3MHSA

Structure of the saga ubp8/sgf11/sus1/sgf73 dub module bound to ubiquitin aldehyde
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
472
structure length
455
Chain Sequence
b'AMSICPHIQQVFQNEKSKDGVLKTCNAARYILNHSVPKEKFLNTMKCGTCHEINSGATFMCLQCGFCGCWNHSHFLSHSKQIGHIFGINSNNGLLFCFKCEDYIGNIDLINDAILAKYWDDVCTKTMVPSMERRDGLSGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNNCKVRSPDKCFSCALDKIVHELYGALNTSTNRQTGFIYLLTCAWKINQNLAGYSQQDAHEFWQFIINQIHQSYVLDLPNNNKQCECIVHTVFEGSLESSIVCPGCQNNSKTTIDPFLDLSLDIKDKKKLYECLDSFHKKEQLKDFNYHCGECNSTQDAIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKNYCSTKEKDKENGKVPDIIYELIGIVSHKGTVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQAYLLFYTIRQVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase 8
publication title Structural insights into the assembly and function of the SAGA deubiquitinating module.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/transcription regulator/protein binding
total genus 134
structure length 455
sequence length 472
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2010-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3mhsA01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3mhsA02
1AU4A 5FERA 1YT7A 2P7UA 2LGGA 5D1KB 2G8EA 4CDDB 1XWHA 4FJCA 4BBQA 3C6WA 2FT2A 1BORA 1LDKC 4R7EA 2RI7A 5LKZA 3QJ3A 2YHNA 3B79A 3HTKC 2DJGB 1Z60A 2NAAA 2FUDA 1BGOA 3QT4A 1WIMA 1Y4HA 4KLBA 4PP2E 1NL6A 3P5VA 2VHSA 3HCSA 4LKAA 2ECIA 3PHDA 3P5XA 2MA6A 2C2LA 2R9FA 5B79A 2XU4A 1Z2QA 1K2FA 2E01A 2P0RA 3N4CA 3K9MA 5TRBA 2YW8A 4GNEA 2JMDA 2LDRA 2YJBA 1T1HA 2G8JA 2FSAA 3S3QA 2NQIA 4PTBA 3ZPV1 3PBHA 5TDRA 4N4FA 4N3WA 1ME4A 1CQDA 2CSYA 1PXVA 1F29A 3ZTGA 1X4UA 2DX8A 3L1XA 3V43A 1QMYA 3HCTA 2F6NA 2G45A 2YJCA 3HWNA 3SOUA 2R9NA 1PBHA 1X9YA 2OZ2A 1PPPA 1WEUA 1EWMA 2HD5A 3CBKA 2PBHA 2PUYA 4GNDA 3CBJA 2JQGR 1VJVA 4AYCB 2EGPA 4G54A 2VPGA 1JM7B 3O35A 2CT2A 1TLOA 1PCIA 4PADA 5B8DA 4YYRA 3RVXA 2QIZA 1E4UA 3FL2A 3P5UA 4YV8A 3V6CA 5D1MB 4YAXA 3BC3A 1CB5A 4F52B 1CVZA 1CPJA 4WZ3B 4FK5A 2G6QA 2F7DA 3MHSA 4PPEA 1VSNA 3KSEA 1X4IA 3N9MA 4Q6FA 4XI1A 3C5KA 5B78A 1WEEA 4L7XA 1TU6A 3KNVA 2ECWA 3LRQA 1IWDA 3RVWA 1WESA 1X4JA 3U8EA 4N79A 2K4DA 3LQJA 2M6MA 5CVOB 2OP3A 3TNXA 4YVAA 4OEMA 5H1TA 2AYNA 3KW9A 2R9MA 2IPPB 2KYUA 1WEOA 3I2DA 1MS6A 2HDPA 1EWPA 4C9ZA 1QXPA 1G25A 1SP4B 4X6IA 3PNRA 1WEQA 2Y43A 3T7LA 3N3GA 2M3HA 3O7AA 1MM3A 2CIOA 5PADA 2KU3A 1PE6A 5FB0A 5TBNA 4UP0A 3MORA 2XU3A 1AU3A 2PNXA 4P6GA 1ME3A 4YYWA 3L11A 3E1ZB 3U5PA 3H8BA 2DJFB 2IBIA 5CVNB 1KFXL 3WXEA 1GCBA 2DC8A 3NHEA 5I3LA 1SNKA 1AYWA 1MEGA 1Z6UA 4I04A 2ZETC 3O37A 5DKAA 1AYVA 3IV2A 3O1GA 4XR7A 4W5CA 2M85A 1U6GB 4B7YC 5EGWA 2P86A 1F2CA 1F62A 3AI8A 3IEJA 4BS6A 3SOWA 5TABA 2AUXA 2H0DA 4QF2A 5CVMA 2LGLA 4A0CD 1WENA 2YREA 4QF3A 3H89A 2QJ0A 3GV4A 5LKTA 4IC2A 3PW3A 1Y08A 3IOQA 1BP4A 1S4VA 4XUIA 1PPOA 2VNFA 3N9PA 2AN6A 1FH0A 1A6RA 4N4ZA 3ZPVE 4B86C 2CKLA 5G0FA 2AYOA 2KWJA 2KGIA 2MNYA 3N9OA 4ZUXU 1ICFA 1MDWA 1GMYA 2XEUA 4OELA 5H1VA 3RPGC 4A49A 4I7BA 2C0YA 2E03A 4CDEB 2L5UA 2VJEB 2KR4A 1F2AA 2YT5A 1WILA 1JQPA 1ZCMA 4AP4A 1O0EA 2KWOA 3WXFA 1KXRA 2KE1A 1WEVA 7PCKA 3LXSA 3LFYA 4YABA 2LXHC 4IC3A 2ECJA 3ZNIA 2JMIA 1V87A 2EODA 4QRVA 2YURA 1U9VA 2R6NA 2H7JA 4YYUA 1VFYA 5FPWA 5JA7A 3HCUA 1HUCB 4WA6A 4FIPA 1KFUL 4CA1A 2DZZA 3KFQA 1EWOA 1POPA 3BCNA 3ZVZB 5KH7A 5CHVA 4R2YA 2L80A 5DINA 4W5BA 3EB5A 4DMXA 1M6DA 9PAPA 2FRQA 2ECTA 2YQLA 3CH3X 4YYQA 2I50A 1YK7A 2E6RA 2DCCA 2F1GA 4DMYA 2NQGA 3IUTA 1MHWA 2UZGA 4L58A 2HXZA 1QOLA 2CSZA 1YK8A 2FRAA 3USVA 1AYUA 1PADA 3VK6A 2E00A 3PDFA 2DC6A 4NN2A 2L43A 1PPDA 1DVPA 2R9CA 2LV9A 2KWNA 3RPGB 3NG2A 1HYJA 5G05B 1ZBDB 2AS8A 3HHAA 2YJ8A 3OISA 2BAYA 3QZVA 2KREA 4AVXA 1NLJA 4YATA 2K1JA 2L75A 1WE9A 3F75A 3I06A 1NQCA 2ECNA 2JRJA 3WXGA 3GCBA 3KV5A 2YU4A 3N9LA 1N87A 1U9WA 5LKXA 1CSBB 2VPDA 4UP5A 4FO9A 1THEA 1MEMA 1WEMA 2ACTA 3MTNA 4AYCA 3K8UA 2XU1A 4K7CA 4A4BA 1AU2A 2L0BA 3BOWA 5G04B 5A24A 3MHHA 2LQ6A 3DQVR 2ARYA 4P6EA 1JM7A 2JQFR 3KKUA 1GECE 3OVZA 2DCDA 4A4CA 2YHOA 4MSXA 4ZDTA 4AXLA 4AXMA 2Y6EA 2YYRA 1CV8A 4X3GA 4BQVA 2LGKA 2RSDA 2FUUA 2KGGA 4ZQLA 4CCGX 5EF4A 4V3KC 3SOXA 4LK9A 2YSMA 5J94A 2IDAA 3BPFA 4I7DA 1VYXA 2G43A 2DZYA 4BPVA 4GNGA 5J3XA 4QRGA 2ECGA 5D1LB 2D8SA 4UI9B 1U5IA 1PIPA 3ZYQA 4QH6A 2HH5A 2K16A 5C11A 1PPNA 4YBMA 2FYEA 2Y5BA 3H8CA 3KV6A 4YBSA 2AVWA 3T6RA 2VJFA 3DPLR 1Q6KA 2BDZA 2AUZA 2E6SA 1NB3A 1LDJB 3N9QA 2YJ9A 2C2VS 3U5OA 2FQ9A 1U9QX 3LQIA 1FBVA 4WZ0A 2HYED 2F6JA 3H6SA 3RVVA 2BDLA 1YVBA 4MVTA 3H7DA 4I07A 5C13A 2DCBA 5FB1A 1GLOA 2OULA 2DC7A 2JMJA 5B77A 3EB6A 3U5NA 2QICA 2YSJA 3M63A 5LKUA 1ZIVA 5K16A 1ATKA 1FP0A 3HD3A 4I05A 3ZVYA 1TL9A 3OVXA 3IMAA 3KWBX 1CHCA 3ERVA 3P5WA 4LADB 2HHNA 5EYAF 2B1NA 3S3RA 5F02A 4Q8HA 2NQAA 2MUMA 4PI3A 4BS5A 8PCHA 2EA6A 2KIZA 4PP1A 3PUQA 5H1UA 4AUQB 3C9EA 3V6EA 3LQHA 2FUIA 2K17A 5AITA 1XKGA 2PADA 2Y1NA 1AECA 2LGVA 