3MHSA

Structure of the saga ubp8/sgf11/sus1/sgf73 dub module bound to ubiquitin aldehyde
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
472
structure length
455
Chain Sequence
AMSICPHIQQVFQNEKSKDGVLKTCNAARYILNHSVPKEKFLNTMKCGTCHEINSGATFMCLQCGFCGCWNHSHFLSHSKQIGHIFGINSNNGLLFCFKCEDYIGNIDLINDAILAKYWDDVCTKTMVPSMERRDGLSGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNNCKVRSPDKCFSCALDKIVHELYGALNTSTNRQTGFIYLLTCAWKINQNLAGYSQQDAHEFWQFIINQIHQSYVLDLPNNNKQCECIVHTVFEGSLESSIVCPGCQNNSKTTIDPFLDLSLDIKDKKKLYECLDSFHKKEQLKDFNYHCGECNSTQDAIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKNYCSTKEKDKENGKVPDIIYELIGIVSHKGTVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQAYLLFYTIRQVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the assembly and function of the SAGA deubiquitinating module.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/transcription regulator/protein binding
molecule keywords Ubiquitin carboxyl-terminal hydrolase 8
total genus 134
structure length 455
sequence length 472
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2010-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3mhsA01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3mhsA02
4LADB 1NL6A 3ZTGA 1GMYA 2Y6EA 5KH7A 2F6JA 4WZ2A 1U9WA 4R8PK 3ZPV1 3WXEA 2M1RA 2JQFR 3DPLR 3O33A 4LLBA 2MA6A 2YURA 1SP4B 5CHVA 3LRQA 3ASLA 2YJBA 3ERVA 4V3KC 4BSQA 2FRQA 3K9MA 1Z60A 4CCGX 5FPWA 3SHBA 4MZSA 4AXLA 5TDWA 2G43A 3K24A 1MS6A 1SNKA 3P5WA 2K17A 4C9ZA 3HD3A 2PNXA 2FT2A 2VPDA 2KFTA 4Q6FA 3N9PA 4YABA 3S3QA 1U6GB 2ECWA 2DZZA 3O35A 3WXGA 2VHSA 3C6WA 4I07A 4IC3A 2CKLB 4N79A 3O37A 5C11A 2LRIC 4AVXA 5TBNA 3HTKC 2R9NA 5EGWA 2E01A 4R2YA 3V6EA 5D1MB 3QT4A 2ECJA 3H89A 3MHSA 1CHCA 3RTRB 3KFQA 2QJ0A 3OF9A 4ZQLA 3S3RA 4W4UA 5J94A 2AYOA 3BOWA 3KKUA 5FB1A 4CZWA 4GNDA 2R9CA 2E6SA 2LGVA 2VP7A 1EWMA 1U5IA 1QOLA 4NN2A 2DCBA 2OZ2A 5CHTA 2CSYA 2H7JA 1CQDA 4BBQA 4BPVA 1WEPA 3L1XA 1FP0A 3H6SA 3U5PA 5TDRA 6PADA 5B76A 4WZ0A 2FO5A 1AU2A 5LCWB 1TLOA 2MNZA 2R6NA 3KNVA 2FUUA 2Y1MA 4YV8A 3KSEA 2R9MA 2KREA 4X6HA 4CDCB 3CBJA 3WXFA 4R7EA 4S3OB 2YJ2A 2O6XA 1ME4A 