1JOCA 2VPBA 4QBBA 2YQMA 2DCAA 2OXQC 2Y1MA 1U9XA 4BHWA 2ECVA 2LRIC 5AIUA 1EWLA 5LCWB 3O36A 3IHPA 1DF0A 2M1RA 3L1ZB 2XB1A 4S3OC 1KHQA 3O70A 1F2BA 4CDFB 1KHPA 5KH3A 3CH2X 4W4UA 2MT5A 1NB5A 4MZOA 4R8PK 4Q8GA 1ITOA 4WZ2A 2LN0A 1MM2A 3O33A 1EF7A 3HHIA 2ATOA 3RTRB 2B1MA 1YALA 3QSDA 5H9MA 3BWKA 1QDQA 2AU1A 4YC9A 3PURA 3KQIA 5TDWA 4X6HA 6PADA 3N3KA 2O6XA 2VJEA 3ZUAA 2G6DA 4TKPB 2LXPC 2PREA 4RY2A 3OF8A 2E02A 2XU5A 3O0UA 3M62A 4P5OB 1VD4A 2KFTA 1AIMA 5CHTA 4N8WA 2MIQA 2MA5A 2VHFA 1WEWA 3M99A 2AIMA 4BSQA 3BPMA 2GHUA 1RMDA 2GFOA 4QRXA 4O64A 1IYMA 4GB0A 2R9OA 3ASLA 4GNFA 5JG6A 3SHBA 4YYSA 2KWKA 3K24A 5KH9A 2MNZA 4YYVA 1WGMA 4LLBA 2H0DB 2YUCA 3I3TA 4LJNA 2VJFB 4CZWA 1DEUA 1HYIA 3O34A 1CJLA 4MZSA 2FTDA 5JH3A 3OF9A 4YADA 1STFE 1NPZA 5FEYA 4S3OB 2FO5A 4X6JA 4V3LC 2CKLB 1CS8A 1BQIA 3U5MA 2YJ2A 2MD8C 3DF0A 3KX1A 1K3BB 4CDCB 1WFKA 2NQDB 3F5VA 5B75A 2VP7A 2MD7B 3N9NA 1MIRA 4HWYA 3D6SA 2PNSA 4I7CA 1AU0A 1CTEA 2G7YA 2DC9A 1WEPA 2CB5A 2F42A 2WBFX 5B76A 3KWZA 1BY8A 3GL6A 2VPEA 4YBTA
chains in the Genus database with same CATH superfamily
1AU4A 5FERA 1YT7A 2P7UA 2LGGA 5D1KB 2G8EA 4CDDB 4OGCA 2KKYA 1XWHA 4FJCA 4BBQA 3C6WA 2FT2A 4OVZB 1BORA 1LDKC 4R7EA 2RI7A 5LKZA 3C0RA 3QJ3A 2CRWA 2YHNA 3B79A 3HTKC 2DJGB 1Z60A 2NAAA 2CRRA 2FUDA 1BGOA 3QT4A 1WIMA 1Y4HA 4KLBA 4PP2E 3PT2A 1NL6A 3P5VA 2MKEA 2VHSA 3HCSA 4LKAA 2ECIA 3PHDA 3P5XA 2MA6A 2FE8A 2C2LA 2R9FA 4H9DA 5B79A 2XU4A 1Z2QA 1K2FA 2E01A 2P0RA 3N4CA 3K9MA 5TRBA 2YW8A 4GNEA 2JMDA 2LDRA 2YJBA 1T1HA 3PHUA 2G8JA 2FSAA 2LAUA 3S3QA 2NQIA 2CSVA 4PTBA 3ZPV1 3PBHA 5TDRA 4N4FA 1UKFA 4N3WA 1ME4A 1CQDA 2CSYA 1PXVA 1F29A 3ZTGA 1X4UA 2DX8A 3L1XA 3V43A 1QMYA 3HCTA 2F6NA 2G45A 2YJCA 3HWNA 3SOUA 2XOZA 2R9NA 1PBHA 1X9YA 2OZ2A 1PPPA 2BTWA 1WEUA 1EWMA 2HD5A 3CBKA 2PBHA 3PHXA 2PUYA 3LVQE 4GNDA 4MI7A 2IQJA 3CBJA 2JQGR 1VJVA 3OQCA 4AYCB 2OWAA 2EGPA 4G54A 2P57A 2VPGA 1JM7B 3O35A 2CT2A 1TLOA 1PCIA 4PADA 5B8DA 5E6JA 4YYRA 3RVXA 2DJAA 2QIZA 1E4UA 3FL2A 3P5UA 4YV8A 3V6CA 5D1MB 4YAXA 3BC3A 3MDBC 4F52B 1CB5A 1CVZA 1CPJA 4WZ3B 4FK5A 2G6QA 2F7DA 3MHSA 4PPEA 5K3QA 1VSNA 2XOYA 3KSEA 1X4IA 3MP2A 3N9MA 4Q6FA 4XI1A 3C5KA 5B78A 1WEEA 4L7XA 2JRIA 1TU6A 4MM3B 3KNVA 2ECWA 4PT5A 3LRQA 3SUBA 1IWDA 3RVWA 4RNAA 1WESA 2DOSA 3PRPA 3Q1DA 1X4JA 3U8EA 4N79A 2K4DA 3LQJA 2M6MA 5CVOB 2OP3A 3TNXA 4YVAA 4OEMA 5H1TA 3FEHA 2AYNA 3KW9A 2R9MA 2IPPB 4BOUA 2KYUA 1WEOA 3I2DA 1MS6A 2HDPA 1EWPA 4C9ZA 1QXPA 1G25A 1SP4B 4X6IA 3PNRA 1WEQA 2Y43A 2FFWA 3T7LA 3N3GA 2M3HA 3O7AA 1MM3A 2CIOA 5PADA 2KU3A 1PE6A 5FB0A 5TBNA 3H7HA 4UP0A 1DCQA 3MORA 2XU3A 4BOSA 1AU3A 2PNXA 3BY4A 4P6GA 1ME3A 4QQ4A 4YYWA 3L11A 3E1ZB 3U5PA 3H8BA 2DJFB 2IBIA 5CVNB 1KFXL 3WXEA 1GCBA 2DC8A 3NHEA 5I3LA 1SNKA 1AYWA 1MEGA 1Z6UA 4I04A 2ZETC 3O37A 5DKAA 1AYVA 3IV2A 3O1GA 4XR7A 2L7PA 4W5CA 2J7QC 2M85A 1U6GB 4B7YC 5EGWA 2P86A 1F2CA 1F62A 3AI8A 3IEJA 4BS6A 3SOWA 5TABA 2AUXA 2H0DA 4QF2A 5CVMA 2LGLA 4A0CD 1WENA 2YREA 4QF3A 3H89A 2QJ0A 3GV4A 5LKTA 4IC2A 4O62A 3PW3A 1PVJA 1Y08A 3IOQA 1BP4A 1S4VA 4XUIA 1PPOA 2XP0A 2VNFA 3N9PA 2AN6A 1FH0A 1A6RA 4N4ZA 3ZPVE 1MBMA 2CKLA 5G0FA 4B86C 2AYOA 2KWJA 3PSEA 2KGIA 2MNYA 3N9OA 4ZUXU 1ICFA 1MDWA 1GMYA 2XEUA 4OELA 5H1VA 3RPGC 4A49A 4I7BA 2C0YA 2E03A 4CDEB 2L5UA 2VJEB 2KR4A 1F2AA 2YT5A 1WILA 3FJUB 1JQPA 1ZCMA 3FM8C 4AP4A 3JUEA 1O0EA 2KWOA 3WXFA 1KXRA 2KE1A 1WEVA 7PCKA 3LXSA 3LFYA 4YABA 2LXHC 4IC3A 2ECJA 3ZNIA 2JMIA 1V87A 2EODA 4QRVA 2YURA 1DKIA 1U9VA 2R6NA 4A5UA 2H7JA 3MTVA 3FAOA 1VFYA 5FPWA 4YYUA 5JA7A 4REZA 3HCUA 1HUCB 4BOQA 4WA6A 4FIPA 1KFUL 4CA1A 3E9SA 2DZZA 3KFQA 1EWOA 1POPA 4OVZA 3BCNA 3ZVZB 5KH7A 3TMPA 5CHVA 4R2YA 2L80A 5DINA 4W5BA 3EB5A 3W30A 5JZEA 4DMXA 1M6DA 9PAPA 2FRQA 2ECTA 2YQLA 3CH3X 4YYQA 2I50A 3BBAA 1YK7A 2D8UA 2E6RA 2DCCA 2F1GA 3IFUA 2NQGA 4DMYA 3IUTA 5SVIB 1MHWA 2UZGA 4L58A 4IP3A 2HXZA 3TRKA 1QOLA 2CSZA 1YK8A 2FRAA 3USVA 1AYUA 1PADA 3VK6A 2E00A 2RR4A 3PDFA 4RKXA 2DC6A 4NN2A 2L43A 1PPDA 4D8EA 1DVPA 2R9CA 2LV9A 2KWNA 3RPGB 3NG2A 1HYJA 4D8BA 5G05B 1ZBDB 2AS8A 3HHAA 2YJ8A 3OISA 4P16A 2BAYA 3QZVA 2KREA 4AVXA 3M7KA 4YATA 1NLJA 2K1JA 2L75A 1WE9A 3F75A 3I06A 3MJ5A 1NQCA 2ECNA 2JRJA 3WXGA 3GCBA 3KV5A 2YU4A 3N9LA 1N87A 1U9WA 5LKXA 1CSBB 2VPDA 4UP5A 4FO9A 1THEA 3DWDA 1WEMA 1MEMA 2ACTA 2M13A 3MTNA 4AYCA 3K8UA 2XU1A 4K7CA 4A4BA 1AU2A 2L0BA 3BOWA 5G04B 5A24A 3MHHA 2BU3A 2LQ6A 3DQVR 2ARYA 4P6EA 1JM7A 3LDYA 2JQFR 3KKUA 1GECE 3OVZA 2DCDA 4A4CA 2YHOA 4MSXA 4F1PA 4ZDTA 5EZQA 4AXLA 4AXMA 2Y6EA 2YYRA 1CV8A 4GUAA 4X3GA 4BQVA 2LGKA 2RSDA 2FUUA 2KGGA 4ZQLA 4CCGX 3PHWA 4IUMA 5EF4A 4V3KC 4LK9A 2YSMA 3SOXA 5J94A 2IDAA 2JTCA 3BPFA 4I7DA 1VYXA 2G43A 4Z0OA 2DZYA 4BPVA 4GNGA 5J3XA 4QRGA 2ECGA 2B0OE 5D1LB 2D8SA 4UI9B 1U5IA 1PIPA 3ZYQA 4QH6A 2HH5A 2EXUA 2K16A 5C11A 1PPNA 4YBMA 2FYEA 2Y5BA 2AGAA 3H8CA 3KV6A 4YBSA 2AVWA 3PRMA 2BTWB 2UZJA 3T6RA 2VJFA 3DPLR 1Q6KA 2BDZA 2AUZA 2E6SA 1NB3A 1LDJB 3N9QA 2YJ9A 2C2VS 3U5OA 2FQ9A 1U9QX 3LQIA 1FBVA 4WZ0A 2HYED 2F6JA 3H6SA 3RVVA 2BDLA 5SVXA 1YVBA 4MVTA 3H7DA 4I07A 5C13A 2DCBA 5FB1A 1GLOA 2OULA 2DC7A 2JMJA 5B77A 3EB6A 3ZNHA 3U5NA 2QICA 2YSJA 3M63A 4D8IA 5LKUA 1ZIVA 5K16A 3W31A 1ATKA 1FP0A 3E2DA 3HD3A 4I05A 3ZVYA 1TL9A 2FD4A 3OVXA 3IMAA 3KWBX 1CHCA 3ERVA 3P5WA 4LADB 2HHNA 5EYAF 2B1NA 3S3RA 5F02A 4Q8HA 2NQAA 2MUMA 4PI3A 3O65A 4BS5A 8PCHA 2EA6A 2KIZA 4OGEA 4PP1A 3PUQA 5H1UA 4AUQB 3C9EA 4RF1A 3V6EA 3LQHA 2FUIA 2K17A 5AITA 1XKGA 2PADA 2EGMA 2Y1NA 1AECA 2KKXA 4XZXA 2LGVA 4Z0RA 1JOCA 2VPBA 4QBBA 3DDTA 2YQMA 2DCAA 2OXQC 2Y1MA 1U9XA 4BHWA 4RF0A 1YZBA 2ECVA 2LRIC 5AIUA 4M0WA 1EWLA 5LCWB 3O36A 3IHPA 1DF0A 2M1RA 3L1ZB 4ZTBA 2XB1A 4S3OC 1KHQA 3O70A 3KDEC 1F2BA 4CDFB 1KHPA 2HWKA 5KH3A 3CH2X 4W4UA 2MT5A 1NB5A 4MZOA 4R8PK 4Q8GA 1ITOA 4WZ2A 5SVYA 2LN0A 1MM2A 2CONA 4R3DA 3O47A 3PLWA 3O33A 1EF7A 3HHIA 3FANA 2ATOA 3RTRB 2B1MA 1YALA 3QSDA 5H9MA 3BWKA 1QDQA 2AU1A 4YC9A 3PURA 3KQIA 5TDWA 3T9KA 4X6HA 6PADA 3N3KA 2O6XA 2VJEA 3ZUAA 2G6DA 4TKPB 2LXPC 2PREA 4RY2A 3OF8A 2E02A 2XU5A 3O0UA 2DSMA 3M62A 4P5OB 1VD4A 4HXDB 2KFTA 5EZSA 1AIMA 5CHTA 4N8WA 2MIQA 2MA5A 2VHFA 2YVRA 1WEWA 3M99A 2Z84A 2AIMA 4BSQA 3BPMA 2GHUA 1RMDA 2GFOA 4QRXA 4O64A 1IYMA 2E61A 4GB0A 4BOPA 2R9OA 3ASLA 4GNFA 5JG6A 3SHBA 4YYSA 3B21A 4WURA 2KWKA 3K24A 5KH9A 2MNZA 4YYVA 1WGMA 4LLBA 2H0DB 2YUCA 3LJUX 3I3TA 4LJNA 2VJFB 4CZWA 1DEUA 1HYIA 3O34A 1CJLA 4MZSA 2FTDA 5JH3A 2JUNA 3OF9A 2J7QA 4YADA 1STFE 1NPZA 5FEYA 4S3OB 2FO5A 4X6JA 4V3LC 5KO3A 2CKLB 1CS8A 1BQIA 3U5MA 2YJ2A 2MD8C 3DF0A 3KX1A 1K3BB 4CDCB 1WFKA 2NQDB 3F5VA 5B75A 2VP7A 2JM3A 2MD7B 3N9NA 1MIRA 4HWYA 5SVIA 3D6SA 4OW0A 3BB7A 4BOZA 2XOCA 2PNSA 4I7CA 1AU0A 1CTEA 2G7YA 2DC9A 1WEPA 3LVRE 2CB5A 2F42A 2WBFX 5B76A 3KWZA 1BY8A 3RNVA 3GL6A 2VPEA 4YBTA
chains in the Genus database with same CATH topology
1AU4A 5FERA 1YT7A 2P7UA 2LGGA 5D1KB 2G8EA 4CDDB 1XWHA 4FJCA 4BBQA 3C6WA 2FT2A 1BORA 1LDKC 4R7EA 2RI7A 5LKZA 3QJ3A 2YHNA 4NV7A 3B79A 4BGFA 3HTKC 2DJGB 1Z60A 2NAAA 2FUDA 1BGOA 3QT4A 1WIMA 1Y4HA 4KLBA 4PP2E 1NL6A 3P5VA 2VHSA 3HCSA 4LKAA 2ECIA 3PHDA 3P5XA 2MA6A 2C2LA 2R9FA 2VFBA 5B79A 2XU4A 1Z2QA 1K2FA 2E01A 2P0RA 3N4CA 3K9MA 5TRBA 2YW8A 4GNEA 2JMDA 2LDRA 2YJBA 1T1HA 2G8JA 2FSAA 3S3QA 2NQIA 4PTBA 3ZPV1 1W5RA 3PBHA 5TDRA 4N4FA 4N3WA 1ME4A 1CQDA 2CSYA 1PXVA 1F29A 3ZTGA 1X4UA 2DX8A 3L1XA 3V43A 1QMYA 3HCTA 2F6NA 2G45A 2YJCA 3HWNA 3SOUA 2R9NA 1PBHA 1X9YA 2OZ2A 1PPPA 1WEUA 1EWMA 2HD5A 3CBKA 2PBHA 2PUYA 4GNDA 3CBJA 2JQGR 1VJVA 4AYCB 2EGPA 4G54A 2VPGA 1JM7B 3O35A 2CT2A 1TLOA 1PCIA 4PADA 5B8DA 4YYRA 3RVXA 2QIZA 1E4UA 3FL2A 3P5UA 4YV8A 3V6CA 5D1MB 4YAXA 3BC3A 1CB5A 4F52B 1CVZA 1CPJA 4WZ3B 4FK5A 2G6QA 2F7DA 3MHSA 4PPEA 1VSNA 3KSEA 1X4IA 3N9MA 4Q6FA 4XI1A 3C5KA 5B78A 1WEEA 4L7XA 1TU6A 3KNVA 2ECWA 3LRQA 1IWDA 3RVWA 1WESA 1X4JA 3U8EA 4N79A 2K4DA 3LQJA 2M6MA 5CVOB 2OP3A 3TNXA 4YVAA 4OEMA 5H1TA 2AYNA 3KW9A 2R9MA 2IPPB 2KYUA 1WEOA 3I2DA 1MS6A 2HDPA 1EWPA 4C9ZA 1QXPA 1G25A 1SP4B 4X6IA 3PNRA 1WEQA 2Y43A 3T7LA 3N3GA 2M3HA 3O7AA 1MM3A 2CIOA 5PADA 2KU3A 1PE6A 5FB0A 5TBNA 4UP0A 3MORA 2XU3A 1AU3A 2PNXA 4P6GA 1ME3A 4YYWA 3L11A 3E1ZB 3U5PA 3H8BA 2DJFB 2IBIA 5CVNB 1KFXL 3WXEA 1GCBA 2DC8A 3NHEA 5I3LA 1SNKA 1AYWA 1MEGA 1Z6UA 4I04A 2ZETC 3O37A 5DKAA 1AYVA 3IV2A 3O1GA 4XR7A 4W5CA 2M85A 1U6GB 4B7YC 5EGWA 3D9WA 2P86A 1F2CA 1F62A 3AI8A 3IEJA 4BS6A 3SOWA 5TABA 2AUXA 2H0DA 4QF2A 5CVMA 2LGLA 4A0CD 1WENA 2YREA 4QF3A 3H89A 2QJ0A 3GV4A 5LKTA 4IC2A 3PW3A 1Y08A 3IOQA 1BP4A 1S4VA 4XUIA 1PPOA 2VNFA 3N9PA 2AN6A 1FH0A 1A6RA 4N4ZA 3ZPVE 4B86C 2CKLA 5G0FA 2AYOA 2KWJA 2KGIA 2MNYA 3N9OA 4ZUXU 1ICFA 1MDWA 1GMYA 2XEUA 4OELA 5H1VA 3RPGC 4A49A 2VFCA 4I7BA 2C0YA 2E03A 4CDEB 2L5UA 2VJEB 2KR4A 1F2AA 2YT5A 1WILA 1JQPA 1ZCMA 4AP4A 1O0EA 2KWOA 3WXFA 1KXRA 2KE1A 1WEVA 7PCKA 3LXSA 3LFYA 4YABA 2LXHC 4IC3A 2ECJA 3ZNIA 2JMIA 1V87A 2EODA 4QRVA 2YURA 1U9VA 2R6NA 2BSZA 2H7JA 4YYUA 1VFYA 5FPWA 5JA7A 3HCUA 1HUCB 4WA6A 4FIPA 1KFUL 4CA1A 2DZZA 3KFQA 1EWOA 1POPA 3BCNA 3ZVZB 5KH7A 5CHVA 4R2YA 2L80A 5DINA 4W5BA 3EB5A 4DMXA 1M6DA 9PAPA 2FRQA 2ECTA 2YQLA 3CH3X 4YYQA 2I50A 1YK7A 2E6RA 2DCCA 2F1GA 4DMYA 2NQGA 3IUTA 1MHWA 2UZGA 4L58A 2HXZA 1QOLA 2CSZA 1YK8A 2FRAA 3USVA 1AYUA 1PADA 3VK6A 2E00A 3PDFA 2DC6A 4NN2A 2L43A 1PPDA 1DVPA 2R9CA 2LV9A 2KWNA 3RPGB 3NG2A 1HYJA 5G05B 1ZBDB 2AS8A 3HHAA 2YJ8A 3OISA 2BAYA 3QZVA 2KREA 4AVXA 1NLJA 4YATA 2K1JA 2L75A 1WE9A 3F75A 3I06A 1NQCA 2ECNA 2JRJA 3WXGA 3GCBA 3KV5A 2YU4A 3N9LA 1N87A 1U9WA 5LKXA 1CSBB 2VPDA 4UP5A 4FO9A 1THEA 1MEMA 1WEMA 2ACTA 3MTNA 4AYCA 3K8UA 2XU1A 4K7CA 4A4BA 1AU2A 2L0BA 3BOWA 5G04B 5A24A 3MHHA 2LQ6A 3DQVR 2ARYA 4P6EA 1JM7A 1W4TA 2JQFR 3KKUA 1GECE 3OVZA 2DCDA 4A4CA 2YHOA 4MSXA 4ZDTA 4AXLA 4AXMA 2Y6EA 2YYRA 1CV8A 4X3GA 4BQVA 2LGKA 2RSDA 2FUUA 2KGGA 4ZQLA 4CCGX 5EF4A 4V3KC 3SOXA 4LK9A 2YSMA 5J94A 2IDAA 3BPFA 4I7DA 1VYXA 2G43A 2DZYA 4BPVA 4GNGA 5J3XA 4QRGA 2ECGA 5D1LB 2D8SA 4UI9B 