3O34A 1WEQA 2YYRA 5G05B 1CB5A 2ACTA 2VJEB 5I3LA 3IEJA 3GCBA 2GHUA 3MTNA 1ME3A 4UP5A 3VK6A 3LXSA 2VJFB 5EF4A 1KFXL 1Z2QA 2P86A 5KH9A 1G25A 3BPMA 1RMDA 2KWOA 5LKXA 2NQIA 3E1ZB 1O0EA 2E03A 4YBMA 2YUCA 5H1VA 3ZNIA 2VHFA 2HXZA 4WZ3B 2FSAA 3N9OA 1AU0A 2R9FA 3N3KA 3QZVA 1ZCMA 2DX8A 3RVWA 4YYSA 1WEWA 5DKAA 2VJEA 1WEVA 1CPJA 3IHPA 1WESA 2E00A 4L7XA 1WEOA 5FERA 1F2BA 2CB5A 2L0BA 1YALA 4PP2E 3O7AA 1DEUA 2HH5A 1LDKC 5AITA 3BC3A 3HHAA 3LQJA 3KW9A 4AUQB 1EWPA 3HCTA 3D6SA 4Q8GA 2ECGA 1KHPA 1WEMA 3EB6A 1AYVA 2YSJA 2Y43A 2HHNA 3IOQA 5D1KB 4CDFB 3L11A 1ZBDB 3RPGC 3H8BA 1AECA 1YT7A 2FTDA 2AU1A 4XI1A 4LKAA 3H7DA 3L1ZB 4YYVA 5B79A 3N9NA 4W5CA 2CSZA 2DC8A 4A4BA 2E6RA 5EYAF 1WGMA 2G8EA 1FBVA 1MM3A 2F6NA 2YQLA 2OP3A 2MNYA 9PAPA 3CH3X 3DF0A 1QXPA 1PBHA 4PP1A 3KV5A 5H1TA 5G0FA 2XU1A 1STFE 2DCCA 4MZOA 4QBBA 4DMXA 2I50A 2QICA 1WE9A 2C0YA 1K3BB 4G54A 5F02A 2LXHC 2DZYA 4MSXA 5FEYA 4A0CD 2H0DA 3NG2A 5PADA 5TRBA 5FB0A 2ARYA 3RVXA 3MORA 3O70A 1IYMA 5CVMA 1Z6UA 2YHNA 3EB5A 1JM7A 3N9QA 1HYIA 1KHQA 2E02A 1NLJA 4GB0A 5K16A 1QDQA 2LXPC 1ATKA 3SOUA 1M6DA 4PI3A 2Y1NA 1XKGA 3I06A 4YBTA 2FRAA 3O1GA 1EWLA 4AYCA 5D1LB 4A49A 4X6IA 2NQDB 2EGPA 5KH3A 5LKUA 2B1MA 4PADA 1X4JA 1GECE 3OVXA 1EF7A 1QMYA 4AYCB 2YSMA 1DF0A 4YVAA 2HYED 5B77A 2KWNA 1GCBA 3BCNA 1AIMA 2P0RA 3P5UA 3QSDA 1X4UA 3RVVA 3U8EA 2JMIA 1JQPA 5H9MA 2LGKA 2KU3A 2FYEA 2OULA 2KYUA 2DJGB 4Q8HA 2G6DA 2JMJA 2C2VS 1WILA 1U9VA 2JQGR 3H8CA 1F2AA 5JH3A 3BPFA 2K4DA 4PPEA 4QRVA 3M99A 2VNFA 3PUQA 4S3OC 2EODA 2YW8A 1PPOA 2AYNA 4QH6A 2YREA 4FO9A 3P5VA 1LDJB 3MHHA 2YHOA 3QJ3A 2DC7A 3U5NA 2LQ6A 2ECTA 3KWZA 2PREA 3RPGB 3GV4A 4N4FA 4QF2A 1HYJA 1NPZA 1VFYA 2OXQC 2CIOA 4RY2A 2LGLA 4QF3A 2G8JA 3B79A 5CVOB 5LKTA 1KXRA 1WIMA 2VPEA 2ATOA 2YJ8A 1U9QX 1MDWA 3F5VA 2XB1A 2BDZA 2ECVA 1JOCA 2LGGA 2AUXA 4BQVA 2VPBA 3OVZA 2DCAA 2KE1A 1X4IA 1XWHA 4GNEA 4FIPA 1BP4A 2F1GA 3PHDA 4O64A 4X3GA 4UP0A 4X6JA 3N4CA 1K2FA 1PXVA 2BDLA 4YC9A 1MEMA 1MM2A 2RSDA 3U5OA 3DQVR 5C13A 2ECIA 5J3XA 2AUZA 3SOWA 2G6QA 2DC6A 2KGIA 3N9MA 1YK7A 2FUIA 2AS8A 5H1UA 4I7BA 1BY8A 1MHWA 1NQCA 2DC9A 2KWJA 4P6EA 2KWKA 2IBIA 4ZUXU 1F62A 2BAYA 4N4ZA 1WENA 3O0UA 