1U5IA 1PIPA 3ZYQA 4GUZA 4QH6A 2HH5A 2K16A 5C11A 1PPNA 4YBMA 2FYEA 2Y5BA 3H8CA 3KV6A 4YBSA 2AVWA 3T6RA 2VJFA 3DPLR 1Q6KA 2BDZA 2AUZA 2E6SA 1NB3A 1LDJB 3N9QA 2YJ9A 2C2VS 3U5OA 2FQ9A 1U9QX 3LQIA 1FBVA 4WZ0A 2HYED 2F6JA 3H6SA 3RVVA 4NV8A 2BDLA 1YVBA 4MVTA 3H7DA 4I07A 5C13A 2DCBA 5FB1A 1GLOA 2OULA 2DC7A 2JMJA 5B77A 3EB6A 3U5NA 1GX3A 2QICA 2YSJA 3M63A 5LKUA 1ZIVA 5K16A 1ATKA 1FP0A 3HD3A 4I05A 3ZVYA 1TL9A 3OVXA 3IMAA 3KWBX 1CHCA 3ERVA 3P5WA 4LADB 2HHNA 5EYAF 2B1NA 3S3RA 5F02A 4Q8HA 2NQAA 2MUMA 4PI3A 4BS5A 8PCHA 2EA6A 2KIZA 4PP1A 3PUQA 5H1UA 4AUQB 3C9EA 3V6EA 3LQHA 2FUIA 2K17A 5AITA 1XKGA 2PADA 2Y1NA 1AECA 2LGVA 1JOCA 2VPBA 4QBBA 2YQMA 2DCAA 2OXQC 2Y1MA 1U9XA 4BHWA 2ECVA 2LRIC 5AIUA 1EWLA 5LCWB 3O36A 3IHPA 1DF0A 2M1RA 3L1ZB 2XB1A 4S3OC 1KHQA 3O70A 1F2BA 4CDFB 1KHPA 5KH3A 3CH2X 4W4UA 2MT5A 1NB5A 4MZOA 4R8PK 4Q8GA 1ITOA 4WZ2A 2LN0A 1MM2A 3O33A 1EF7A 3HHIA 2ATOA 3RTRB 2B1MA 1YALA 3QSDA 5H9MA 3BWKA 1QDQA 2AU1A 4YC9A 3PURA 3KQIA 5TDWA 4X6HA 6PADA 3N3KA 2O6XA 2VJEA 3ZUAA 2G6DA 4B55A 4TKPB 2LXPC 2PREA 4RY2A 3OF8A 2E02A 2XU5A 3O0UA 3M62A 4P5OB 1VD4A 2KFTA 1AIMA 5CHTA 4N8WA 2MIQA 4C5PA 2MA5A 2VHFA 1WEWA 3M99A 2AIMA 4BSQA 3BPMA 2GHUA 1RMDA 2GFOA 4QRXA 4O64A 1IYMA 4GB0A 2R9OA 3ASLA 1W6FA 4GNFA 5JG6A 3SHBA 4YYSA 2KWKA 3K24A 5KH9A 2MNZA 4YYVA 1WGMA 4LLBA 2H0DB 2YUCA 3I3TA 4LJNA 3LTWA 2VJFB 4CZWA 1DEUA 1HYIA 3O34A 1CJLA 4MZSA 2FTDA 5JH3A 3OF9A 4YADA 1STFE 1NPZA 5FEYA 4S3OB 2FO5A 4X6JA 4V3LC 2CKLB 1CS8A 1BQIA 3U5MA 2YJ2A 2MD8C 3DF0A 3KX1A 1K3BB 4CDCB 1WFKA 2NQDB 3F5VA 5B75A 2VP7A 2MD7B 3N9NA 1E2TA 1MIRA 4HWYA 3D6SA 2PNSA 4I7CA 1AU0A 1CTEA 2G7YA 2DC9A 1WEPA 2CB5A 2F42A 2WBFX 5B76A 3KWZA 1BY8A 3GL6A 2VPEA 4YBTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AU4 A;  5FER A;  1YT7 A;  2P7U A;  2LGG A;  5D1K B;  2G8E A;  4CDD B;  1XWH A;  4FJC A;  4BBQ A;  3C6W A;  2FT2 A;  1BOR A;  1LDK C;  4R7E A;  2RI7 A;  5LKZ A;  3QJ3 A;  2YHN A;  3B79 A;  3HTK C;  2DJG B;  1Z60 A;  2NAA A;  2FUD A;  1BGO A;  3QT4 A;  1WIM A;  1Y4H A;  4KLB A;  4PP2 E;  1NL6 A;  3P5V A;  2VHS A;  3HCS A;  4LKA A;  2ECI A;  3PHD A;  3P5X A;  2MA6 A;  2C2L A;  2R9F A;  5B79 A;  2XU4 A;  1Z2Q A;  1K2F A;  2E01 A;  2P0R A;  3N4C A;  3K9M A;  5TRB A;  2YW8 A;  4GNE A;  2JMD A;  2LDR A;  2YJB A;  1T1H A;  2G8J A;  2FSA A;  3S3Q A;  2NQI A;  4PTB A;  3ZPV 1;  3PBH A;  5TDR A;  4N4F A;  4N3W A;  1ME4 A;  1CQD A;  2CSY A;  1PXV A;  1F29 A;  3ZTG A;  1X4U A;  2DX8 A;  3L1X A;  3V43 A;  1QMY A;  3HCT A;  2F6N A;  2G45 A;  2YJC A;  3HWN A;  3SOU A;  2R9N A;  1PBH A;  1X9Y A;  2OZ2 A;  1PPP A;  1WEU A;  1EWM A;  2HD5 A;  3CBK A;  2PBH A;  2PUY A;  4GND A;  3CBJ A;  2JQG R;  1VJV A;  4AYC B;  2EGP A;  4G54 A;  2VPG A;  1JM7 B;  3O35 A;  2CT2 A;  1TLO A;  1PCI A;  4PAD A;  5B8D A;  4YYR A;  3RVX A;  2QIZ A;  1E4U A;  3FL2 A;  3P5U A;  4YV8 A;  3V6C A;  5D1M B;  4YAX A;  3BC3 A;  1CB5 A;  4F52 B;  1CVZ A;  1CPJ A;  4WZ3 B;  4FK5 A;  2G6Q A;  2F7D A;  3MHS A;  4PPE A;  1VSN A;  3KSE A;  1X4I A;  3N9M A;  4Q6F A;  4XI1 A;  3C5K A;  5B78 A;  1WEE A;  4L7X A;  1TU6 A;  3KNV A;  2ECW A;  3LRQ A;  1IWD A;  3RVW A;  1WES A;  1X4J A;  3U8E A;  4N79 A;  2K4D A;  3LQJ A;  2M6M A;  5CVO B;  2OP3 A;  3TNX A;  4YVA A;  4OEM A;  5H1T A;  2AYN A;  3KW9 A;  2R9M A;  2IPP B;  2KYU A;  1WEO A;  3I2D A;  1MS6 A;  2HDP A;  1EWP A;  4C9Z A;  1QXP A;  1G25 A;  1SP4 B;  4X6I A;  3PNR A;  1WEQ A;  2Y43 A;  3T7L A;  3N3G A;  2M3H A;  3O7A A;  1MM3 A;  2CIO A;  5PAD A;  2KU3 A;  1PE6 A;  5FB0 A;  5TBN A;  4UP0 A;  3MOR A;  2XU3 A;  1AU3 A;  2PNX A;  4P6G A;  1ME3 A;  4YYW A;  3L11 A;  3E1Z B;  3U5P A;  3H8B A;  2DJF B;  2IBI A;  5CVN B;  1KFX L;  3WXE A;  1GCB A;  2DC8 A;  3NHE A;  5I3L A;  1SNK A;  1AYW A;  1MEG A;  1Z6U A;  4I04 A;  2ZET C;  3O37 A;  5DKA A;  1AYV A;  3IV2 A;  3O1G A;  4XR7 A;  4W5C A;  2M85 A;  1U6G B;  4B7Y C;  5EGW A;  2P86 A;  1F2C A;  1F62 A;  3AI8 A;  3IEJ A;  4BS6 A;  3SOW A;  5TAB A;  2AUX A;  2H0D A;  4QF2 A;  5CVM A;  2LGL A;  4A0C D;  1WEN A;  2YRE A;  4QF3 A;  3H89 A;  2QJ0 A;  3GV4 A;  5LKT A;  4IC2 A;  3PW3 A;  1Y08 A;  3IOQ A;  1BP4 A;  1S4V A;  4XUI A;  1PPO A;  2VNF A;  3N9P A;  2AN6 A;  1FH0 A;  1A6R A;  4N4Z A;  3ZPV E;  4B86 C;  2CKL A;  5G0F A;  2AYO A;  2KWJ A;  2KGI A;  2MNY A;  3N9O A;  4ZUX U;  1ICF A;  1MDW A;  1GMY A;  2XEU A;  4OEL A;  5H1V A;  3RPG C;  4A49 A;  4I7B A;  2C0Y A;  2E03 A;  4CDE B;  2L5U A;  2VJE B;  2KR4 A;  1F2A A;  2YT5 A;  1WIL A;  1JQP A;  1ZCM A;  4AP4 A;  1O0E A;  2KWO A;  3WXF A;  1KXR A;  2KE1 A;  1WEV A;  7PCK A;  3LXS A;  3LFY A;  4YAB A;  2LXH C;  4IC3 A;  2ECJ A;  3ZNI A;  2JMI A;  1V87 A;  2EOD A;  4QRV A;  2YUR A;  1U9V A;  2R6N A;  2H7J A;  4YYU A;  1VFY A;  5FPW A;  5JA7 A;  3HCU A;  1HUC B;  4WA6 A;  4FIP A;  1KFU L;  4CA1 A;  2DZZ A;  3KFQ A;  1EWO A;  1POP A;  3BCN A;  3ZVZ B;  5KH7 A;  5CHV A;  4R2Y A;  2L80 A;  5DIN A;  4W5B A;  3EB5 A;  4DMX A;  1M6D A;  9PAP A;  2FRQ A;  2ECT A;  2YQL A;  3CH3 X;  4YYQ A;  2I50 A;  1YK7 A;  2E6R A;  2DCC A;  2F1G A;  4DMY A;  2NQG A;  3IUT A;  1MHW A;  2UZG A;  4L58 A;  2HXZ A;  1QOL A;  2CSZ A;  1YK8 A;  2FRA A;  3USV A;  1AYU A;  1PAD A;  3VK6 A;  2E00 A;  3PDF A;  2DC6 A;  4NN2 A;  2L43 A;  1PPD A;  1DVP A;  2R9C A;  2LV9 A;  2KWN A;  3RPG B;  3NG2 A;  1HYJ A;  5G05 B;  1ZBD B;  2AS8 A;  3HHA A;  2YJ8 A;  3OIS A;  2BAY A;  3QZV A;  2KRE A;  4AVX A;  1NLJ A;  4YAT A;  2K1J A;  2L75 A;  1WE9 A;  3F75 A;  3I06 A;  1NQC A;  2ECN A;  2JRJ A;  3WXG A;  3GCB A;  3KV5 A;  2YU4 A;  3N9L A;  1N87 A;  1U9W A;  5LKX A;  1CSB B;  2VPD A;  4UP5 A;  4FO9 A;  1THE A;  1MEM A;  1WEM A;  2ACT A;  3MTN A;  4AYC A;  3K8U A;  2XU1 A;  4K7C A;  4A4B A;  1AU2 A;  2L0B A;  3BOW A;  5G04 B;  5A24 A;  3MHH A;  2LQ6 A;  3DQV R;  2ARY A;  4P6E A;  1JM7 A;  2JQF R;  3KKU A;  1GEC E;  3OVZ A;  2DCD A;  4A4C A;  2YHO A;  4MSX A;  4ZDT A;  4AXL A;  4AXM A;  2Y6E A;  2YYR A;  1CV8 A;  4X3G A;  4BQV A;  2LGK A;  2RSD A;  2FUU A;  2KGG A;  4ZQL A;  4CCG X;  5EF4 A;  4V3K C;  3SOX A;  4LK9 A;  2YSM A;  5J94 A;  2IDA A;  3BPF A;  4I7D A;  1VYX A;  2G43 A;  2DZY A;  4BPV A;  4GNG A;  5J3X A;  4QRG A;  2ECG A;  5D1L B;  2D8S A;  4UI9 B;  1U5I A;  1PIP A;  3ZYQ A;  4QH6 A;  2HH5 A;  2K16 A;  5C11 A;  1PPN A;  4YBM A;  2FYE A;  2Y5B A;  3H8C A;  3KV6 A;  4YBS A;  2AVW A;  3T6R A;  2VJF A;  3DPL R;  1Q6K A;  2BDZ A;  2AUZ A;  2E6S A;  1NB3 A;  1LDJ B;  3N9Q A;  2YJ9 A;  2C2V S;  3U5O A;  2FQ9 A;  1U9Q X;  3LQI A;  1FBV A;  4WZ0 A;  2HYE D;  2F6J A;  3H6S A;  3RVV A;  2BDL A;  1YVB A;  4MVT A;  3H7D A;  4I07 A;  5C13 A;  2DCB A;  5FB1 A;  1GLO A;  2OUL A;  2DC7 A;  2JMJ A;  5B77 A;  3EB6 A;  3U5N A;  2QIC A;  2YSJ A;  3M63 A;  5LKU A;  1ZIV A;  5K16 A;  1ATK A;  1FP0 A;  3HD3 A;  4I05 A;  3ZVY A;  1TL9 A;  3OVX A;  3IMA A;  3KWB X;  1CHC A;  3ERV A;  3P5W A;  4LAD B;  2HHN A;  5EYA F;  2B1N A;  3S3R A;  5F02 A;  4Q8H A;  2NQA A;  2MUM A;  4PI3 A;  4BS5 A;  8PCH A;  2EA6 A;  2KIZ A;  4PP1 A;  3PUQ A;  5H1U A;  4AUQ B;  3C9E A;  3V6E A;  3LQH A;  2FUI A;  2K17 A;  5AIT A;  1XKG A;  2PAD A;  2Y1N A;  1AEC A;  2LGV A;  1JOC A;  2VPB A;  4QBB A;  2YQM A;  2DCA A;  2OXQ C;  2Y1M A;  1U9X A;  4BHW A;  2ECV A;  2LRI C;  5AIU A;  1EWL A;  5LCW B;  3O36 A;  3IHP A;  1DF0 A;  2M1R A;  3L1Z B;  2XB1 A;  4S3O C;  1KHQ A;  3O70 A;  1F2B A;  4CDF B;  1KHP A;  5KH3 A;  3CH2 X;  4W4U A;  2MT5 A;  1NB5 A;  4MZO A;  4R8P K;  4Q8G A;  1ITO A;  4WZ2 A;  2LN0 A;  1MM2 A;  3O33 A;  1EF7 A;  3HHI A;  2ATO A;  3RTR B;  2B1M A;  1YAL A;  3QSD A;  5H9M A;  3BWK A;  1QDQ A;  2AU1 A;  4YC9 A;  3PUR A;  3KQI A;  5TDW A;  4X6H A;  6PAD A;  3N3K A;  2O6X A;  2VJE A;  3ZUA A;  2G6D A;  4TKP B;  2LXP C;  2PRE A;  4RY2 A;  3OF8 A;  2E02 A;  2XU5 A;  3O0U A;  3M62 A;  4P5O B;  1VD4 A;  2KFT A;  1AIM A;  5CHT A;  4N8W A;  2MIQ A;  2MA5 A;  2VHF A;  1WEW A;  3M99 A;  2AIM A;  4BSQ A;  3BPM A;  2GHU A;  1RMD A;  2GFO A;  4QRX A;  4O64 A;  1IYM A;  4GB0 A;  2R9O A;  3ASL A;  4GNF A;  5JG6 A;  3SHB A;  4YYS A;  2KWK A;  3K24 A;  5KH9 A;  2MNZ A;  4YYV A;  1WGM A;  4LLB A;  2H0D B;  2YUC A;  3I3T A;  4LJN A;  2VJF B;  4CZW A;  1DEU A;  1HYI A;  3O34 A;  1CJL A;  4MZS A;  2FTD A;  5JH3 A;  3OF9 A;  4YAD A;  1STF E;  1NPZ A;  5FEY A;  4S3O B;  2FO5 A;  4X6J A;  4V3L C;  2CKL B;  1CS8 A;  1BQI A;  3U5M A;  2YJ2 A;  2MD8 C;  3DF0 A;  3KX1 A;  1K3B B;  4CDC B;  1WFK A;  2NQD B;  3F5V A;  5B75 A;  2VP7 A;  2MD7 B;  3N9N A;  1MIR A;  4HWY A;  3D6S A;  2PNS A;  4I7C A;  1AU0 A;  1CTE A;  2G7Y A;  2DC9 A;  1WEP A;  2CB5 A;  2F42 A;  2WBF X;  5B76 A;  3KWZ A;  1BY8 A;  3GL6 A;  2VPE A;  4YBT A; 
#chains in the Genus database with same CATH topology
 1AU4 A;  5FER A;  1YT7 A;  2P7U A;  2LGG A;  5D1K B;  2G8E A;  4CDD B;  4OGC A;  2KKY A;  1XWH A;  4FJC A;  4BBQ A;  3C6W A;  2FT2 A;  4OVZ B;  1BOR A;  1LDK C;  4R7E A;  2RI7 A;  5LKZ A;  3C0R A;  3QJ3 A;  2CRW A;  2YHN A;  3B79 A;  3HTK C;  2DJG B;  1Z60 A;  2NAA A;  2CRR A;  2FUD A;  1BGO A;  3QT4 A;  1WIM A;  1Y4H A;  4KLB A;  4PP2 E;  3PT2 A;  1NL6 A;  3P5V A;  2MKE A;  2VHS A;  3HCS A;  4LKA A;  2ECI A;  3PHD A;  3P5X A;  2MA6 A;  2FE8 A;  2C2L A;  2R9F A;  4H9D A;  5B79 A;  2XU4 A;  1Z2Q A;  1K2F A;  2E01 A;  2P0R A;  3N4C A;  3K9M A;  5TRB A;  2YW8 A;  4GNE A;  2JMD A;  2LDR A;  2YJB A;  1T1H A;  3PHU A;  2G8J A;  2FSA A;  2LAU A;  3S3Q A;  2NQI A;  2CSV A;  4PTB A;  3ZPV 1;  3PBH A;  5TDR A;  4N4F A;  1UKF A;  4N3W A;  1ME4 A;  1CQD A;  2CSY A;  1PXV A;  1F29 A;  3ZTG A;  1X4U A;  2DX8 A;  3L1X A;  3V43 A;  1QMY A;  3HCT A;  2F6N A;  2G45 A;  2YJC A;  3HWN A;  3SOU A;  2XOZ A;  2R9N A;  