3TNXA 2CKLA 4K7CA 3GL6A 1THEA 4I7DA 1TU6A 4BHWA 4MVTA 3IUTA 2L80A 1PPNA 5JG6A 4WA6A 1GLOA 2MD7B 1BQIA 4B86C 3O36A 4YYWA 4BS5A 1TL9A 3HCSA 3K8UA 1WEEA 3KQIA 2DCDA 4F52B 3HWNA 1DVPA 2XEUA 3P5XA 4KLBA 2KGGA 5CVNB 4W5BA 3IMAA 3SOXA 1IWDA 2YQMA 3PBHA 1Q6KA 2YU4A 5DINA 3T6RA 3HCUA 5AIUA 1U9XA 2YT5A 4OELA 1ZIVA 2PADA 1AU4A 2GFOA 5A24A 5LKZA 3PURA 1AYUA 4QRGA 4FK5A 3ZPVE 3ZVYA 1ICFA 3PW3A 2K1JA 2F42A 3ZVZB 1F2CA 2NQAA 1A6RA 3OISA 4YAXA 1PCIA 3KX1A 4P6GA 1PPPA 2IDAA 4PTBA 4YYUA 1CVZA 4AXMA 2C2LA 3N9LA 2B1NA 3ZYQA 2XU3A 4V3LC 4LJNA 2NAAA 1AYWA 2JMDA 1V87A 5G04B 1MEGA 4BS6A 3C5KA 4IC2A 1F29A 4I05A 2FQ9A 3OF8A 8PCHA 2RI7A 7PCKA 1KFUL 2MUMA 1NB3A 2EA6A 2MIQA 4GNFA 4YBSA 3HHIA 4TKPB 1ITOA 5B78A 5B75A 1CS8A 3T7LA 4A4CA 2FUDA 3KWBX 2Y5BA 4OEMA 2L43A 3I3TA 2G45A 2HDPA 2CT2A 2QIZA 3U5MA 3M62A 1E4UA 3C9EA 2M6MA 2PUYA 2UZGA 1MIRA 1BORA 1AU3A 3BWKA 2L75A 4CDEB 3USVA 1EWOA 5TABA 4P5OB 2MT5A 2D8SA 1Y4HA 1WFKA 1FH0A 1T1HA 1JM7B 1PPDA 2AN6A 1POPA 1VYXA 2MA5A 1PIPA 1PADA 4XR7A 1VJVA 2YJCA 3I2DA 2K16A 1BGOA 1CTEA 3KV6A 1VSNA 3ZUAA 2AVWA 2H0DB 2IPPB 1WEUA 4CA1A 3NHEA 2HD5A 2LV9A 2ZETC 3V43A 4N3WA 2XU4A 3AI8A 2KIZA 2LN0A 1CJLA 3IV2A 2JRJA 1YK8A 2PNSA 3LFYA 4L58A 5B8DA 4AP4A 1NB5A 1CV8A 2KR4A 2M85A 1S4VA 4DMYA 2R9OA 1YVBA 2VPGA 2P7UA 3CBKA 1CSBB 2LDRA 4GNGA 2L5UA 3N3GA 2M3HA 3LQIA 2G7YA 4CDDB 2PBHA 2YJ9A 4YYQA 1X9YA 3CH2X 1PE6A 4HWYA 5JA7A 4I7CA 2DJFB 3V6CA 2VJFA 1Y08A 2NQGA 2F7DA 4YADA 3FL2A 2ECNA 1N87A 4ZDTA 4QRXA 2XU5A 4FJCA 4I04A 3LQHA 4YYRA 4LK9A 4XUIA 4UI9B 3PNRA 4YATA 1HUCB 4N8WA 4B7YC 3M63A 3F75A 1VD4A 2WBFX 3PDFA 2MD8C 2AIMA
chains in the Genus database with same CATH superfamily
4LADB 1NL6A 3ZTGA 1GMYA 2Y6EA 5KH7A 2F6JA 2XP0A 4WZ2A 1U9WA 4R8PK 3ZPV1 3WXEA 2M1RA 2JQFR 3DPLR 3O33A 4LLBA 2XOZA 2MA6A 2FE8A 2EXUA 2YURA 1SP4B 3DWDA 2P57A 5CHVA 3LRQA 3ASLA 2YJBA 3PLWA 3ERVA 4V3KC 4BSQA 2FRQA 3K9MA 1Z60A 4CCGX 5FPWA 3SHBA 4MZSA 4AXLA 5TDWA 2G43A 3K24A 1MS6A 1SNKA 3P5WA 2K17A 4C9ZA 3HD3A 2PNXA 2FT2A 2J7QA 2VPDA 2KFTA 4Q6FA 3N9PA 4YABA 3S3QA 1U6GB 2ECWA 2DZZA 3O35A 3WXGA 2VHSA 3C6WA 4I07A 4IC3A 2CKLB 4N79A 3O37A 5C11A 2LRIC 4AVXA 