1PBH A;  1X9Y A;  2OZ2 A;  1PPP A;  2BTW A;  1WEU A;  1EWM A;  2HD5 A;  3CBK A;  2PBH A;  3PHX A;  2PUY A;  3LVQ E;  4GND A;  4MI7 A;  2IQJ A;  3CBJ A;  2JQG R;  1VJV A;  3OQC A;  4AYC B;  2OWA A;  2EGP A;  4G54 A;  2P57 A;  2VPG A;  1JM7 B;  3O35 A;  2CT2 A;  1TLO A;  1PCI A;  4PAD A;  5B8D A;  5E6J A;  4YYR A;  3RVX A;  2DJA A;  2QIZ A;  1E4U A;  3FL2 A;  3P5U A;  4YV8 A;  3V6C A;  5D1M B;  4YAX A;  3BC3 A;  3MDB C;  4F52 B;  1CB5 A;  1CVZ A;  1CPJ A;  4WZ3 B;  4FK5 A;  2G6Q A;  2F7D A;  3MHS A;  4PPE A;  5K3Q A;  1VSN A;  2XOY A;  3KSE A;  1X4I A;  3MP2 A;  3N9M A;  4Q6F A;  4XI1 A;  3C5K A;  5B78 A;  1WEE A;  4L7X A;  2JRI A;  1TU6 A;  4MM3 B;  3KNV A;  2ECW A;  4PT5 A;  3LRQ A;  3SUB A;  1IWD A;  3RVW A;  4RNA A;  1WES A;  2DOS A;  3PRP A;  3Q1D A;  1X4J A;  3U8E A;  4N79 A;  2K4D A;  3LQJ A;  2M6M A;  5CVO B;  2OP3 A;  3TNX A;  4YVA A;  4OEM A;  5H1T A;  3FEH A;  2AYN A;  3KW9 A;  2R9M A;  2IPP B;  4BOU A;  2KYU A;  1WEO A;  3I2D A;  1MS6 A;  2HDP A;  1EWP A;  4C9Z A;  1QXP A;  1G25 A;  1SP4 B;  4X6I A;  3PNR A;  1WEQ A;  2Y43 A;  2FFW A;  3T7L A;  3N3G A;  2M3H A;  3O7A A;  1MM3 A;  2CIO A;  5PAD A;  2KU3 A;  1PE6 A;  5FB0 A;  5TBN A;  3H7H A;  4UP0 A;  1DCQ A;  3MOR A;  2XU3 A;  4BOS A;  1AU3 A;  2PNX A;  3BY4 A;  4P6G A;  1ME3 A;  4QQ4 A;  4YYW A;  3L11 A;  3E1Z B;  3U5P A;  3H8B A;  2DJF B;  2IBI A;  5CVN B;  1KFX L;  3WXE A;  1GCB A;  2DC8 A;  3NHE A;  5I3L A;  1SNK A;  1AYW A;  1MEG A;  1Z6U A;  4I04 A;  2ZET C;  3O37 A;  5DKA A;  1AYV A;  3IV2 A;  3O1G A;  4XR7 A;  2L7P A;  4W5C A;  2J7Q C;  2M85 A;  1U6G B;  4B7Y C;  5EGW A;  2P86 A;  1F2C A;  1F62 A;  3AI8 A;  3IEJ A;  4BS6 A;  3SOW A;  5TAB A;  2AUX A;  2H0D A;  4QF2 A;  5CVM A;  2LGL A;  4A0C D;  1WEN A;  2YRE A;  4QF3 A;  3H89 A;  2QJ0 A;  3GV4 A;  5LKT A;  4IC2 A;  4O62 A;  3PW3 A;  1PVJ A;  1Y08 A;  3IOQ A;  1BP4 A;  1S4V A;  4XUI A;  1PPO A;  2XP0 A;  2VNF A;  3N9P A;  2AN6 A;  1FH0 A;  1A6R A;  4N4Z A;  3ZPV E;  1MBM A;  2CKL A;  5G0F A;  4B86 C;  2AYO A;  2KWJ A;  3PSE A;  2KGI A;  2MNY A;  3N9O A;  4ZUX U;  1ICF A;  1MDW A;  1GMY A;  2XEU A;  4OEL A;  5H1V A;  3RPG C;  4A49 A;  4I7B A;  2C0Y A;  2E03 A;  4CDE B;  2L5U A;  2VJE B;  2KR4 A;  1F2A A;  2YT5 A;  1WIL A;  3FJU B;  1JQP A;  1ZCM A;  3FM8 C;  4AP4 A;  3JUE A;  1O0E A;  2KWO A;  3WXF A;  1KXR A;  2KE1 A;  1WEV A;  7PCK A;  3LXS A;  3LFY A;  4YAB A;  2LXH C;  4IC3 A;  2ECJ A;  3ZNI A;  2JMI A;  1V87 A;  2EOD A;  4QRV A;  2YUR A;  1DKI A;  1U9V A;  2R6N A;  4A5U A;  2H7J A;  3MTV A;  3FAO A;  1VFY A;  5FPW A;  4YYU A;  5JA7 A;  4REZ A;  3HCU A;  1HUC B;  4BOQ A;  4WA6 A;  4FIP A;  1KFU L;  4CA1 A;  3E9S A;  2DZZ A;  3KFQ A;  1EWO A;  1POP A;  4OVZ A;  3BCN A;  3ZVZ B;  5KH7 A;  3TMP A;  5CHV A;  4R2Y A;  2L80 A;  5DIN A;  4W5B A;  3EB5 A;  3W30 A;  5JZE A;  4DMX A;  1M6D A;  9PAP A;  2FRQ A;  2ECT A;  2YQL A;  3CH3 X;  4YYQ A;  2I50 A;  3BBA A;  1YK7 A;  2D8U A;  2E6R A;  2DCC A;  2F1G A;  3IFU A;  2NQG A;  4DMY A;  3IUT A;  5SVI B;  1MHW A;  2UZG A;  4L58 A;  4IP3 A;  2HXZ A;  3TRK A;  1QOL A;  2CSZ A;  1YK8 A;  2FRA A;  3USV A;  1AYU A;  1PAD A;  3VK6 A;  2E00 A;  2RR4 A;  3PDF A;  4RKX A;  2DC6 A;  4NN2 A;  2L43 A;  1PPD A;  4D8E A;  1DVP A;  2R9C A;  2LV9 A;  2KWN A;  3RPG B;  3NG2 A;  1HYJ A;  4D8B A;  5G05 B;  1ZBD B;  2AS8 A;  3HHA A;  2YJ8 A;  3OIS A;  4P16 A;  2BAY A;  3QZV A;  2KRE A;  4AVX A;  3M7K A;  4YAT A;  1NLJ A;  2K1J A;  2L75 A;  1WE9 A;  3F75 A;  3I06 A;  3MJ5 A;  1NQC A;  2ECN A;  2JRJ A;  3WXG A;  3GCB A;  3KV5 A;  2YU4 A;  3N9L A;  1N87 A;  1U9W A;  5LKX A;  1CSB B;  2VPD A;  4UP5 A;  4FO9 A;  1THE A;  3DWD A;  1WEM A;  1MEM A;  2ACT A;  2M13 A;  3MTN A;  4AYC A;  3K8U A;  2XU1 A;  4K7C A;  4A4B A;  1AU2 A;  2L0B A;  3BOW A;  5G04 B;  5A24 A;  3MHH A;  2BU3 A;  2LQ6 A;  3DQV R;  2ARY A;  4P6E A;  1JM7 A;  3LDY A;  2JQF R;  3KKU A;  1GEC E;  3OVZ A;  2DCD A;  4A4C A;  2YHO A;  4MSX A;  4F1P A;  4ZDT A;  5EZQ A;  4AXL A;  4AXM A;  2Y6E A;  2YYR A;  1CV8 A;  4GUA A;  4X3G A;  4BQV A;  2LGK A;  2RSD A;  2FUU A;  2KGG A;  4ZQL A;  4CCG X;  3PHW A;  4IUM A;  5EF4 A;  4V3K C;  4LK9 A;  2YSM A;  3SOX A;  5J94 A;  2IDA A;  2JTC A;  3BPF A;  4I7D A;  1VYX A;  2G43 A;  4Z0O A;  2DZY A;  4BPV A;  4GNG A;  5J3X A;  4QRG A;  2ECG A;  2B0O E;  5D1L B;  2D8S A;  4UI9 B;  1U5I A;  1PIP A;  3ZYQ A;  4QH6 A;  2HH5 A;  2EXU A;  2K16 A;  5C11 A;  1PPN A;  4YBM A;  2FYE A;  2Y5B A;  2AGA A;  3H8C A;  3KV6 A;  4YBS A;  2AVW A;  3PRM A;  2BTW B;  2UZJ A;  3T6R A;  2VJF A;  3DPL R;  1Q6K A;  2BDZ A;  2AUZ A;  2E6S A;  1NB3 A;  1LDJ B;  3N9Q A;  2YJ9 A;  2C2V S;  3U5O A;  2FQ9 A;  1U9Q X;  3LQI A;  1FBV A;  4WZ0 A;  2HYE D;  2F6J A;  3H6S A;  3RVV A;  2BDL A;  5SVX A;  1YVB A;  4MVT A;  3H7D A;  4I07 A;  5C13 A;  2DCB A;  5FB1 A;  1GLO A;  2OUL A;  2DC7 A;  2JMJ A;  5B77 A;  3EB6 A;  3ZNH A;  3U5N A;  2QIC A;  2YSJ A;  3M63 A;  4D8I A;  5LKU A;  1ZIV A;  5K16 A;  3W31 A;  1ATK A;  1FP0 A;  3E2D A;  3HD3 A;  4I05 A;  3ZVY A;  1TL9 A;  2FD4 A;  3OVX A;  3IMA A;  3KWB X;  1CHC A;  3ERV A;  3P5W A;  4LAD B;  2HHN A;  5EYA F;  2B1N A;  3S3R A;  5F02 A;  4Q8H A;  2NQA A;  2MUM A;  4PI3 A;  3O65 A;  4BS5 A;  8PCH A;  2EA6 A;  2KIZ A;  4OGE A;  4PP1 A;  3PUQ A;  5H1U A;  4AUQ B;  3C9E A;  4RF1 A;  3V6E A;  3LQH A;  2FUI A;  2K17 A;  5AIT A;  1XKG A;  2PAD A;  2EGM A;  2Y1N A;  1AEC A;  2KKX A;  4XZX A;  2LGV A;  4Z0R A;  1JOC A;  2VPB A;  4QBB A;  3DDT A;  2YQM A;  2DCA A;  2OXQ C;  2Y1M A;  1U9X A;  4BHW A;  4RF0 A;  1YZB A;  2ECV A;  2LRI C;  5AIU A;  4M0W A;  1EWL A;  5LCW B;  3O36 A;  3IHP A;  1DF0 A;  2M1R A;  3L1Z B;  4ZTB A;  2XB1 A;  4S3O C;  1KHQ A;  3O70 A;  3KDE C;  1F2B A;  4CDF B;  1KHP A;  2HWK A;  5KH3 A;  3CH2 X;  4W4U A;  2MT5 A;  1NB5 A;  4MZO A;  4R8P K;  4Q8G A;  1ITO A;  4WZ2 A;  5SVY A;  2LN0 A;  1MM2 A;  2CON A;  4R3D A;  3O47 A;  3PLW A;  3O33 A;  1EF7 A;  3HHI A;  3FAN A;  2ATO A;  3RTR B;  2B1M A;  1YAL A;  3QSD A;  5H9M A;  3BWK A;  1QDQ A;  2AU1 A;  4YC9 A;  3PUR A;  3KQI A;  5TDW A;  3T9K A;  4X6H A;  6PAD A;  3N3K A;  2O6X A;  2VJE A;  3ZUA A;  2G6D A;  4TKP B;  2LXP C;  2PRE A;  4RY2 A;  3OF8 A;  2E02 A;  2XU5 A;  3O0U A;  2DSM A;  3M62 A;  4P5O B;  1VD4 A;  4HXD B;  2KFT A;  5EZS A;  1AIM A;  5CHT A;  4N8W A;  2MIQ A;  2MA5 A;  2VHF A;  2YVR A;  1WEW A;  3M99 A;  2Z84 A;  2AIM A;  4BSQ A;  3BPM A;  2GHU A;  1RMD A;  2GFO A;  4QRX A;  4O64 A;  1IYM A;  2E61 A;  4GB0 A;  4BOP A;  2R9O A;  3ASL A;  4GNF A;  5JG6 A;  3SHB A;  4YYS A;  3B21 A;  4WUR A;  2KWK A;  3K24 A;  5KH9 A;  2MNZ A;  4YYV A;  1WGM A;  4LLB A;  2H0D B;  2YUC A;  3LJU X;  3I3T A;  4LJN A;  2VJF B;  4CZW A;  1DEU A;  1HYI A;  3O34 A;  1CJL A;  4MZS A;  2FTD A;  5JH3 A;  2JUN A;  3OF9 A;  2J7Q A;  4YAD A;  1STF E;  1NPZ A;  5FEY A;  4S3O B;  2FO5 A;  4X6J A;  4V3L C;  5KO3 A;  2CKL B;  1CS8 A;  1BQI A;  3U5M A;  2YJ2 A;  2MD8 C;  3DF0 A;  3KX1 A;  1K3B B;  4CDC B;  1WFK A;  2NQD B;  3F5V A;  5B75 A;  2VP7 A;  2JM3 A;  2MD7 B;  3N9N A;  1MIR A;  4HWY A;  5SVI A;  3D6S A;  4OW0 A;  3BB7 A;  4BOZ A;  2XOC A;  2PNS A;  4I7C A;  1AU0 A;  1CTE A;  2G7Y A;  2DC9 A;  1WEP A;  3LVR E;  2CB5 A;  2F42 A;  2WBF X;  5B76 A;  3KWZ A;  1BY8 A;  3RNV A;  3GL6 A;  2VPE A;  4YBT A; 
#chains in the Genus database with same CATH homology
 1AU4 A;  5FER A;  1YT7 A;  2P7U A;  2LGG A;  5D1K B;  2G8E A;  4CDD B;  1XWH A;  4FJC A;  4BBQ A;  3C6W A;  2FT2 A;  1BOR A;  1LDK C;  4R7E A;  2RI7 A;  5LKZ A;  3QJ3 A;  2YHN A;  4NV7 A;  3B79 A;  4BGF A;  3HTK C;  2DJG B;  1Z60 A;  2NAA A;  2FUD A;  1BGO A;  3QT4 A;  1WIM A;  1Y4H A;  4KLB A;  4PP2 E;  1NL6 A;  3P5V A;  2VHS A;  3HCS A;  4LKA A;  2ECI A;  3PHD A;  3P5X A;  2MA6 A;  2C2L A;  2R9F A;  2VFB A;  5B79 A;  2XU4 A;  1Z2Q A;  1K2F A;  2E01 A;  2P0R A;  3N4C A;  3K9M A;  5TRB A;  2YW8 A;  4GNE A;  2JMD A;  2LDR A;  2YJB A;  1T1H A;  2G8J A;  2FSA A;  3S3Q A;  2NQI A;  4PTB A;  3ZPV 1;  1W5R A;  3PBH A;  5TDR A;  4N4F A;  4N3W A;  1ME4 A;  1CQD A;  2CSY A;  1PXV A;  1F29 A;  3ZTG A;  1X4U A;  2DX8 A;  3L1X A;  3V43 A;  1QMY A;  3HCT A;  2F6N A;  2G45 A;  2YJC A;  3HWN A;  3SOU A;  2R9N A;  1PBH A;  1X9Y A;  2OZ2 A;  1PPP A;  1WEU A;  1EWM A;  2HD5 A;  3CBK A;  2PBH A;  2PUY A;  4GND A;  3CBJ A;  2JQG R;  1VJV A;  4AYC B;  2EGP A;  4G54 A;  2VPG A;  1JM7 B;  3O35 A;  2CT2 A;  1TLO A;  1PCI A;  4PAD A;  5B8D A;  4YYR A;  3RVX A;  2QIZ A;  1E4U A;  3FL2 A;  3P5U A;  4YV8 A;  3V6C A;  5D1M B;  4YAX A;  3BC3 A;  1CB5 A;  4F52 B;  1CVZ A;  1CPJ A;  4WZ3 B;  4FK5 A;  2G6Q A;  2F7D A;  3MHS A;  4PPE A;  1VSN A;  3KSE A;  1X4I A;  3N9M A;  4Q6F A;  4XI1 A;  3C5K A;  5B78 A;  1WEE A;  4L7X A;  1TU6 A;  3KNV A;  2ECW A;  3LRQ A;  1IWD A;  3RVW A;  1WES A;  1X4J A;  3U8E A;  4N79 A;  2K4D A;  3LQJ A;  2M6M A;  5CVO B;  2OP3 A;  3TNX A;  4YVA A;  4OEM A;  5H1T A;  2AYN A;  3KW9 A;  2R9M A;  2IPP B;  2KYU A;  1WEO A;  3I2D A;  1MS6 A;  2HDP A;  1EWP A;  4C9Z A;  1QXP A;  1G25 A;  1SP4 B;  4X6I A;  3PNR A;  1WEQ A;  2Y43 A;  3T7L A;  3N3G A;  2M3H A;  3O7A A;  1MM3 A;  2CIO A;  5PAD A;  2KU3 A;  1PE6 A;  5FB0 A;  5TBN A;  4UP0 A;  3MOR A;  2XU3 A;  1AU3 A;  2PNX A;  4P6G A;  1ME3 A;  4YYW A;  3L11 A;  3E1Z B;  3U5P A;  3H8B A;  2DJF B;  2IBI A;  5CVN B;  1KFX L;  3WXE A;  1GCB A;  2DC8 A;  3NHE A;  5I3L A;  1SNK A;  1AYW A;  1MEG A;  1Z6U A;  4I04 A;  2ZET C;  3O37 A;  5DKA A;  1AYV A;  3IV2 A;  3O1G A;  4XR7 A;  4W5C A;  2M85 A;  1U6G B;  4B7Y C;  5EGW A;  3D9W A;  2P86 A;  1F2C A;  1F62 A;  3AI8 A;  3IEJ A;  4BS6 A;  3SOW A;  5TAB A;  2AUX A;  2H0D A;  4QF2 