5TBNA 3HTKC 2R9NA 2CRRA 5EGWA 2E01A 4R2YA 3V6EA 5D1MB 4F1PA 2ECJA 3QT4A 3DDTA 3MHSA 1CHCA 3H89A 3RTRB 3KFQA 2QJ0A 2UZJA 3OF9A 4ZQLA 3S3RA 4W4UA 5J94A 2AYOA 3BOWA 2DSMA 3KKUA 5FB1A 3FJUB 2LAUA 4CZWA 4GNDA 2R9CA 2E6SA 2LGVA 2VP7A 1EWMA 1U5IA 2MKEA 1QOLA 4NN2A 2KKYA 2DCBA 2OZ2A 5CHTA 2CSYA 2H7JA 1CQDA 4BBQA 3PHXA 4BPVA 1WEPA 3L1XA 1FP0A 3H6SA 3U5PA 5TDRA 6PADA 5B76A 4WZ0A 2FO5A 1AU2A 2BTWA 5LCWB 1TLOA 2MNZA 2R6NA 3KNVA 2FUUA 4OGCA 2Y1MA 4YV8A 2KKXA 3KSEA 2R9MA 2CSVA 2KREA 4X6HA 4OVZA 4CDCB 3CBJA 3WXFA 4R7EA 2OWAA 4XZXA 4S3OB 2YJ2A 2O6XA 3C0RA 1ME4A 3O34A 1WEQA 2YYRA 5G05B 1CB5A 2ACTA 2VJEB 5I3LA 3IEJA 3GCBA 2GHUA 3MTNA 1ME3A 4UP5A 3VK6A 3LXSA 2VJFB 5EF4A 2BTWB 3B21A 1KFXL 1Z2QA 2P86A 2Z84A 5KH9A 3MDBC 1G25A 3BPMA 1RMDA 2KWOA 5LKXA 2NQIA 2E61A 3E1ZB 4OVZB 1O0EA 4HXDB 4D8IA 2E03A 4O62A 4YBMA 2YUCA 5H1VA 3ZNIA 2VHFA 1MBMA 2D8UA 4WZ3B 2HXZA 2FSAA 4BOZA 3N9OA 2XOYA 1AU0A 2R9FA 3N3KA 3QZVA 1ZCMA 2DX8A 3RVWA 4YYSA 1WEWA 5DKAA 2VJEA 1WEVA 1CPJA 3IHPA 1WESA 2E00A 4L7XA 3H7HA 5EZSA 1WEOA 4BOUA 5FERA 1F2BA 3KDEC 2CB5A 2L0BA 1YALA 4PP2E 3O7AA 1DEUA 2HH5A 1LDKC 5AITA 3BC3A 3HHAA 2L7PA 3LQJA 4QQ4A 3KW9A 4REZA 2IQJA 4AUQB 1EWPA 3HCTA 3D6SA 4Q8GA 2ECGA 1KHPA 1WEMA 3EB6A 1AYVA 3W31A 2YSJA 2Y43A 2HHNA 3IOQA 5D1KB 4CDFB 3L11A 4IUMA 1ZBDB 3RPGC 3H8BA 3BY4A 1AECA 1YT7A 2FTDA 2AU1A 4XI1A 4LKAA 5SVIB 3H7DA 3L1ZB 4YYVA 5B79A 3N9NA 4W5CA 2CSZA 2JRIA 4WURA 2DC8A 4A4BA 2E6RA 5EYAF 1WGMA 2G8EA 3SUBA 1FBVA 1MM3A 2F6NA 2YQLA 2OP3A 2MNYA 2JTCA 9PAPA 3CH3X 3DF0A 1QXPA 4BOSA 1PBHA 3MP2A 4PP1A 3KV5A 5H1TA 5G0FA 1DKIA 2XU1A 1STFE 3PHUA 2DCCA 4MZOA 4QBBA 4DMXA 2I50A 2QICA 4H9DA 1WE9A 2C0YA 1K3BB 4G54A 2CRWA 5F02A 3LDYA 2LXHC 2DZYA 4MSXA 5FEYA 4A0CD 2H0DA 3NG2A 5PADA 5TRBA 5FB0A 2ARYA 3RVXA 2FFWA 3MORA 3O70A 1IYMA 5CVMA 1Z6UA 2YHNA 3EB5A 3FM8C 2JM3A 1JM7A 3N9QA 1HYIA 1KHQA 5KO3A 2E02A 1NLJA 4GB0A 5K16A 1QDQA 2LXPC 1ATKA 3SOUA 1M6DA 4PI3A 2B0OE 2Y1NA 2DOSA 1XKGA 3I06A 4D8EA 4YBTA 2FRAA 3O1GA 1EWLA 3PT2A 4AYCA 5D1LB 4A49A 4X6IA 4OGEA 2NQDB 2EGPA 5KH3A 5LKUA 2J7QC 3M7KA 2B1MA 2DJAA 4PADA 1X4JA 1GECE 3OVXA 1EF7A 1QMYA 4AYCB 2YSMA 5SVYA 1DF0A 3BB7A 4YVAA 2HYED 5B77A 2KWNA 1GCBA 5EZQA 3BCNA 1AIMA 2P0RA 3P5UA 3QSDA 1X4UA 3RVVA 3U8EA 2JMIA 1JQPA 5H9MA 4BOQA 2LGKA 2KU3A 2FYEA 2OULA 2KYUA 2DJGB 4Q8HA 2G6DA 2JMJA 2C2VS 1WILA 5SVIA 1U9VA 2JQGR 3H8CA 1YZBA 1F2AA 5JH3A 3LJUX 3BPFA 2K4DA 4PPEA 3W30A 4QRVA 3M99A 2VNFA 3PUQA 4S3OC 2EODA 2YW8A 1PPOA 2AYNA 4QH6A 4OW0A 2YREA 4FO9A 3P5VA 1LDJB 3MHHA 2YHOA 4BOPA 3QJ3A 2DC7A 4IP3A 3U5NA 2LQ6A 2ECTA 3KWZA 2PREA 3RPGB 3GV4A 4N4FA 4QF2A 4RF0A 1HYJA 1NPZA 1VFYA 2OXQC 2CIOA 4RY2A 2LGLA 4QF3A 2G8JA 3B79A 5CVOB 5LKTA 1KXRA 1WIMA 2VPEA 2ATOA 2YJ8A 1U9QX 1MDWA 3F5VA 2XB1A 2BDZA 2ECVA 3PSEA 1JOCA 2LGGA 2AUXA 4BQVA 2VPBA 3OVZA 2DCAA 2KE1A 1X4IA 1XWHA 4GNEA 4FIPA 1BP4A 2F1GA 3PHDA 4O64A 4X3GA 4UP0A 4X6JA 3N4CA 1K2FA 1PXVA 2BDLA 4YC9A 1MEMA 3FANA 1MM2A 2RSDA 3U5OA 3DQVR 5C13A 2ECIA 5J3XA 2AUZA 3SOWA 1DCQA 2G6QA 2DC6A 2KGIA 3N9MA 1YK7A 4M0WA 2FUIA 2AS8A 3PRPA 5H1UA 4I7BA 1BY8A 1MHWA 1NQCA 2DC9A 2KWJA 4P6EA 3RNVA 2KWKA 2IBIA 4ZUXU 1F62A 2BAYA 4N4ZA 1WENA 3O0UA 3TNXA 2CKLA 4K7CA 3GL6A 1THEA 4I7DA 1TU6A 4BHWA 4MVTA 3IUTA 3MTVA 2L80A 4RF1A 1PPNA 5JG6A 4WA6A 1GLOA 2MD7B 1BQIA 4B86C 3O36A 4YYWA 2JUNA 4BS5A 1TL9A 3HCSA 3K8UA 1WEEA 3KQIA 3T9KA 2HWKA 2DCDA 4F52B 3HWNA 1DVPA 2XEUA 3P5XA 4KLBA 2KGGA 5CVNB 4W5BA 3TRKA 3IMAA 3SOXA 1IWDA 2YQMA 3PBHA 1Q6KA 2YU4A 5DINA 5AIUA 2FD4A 3HCUA 3T6RA 1U9XA 2YT5A 4OELA 1ZIVA 2PADA 3IFUA 1AU4A 2GFOA 3ZNHA 5A24A 5LKZA 3PURA 1AYUA 3LVRE 4ZTBA 4QRGA 4FK5A 3ZPVE 3ZVYA 1ICFA 3E9SA 2K1JA 3PW3A 1UKFA 2F42A 3ZVZB 1F2CA 2NQAA 5JZEA 4D8BA 1A6RA 3OISA 4YAXA 1PCIA 3KX1A 4P6GA 1PPPA 4P16A 2IDAA 4PTBA 4YYUA 3Q1DA 1CVZA 4AXMA 3FEHA 2C2LA 2CONA 3N9LA 2B1NA 3ZYQA 2XU3A 4V3LC 4LJNA 2NAAA 1AYWA 2JMDA 1V87A 5G04B 1MEGA 4BS6A 3C5KA 4IC2A 1F29A 3O47A 4I05A 2FQ9A 3OF8A 8PCHA 2RI7A 7PCKA 1KFUL 3PRMA 2MUMA 4Z0OA 1NB3A 3TMPA 2EA6A 2MIQA 3LVQE 4GNFA 3PHWA 4GUAA 4YBSA 3HHIA 4TKPB 1ITOA 4MI7A 5B78A 5B75A 1CS8A 3T7LA 4A4CA 2FUDA 2XOCA 3KWBX 2Y5BA 4OEMA 2L43A 3I3TA 2G45A 2HDPA 2CT2A 2QIZA 3U5MA 3M62A 1E4UA 3FAOA 3C9EA 2M6MA 2PUYA 2UZGA 1MIRA 1BORA 1AU3A 3OQCA 3BWKA 3JUEA 2L75A 4CDEB 3USVA 5K3QA 5SVXA 1EWOA 5TABA 4P5OB 2MT5A 2D8SA 1Y4HA 