A;  5CVM A;  2LGL A;  4A0C D;  1WEN A;  2YRE A;  4QF3 A;  3H89 A;  2QJ0 A;  3GV4 A;  5LKT A;  4IC2 A;  3PW3 A;  1Y08 A;  3IOQ A;  1BP4 A;  1S4V A;  4XUI A;  1PPO A;  2VNF A;  3N9P A;  2AN6 A;  1FH0 A;  1A6R A;  4N4Z A;  3ZPV E;  4B86 C;  2CKL A;  5G0F A;  2AYO A;  2KWJ A;  2KGI A;  2MNY A;  3N9O A;  4ZUX U;  1ICF A;  1MDW A;  1GMY A;  2XEU A;  4OEL A;  5H1V A;  3RPG C;  4A49 A;  2VFC A;  4I7B A;  2C0Y A;  2E03 A;  4CDE B;  2L5U A;  2VJE B;  2KR4 A;  1F2A A;  2YT5 A;  1WIL A;  1JQP A;  1ZCM A;  4AP4 A;  1O0E A;  2KWO A;  3WXF A;  1KXR A;  2KE1 A;  1WEV A;  7PCK A;  3LXS A;  3LFY A;  4YAB A;  2LXH C;  4IC3 A;  2ECJ A;  3ZNI A;  2JMI A;  1V87 A;  2EOD A;  4QRV A;  2YUR A;  1U9V A;  2R6N A;  2BSZ A;  2H7J A;  4YYU A;  1VFY A;  5FPW A;  5JA7 A;  3HCU A;  1HUC B;  4WA6 A;  4FIP A;  1KFU L;  4CA1 A;  2DZZ A;  3KFQ A;  1EWO A;  1POP A;  3BCN A;  3ZVZ B;  5KH7 A;  5CHV A;  4R2Y A;  2L80 A;  5DIN A;  4W5B A;  3EB5 A;  4DMX A;  1M6D A;  9PAP A;  2FRQ A;  2ECT A;  2YQL A;  3CH3 X;  4YYQ A;  2I50 A;  1YK7 A;  2E6R A;  2DCC A;  2F1G A;  4DMY A;  2NQG A;  3IUT A;  1MHW A;  2UZG A;  4L58 A;  2HXZ A;  1QOL A;  2CSZ A;  1YK8 A;  2FRA A;  3USV A;  1AYU A;  1PAD A;  3VK6 A;  2E00 A;  3PDF A;  2DC6 A;  4NN2 A;  2L43 A;  1PPD A;  1DVP A;  2R9C A;  2LV9 A;  2KWN A;  3RPG B;  3NG2 A;  1HYJ A;  5G05 B;  1ZBD B;  2AS8 A;  3HHA A;  2YJ8 A;  3OIS A;  2BAY A;  3QZV A;  2KRE A;  4AVX A;  1NLJ A;  4YAT A;  2K1J A;  2L75 A;  1WE9 A;  3F75 A;  3I06 A;  1NQC A;  2ECN A;  2JRJ A;  3WXG A;  3GCB A;  3KV5 A;  2YU4 A;  3N9L A;  1N87 A;  1U9W A;  5LKX A;  1CSB B;  2VPD A;  4UP5 A;  4FO9 A;  1THE A;  1MEM A;  1WEM A;  2ACT A;  3MTN A;  4AYC A;  3K8U A;  2XU1 A;  4K7C A;  4A4B A;  1AU2 A;  2L0B A;  3BOW A;  5G04 B;  5A24 A;  3MHH A;  2LQ6 A;  3DQV R;  2ARY A;  4P6E A;  1JM7 A;  1W4T A;  2JQF R;  3KKU A;  1GEC E;  3OVZ A;  2DCD A;  4A4C A;  2YHO A;  4MSX A;  4ZDT A;  4AXL A;  4AXM A;  2Y6E A;  2YYR A;  1CV8 A;  4X3G A;  4BQV A;  2LGK A;  2RSD A;  2FUU A;  2KGG A;  4ZQL A;  4CCG X;  5EF4 A;  4V3K C;  3SOX A;  4LK9 A;  2YSM A;  5J94 A;  2IDA A;  3BPF A;  4I7D A;  1VYX A;  2G43 A;  2DZY A;  4BPV A;  4GNG A;  5J3X A;  4QRG A;  2ECG A;  5D1L B;  2D8S A;  4UI9 B;  1U5I A;  1PIP A;  3ZYQ A;  4GUZ A;  4QH6 A;  2HH5 A;  2K16 A;  5C11 A;  1PPN A;  4YBM A;  2FYE A;  2Y5B A;  3H8C A;  3KV6 A;  4YBS A;  2AVW A;  3T6R A;  2VJF A;  3DPL R;  1Q6K A;  2BDZ A;  2AUZ A;  2E6S A;  1NB3 A;  1LDJ B;  3N9Q A;  2YJ9 A;  2C2V S;  3U5O A;  2FQ9 A;  1U9Q X;  3LQI A;  1FBV A;  4WZ0 A;  2HYE D;  2F6J A;  3H6S A;  3RVV A;  4NV8 A;  2BDL A;  1YVB A;  4MVT A;  3H7D A;  4I07 A;  5C13 A;  2DCB A;  5FB1 A;  1GLO A;  2OUL A;  2DC7 A;  2JMJ A;  5B77 A;  3EB6 A;  3U5N A;  1GX3 A;  2QIC A;  2YSJ A;  3M63 A;  5LKU A;  1ZIV A;  5K16 A;  1ATK A;  1FP0 A;  3HD3 A;  4I05 A;  3ZVY A;  1TL9 A;  3OVX A;  3IMA A;  3KWB X;  1CHC A;  3ERV A;  3P5W A;  4LAD B;  2HHN A;  5EYA F;  2B1N A;  3S3R A;  5F02 A;  4Q8H A;  2NQA A;  2MUM A;  4PI3 A;  4BS5 A;  8PCH A;  2EA6 A;  2KIZ A;  4PP1 A;  3PUQ A;  5H1U A;  4AUQ B;  3C9E A;  3V6E A;  3LQH A;  2FUI A;  2K17 A;  5AIT A;  1XKG A;  2PAD A;  2Y1N A;  1AEC A;  2LGV A;  1JOC A;  2VPB A;  4QBB A;  2YQM A;  2DCA A;  2OXQ C;  2Y1M A;  1U9X A;  4BHW A;  2ECV A;  2LRI C;  5AIU A;  1EWL A;  5LCW B;  3O36 A;  3IHP A;  1DF0 A;  2M1R A;  3L1Z B;  2XB1 A;  4S3O C;  1KHQ A;  3O70 A;  1F2B A;  4CDF B;  1KHP A;  5KH3 A;  3CH2 X;  4W4U A;  2MT5 A;  1NB5 A;  4MZO A;  4R8P K;  4Q8G A;  1ITO A;  4WZ2 A;  2LN0 A;  1MM2 A;  3O33 A;  1EF7 A;  3HHI A;  2ATO A;  3RTR B;  2B1M A;  1YAL A;  3QSD A;  5H9M A;  3BWK A;  1QDQ A;  2AU1 A;  4YC9 A;  3PUR A;  3KQI A;  5TDW A;  4X6H A;  6PAD A;  3N3K A;  2O6X A;  2VJE A;  3ZUA A;  2G6D A;  4B55 A;  4TKP B;  2LXP C;  2PRE A;  4RY2 A;  3OF8 A;  2E02 A;  2XU5 A;  3O0U A;  3M62 A;  4P5O B;  1VD4 A;  2KFT A;  1AIM A;  5CHT A;  4N8W A;  2MIQ A;  4C5P A;  2MA5 A;  2VHF A;  1WEW A;  3M99 A;  2AIM A;  4BSQ A;  3BPM A;  2GHU A;  1RMD A;  2GFO A;  4QRX A;  4O64 A;  1IYM A;  4GB0 A;  2R9O A;  3ASL A;  1W6F A;  4GNF A;  5JG6 A;  3SHB A;  4YYS A;  2KWK A;  3K24 A;  5KH9 A;  2MNZ A;  4YYV A;  1WGM A;  4LLB A;  2H0D B;  2YUC A;  3I3T A;  4LJN A;  3LTW A;  2VJF B;  4CZW A;  1DEU A;  1HYI A;  3O34 A;  1CJL A;  4MZS A;  2FTD A;  5JH3 A;  3OF9 A;  4YAD A;  1STF E;  1NPZ A;  5FEY A;  4S3O B;  2FO5 A;  4X6J A;  4V3L C;  2CKL B;  1CS8 A;  1BQI A;  3U5M A;  2YJ2 A;  2MD8 C;  3DF0 A;  3KX1 A;  1K3B B;  4CDC B;  1WFK A;  2NQD B;  3F5V A;  5B75 A;  2VP7 A;  2MD7 B;  3N9N A;  1E2T A;  1MIR A;  4HWY A;  3D6S A;  2PNS A;  4I7C A;  1AU0 A;  1CTE A;  2G7Y A;  2DC9 A;  1WEP A;  2CB5 A;  2F42 A;  2WBF X;  5B76 A;  3KWZ A;  1BY8 A;  3GL6 A;  2VPE A;  4YBT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...