1WFKA 1FH0A 1T1HA 1JM7B 2EGMA 1PPDA 2AN6A 1POPA 2AGAA 1VYXA 2MA5A 1PIPA 1PADA 3O65A 4XR7A 1VJVA 2YJCA 3I2DA 2K16A 3E2DA 1BGOA 1CTEA 3KV6A 1VSNA 3ZUAA 2AVWA 4MM3B 2H0DB 2IPPB 3BBAA 1WEUA 4CA1A 2BU3A 3NHEA 3MJ5A 2HD5A 4RKXA 2LV9A 2ZETC 4R3DA 3V43A 4N3WA 2XU4A 3AI8A 2KIZA 2LN0A 2YVRA 1CJLA 3IV2A 2JRJA 1YK8A 2PNSA 3LFYA 4L58A 5B8DA 4AP4A 1NB5A 1CV8A 2KR4A 4A5UA 2M85A 1S4VA 4DMYA 2R9OA 1YVBA 2VPGA 2P7UA 3CBKA 1CSBB 2LDRA 4GNGA 2L5UA 3N3GA 2M3HA 3LQIA 2G7YA 4CDDB 2PBHA 2YJ9A 4YYQA 1X9YA 3CH2X 1PE6A 4HWYA 5JA7A 2M13A 4I7CA 2DJFB 3V6CA 2VJFA 1Y08A 5E6JA 4PT5A 2NQGA 2F7DA 4YADA 3FL2A 2ECNA 1N87A 4ZDTA 4QRXA 2XU5A 4FJCA 4I04A 3LQHA 4YYRA 4LK9A 4Z0RA 4XUIA 4UI9B 3PNRA 4YATA 1HUCB 4N8WA 4B7YC 4RNAA 1PVJA 3M63A 3F75A 1VD4A 2WBFX 3PDFA 2MD8C 2RR4A 2AIMA
chains in the Genus database with same CATH topology
4LADB 1NL6A 3ZTGA 1GMYA 2Y6EA 5KH7A 2F6JA 4WZ2A 1U9WA 4R8PK 3ZPV1 3WXEA 2M1RA 2JQFR 3DPLR 3O33A 4LLBA 2MA6A 2YURA 1SP4B 5CHVA 3LRQA 3ASLA 2YJBA 1W6FA 3ERVA 4V3KC 4BSQA 2FRQA 3K9MA 1Z60A 4CCGX 5FPWA 3SHBA 4MZSA 4AXLA 5TDWA 2G43A 3K24A 1MS6A 1SNKA 3P5WA 2K17A 4C9ZA 3HD3A 2PNXA 2FT2A 2VPDA 2KFTA 4Q6FA 3N9PA 4YABA 3S3QA 1U6GB 2ECWA 2DZZA 3O35A 3WXGA 2VHSA 3C6WA 4I07A 4IC3A 2CKLB 4N79A 3O37A 5C11A 2LRIC 4AVXA 5TBNA 3HTKC 2R9NA 5EGWA 2E01A 4R2YA 3V6EA 5D1MB 3QT4A 2ECJA 3H89A 3MHSA 1CHCA 3RTRB 3KFQA 2QJ0A 3OF9A 4ZQLA 3S3RA 4W4UA 5J94A 2AYOA 3BOWA 3KKUA 5FB1A 4BGFA 4CZWA 4GNDA 2R9CA 2E6SA 2LGVA 2VP7A 1EWMA 1U5IA 1QOLA 4NN2A 2DCBA 2OZ2A 5CHTA 2CSYA 2H7JA 1CQDA 4BBQA 4BPVA 1WEPA 3L1XA 1FP0A 3H6SA 3U5PA 5TDRA 6PADA 5B76A 4WZ0A 2FO5A 1AU2A 5LCWB 1TLOA 2MNZA 2R6NA 3KNVA 2FUUA 2Y1MA 4YV8A 3KSEA 2R9MA 2KREA 4X6HA 4CDCB 3CBJA 3WXFA 4R7EA 4S3OB 2YJ2A 2O6XA 1ME4A 3O34A 1WEQA 2YYRA 5G05B 1CB5A 2ACTA 2VJEB 5I3LA 3IEJA 3GCBA 2GHUA 3MTNA 1ME3A 4UP5A 3VK6A 3LXSA 2VJFB 5EF4A 1KFXL 1Z2QA 2P86A 5KH9A 1G25A 3BPMA 1RMDA 2KWOA 5LKXA 2NQIA 3E1ZB 1O0EA 2E03A 4YBMA 2YUCA 5H1VA 3ZNIA 2VHFA 2HXZA 4WZ3B 2FSAA 3N9OA 1AU0A 2R9FA 3N3KA 3QZVA 1ZCMA 2DX8A 3RVWA 1W4TA 4YYSA 1WEWA 5DKAA 2VJEA 1WEVA 1CPJA 3IHPA 1WESA 2E00A 4L7XA 1WEOA 5FERA 1F2BA 2CB5A 2L0BA 1YALA 4PP2E 3O7AA 1DEUA 2HH5A 1LDKC 5AITA 3BC3A 3HHAA 3LQJA 3KW9A 4AUQB 1E2TA 1EWPA 3HCTA 3D6SA 4Q8GA 2ECGA 1KHPA 1WEMA 3EB6A 1AYVA 2YSJA 2Y43A 2HHNA 3IOQA 5D1KB 4CDFB 3L11A 1ZBDB 3RPGC 3H8BA 1AECA 1YT7A 2FTDA 2AU1A 4XI1A 4LKAA 3H7DA 3L1ZB 4YYVA 5B79A 3N9NA 4W5CA 2CSZA 2DC8A 4A4BA 2E6RA 5EYAF 1WGMA 2G8EA 1W5RA 1FBVA 1MM3A 2F6NA 2YQLA 2OP3A 2MNYA 9PAPA 3CH3X 3DF0A 1QXPA 3LTWA 1PBHA 4PP1A 3KV5A 5H1TA 5G0FA 4NV8A 2XU1A 1STFE 2DCCA 4MZOA 4QBBA 4DMXA 2I50A 2QICA 1WE9A 2C0YA 1K3BB 4G54A 5F02A 2LXHC 2DZYA 4MSXA 5FEYA 4A0CD 2H0DA 3NG2A 5PADA 5TRBA 5FB0A 2ARYA 3RVXA 3MORA 3O70A 1IYMA 5CVMA 1Z6UA 2YHNA 3EB5A 1JM7A 3N9QA 1HYIA 1KHQA 2E02A 1NLJA 4GB0A 5K16A 1QDQA 2LXPC 1ATKA 3SOUA 1M6DA 4PI3A 2Y1NA 1XKGA 3I06A 4YBTA 2FRAA 3O1GA 1EWLA 4AYCA 5D1LB 4A49A 4X6IA 2NQDB 2EGPA 5KH3A 5LKUA 2B1MA 4PADA 1X4JA 1GECE 3OVXA 1EF7A 1QMYA 4AYCB 2YSMA 1DF0A 4YVAA 2HYED 5B77A 2KWNA 1GCBA 3BCNA 1AIMA 2P0RA 3P5UA 3QSDA 1X4UA 3RVVA 3U8EA 2JMIA 1JQPA 5H9MA 2LGKA 2KU3A 2FYEA 2OULA 2KYUA 2DJGB 4Q8HA 2G6DA 2JMJA 2C2VS 1WILA 1U9VA 2JQGR 3H8CA 1F2AA 5JH3A 3BPFA 2K4DA 4PPEA 4QRVA 3M99A 2VNFA 3PUQA 4S3OC 2EODA 2YW8A 1PPOA 2AYNA 4QH6A 2YREA 4FO9A 3P5VA 1LDJB 3MHHA 2YHOA 4GUZA 3QJ3A 2DC7A 3U5NA 2LQ6A 2ECTA 3KWZA 2PREA 3RPGB 3GV4A 4N4FA 4QF2A 1HYJA 1NPZA 1VFYA 2OXQC 2CIOA 4RY2A 2LGLA 4QF3A 2G8JA 2VFBA 3B79A 5CVOB 5LKTA 1KXRA 1WIMA 2VPEA 2ATOA 2YJ8A 1U9QX 1MDWA 3F5VA 2XB1A 2BDZA 2ECVA 1JOCA 2LGGA 2AUXA 4BQVA 2VPBA 3OVZA 2DCAA 2KE1A 1X4IA 1XWHA 4GNEA 4FIPA 1BP4A 2F1GA 3PHDA 4O64A 4X3GA 4UP0A 4X6JA 3N4CA 1K2FA 1PXVA 2BDLA 4YC9A 1MEMA 1MM2A 2RSDA 3U5OA 2BSZA 3DQVR 5C13A 2ECIA 5J3XA 2AUZA 3SOWA 2G6QA 2DC6A 2KGIA 3N9MA 1YK7A 2FUIA 2AS8A 5H1UA 4I7BA 1BY8A 1MHWA 1NQCA 2DC9A 2KWJA 4P6EA 2KWKA 2IBIA 4ZUXU 1F62A 2BAYA 4N4ZA 1WENA 3O0UA 3TNXA 2CKLA 4K7CA 3GL6A 1THEA 4I7DA 1TU6A 4BHWA 4MVTA 3IUTA 2L80A 1PPNA 5JG6A 4WA6A 1GLOA 2MD7B 1BQIA 4B86C 3O36A 4YYWA 4BS5A 1TL9A 3HCSA 3K8UA 1WEEA 3KQIA 2DCDA 4F52B 3HWNA 1DVPA 2XEUA 3P5XA 4KLBA 2KGGA 5CVNB 4W5BA 3IMAA 3SOXA 1IWDA 2YQMA 3PBHA 1Q6KA 2YU4A 5DINA 3T6RA 3HCUA 5AIUA 1U9XA 2YT5A 4OELA 1ZIVA 2PADA 1AU4A 2GFOA 5A24A 5LKZA 3PURA 1AYUA 4QRGA 4FK5A 3ZPVE 3ZVYA 1ICFA 3PW3A 2K1JA 2F42A 3ZVZB 1F2CA 2NQAA 1A6RA 3OISA 4YAXA 1PCIA 3KX1A 4P6GA 1PPPA 2IDAA 4PTBA 4YYUA 1CVZA 4AXMA 2C2LA 3N9LA 2B1NA 3ZYQA 2XU3A 4V3LC 4LJNA 2NAAA 1AYWA 2JMDA 1V87A 5G04B 1MEGA 4BS6A 3C5KA 4IC2A 1F29A 4NV7A 4I05A 2FQ9A 3OF8A 8PCHA 2RI7A 7PCKA 1KFUL 2MUMA 1NB3A 2EA6A 2MIQA 4GNFA 4C5PA 4YBSA 3HHIA 4TKPB 1ITOA 5B78A 5B75A 1CS8A 3T7LA 4A4CA 2FUDA 3KWBX 2Y5BA 4OEMA 2VFCA 2L43A 3I3TA 2G45A 2HDPA 2CT2A 2QIZA 3U5MA 3M62A 1E4UA 3C9EA 2M6MA 2PUYA 2UZGA 1MIRA 1BORA 1AU3A 3BWKA 2L75A 4CDEB 3USVA 1EWOA 5TABA 4P5OB 2MT5A 2D8SA 1Y4HA 1WFKA 1FH0A 1T1HA 1JM7B 4B55A 1PPDA 2AN6A 1POPA 1VYXA 2MA5A 1PIPA 1PADA 4XR7A 1VJVA 2YJCA 3I2DA 2K16A 1BGOA 1CTEA 3KV6A 1VSNA 3ZUAA 2AVWA 2H0DB 2IPPB 1WEUA 4CA1A 3NHEA 2HD5A 2LV9A 2ZETC 3V43A 4N3WA 2XU4A 3AI8A 2KIZA 2LN0A 1CJLA 3IV2A 2JRJA 1YK8A 2PNSA 3LFYA 4L58A 5B8DA 4AP4A 1NB5A 1CV8A 2KR4A 2M85A 1S4VA 4DMYA 2R9OA 1YVBA 2VPGA 2P7UA 3CBKA 1CSBB 2LDRA 4GNGA 2L5UA 3N3GA 2M3HA 3LQIA 2G7YA 4CDDB 2PBHA 2YJ9A 4YYQA 1X9YA 3CH2X 1PE6A 4HWYA 5JA7A 4I7CA 2DJFB 3V6CA 2VJFA 1Y08A 1GX3A 2NQGA 2F7DA 4YADA 3FL2A 2ECNA 1N87A 4ZDTA 4QRXA 2XU5A 4FJCA 4I04A 3LQHA 4YYRA 4LK9A 4XUIA 3D9WA 4UI9B 3PNRA 4YATA 1HUCB 4N8WA 4B7YC 3M63A 3F75A 1VD4A 2WBFX 3PDFA 2MD8C 2AIMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LAD B;  1NL6 A;  3ZTG A;  1GMY A;  2Y6E A;  5KH7 A;  2F6J A;  4WZ2 A;  1U9W A;  4R8P K;  3ZPV 1;  3WXE A;  2M1R A;  2JQF R;  3DPL R;  3O33 A;  4LLB A;  2MA6 A;  2YUR A;  1SP4 B;  5CHV A;  3LRQ A;  3ASL A;  2YJB A;  3ERV A;  4V3K C;  4BSQ A;  2FRQ A;  3K9M A;  1Z60 A;  4CCG X;  5FPW A;  3SHB A;  4MZS A;  4AXL A;  5TDW A;  2G43 A;  3K24 A;  1MS6 A;  1SNK A;  3P5W A;  2K17 A;  4C9Z A;  3HD3 A;  2PNX A;  2FT2 A;  2VPD A;  2KFT A;  4Q6F A;  3N9P A;  4YAB A;  3S3Q A;  1U6G B;  2ECW A;  2DZZ A;  3O35 A;  3WXG A;  2VHS A;  3C6W A;  4I07 A;  4IC3 A;  2CKL B;  4N79 A;  3O37 A;  5C11 A;  2LRI C;  4AVX A;  5TBN A;  3HTK C;  2R9N A;  5EGW A;  2E01 A;  4R2Y A;  3V6E A;  5D1M B;  3QT4 A;  2ECJ A;  3H89 A;  3MHS A;  1CHC A;  3RTR B;  3KFQ A;  2QJ0 A;  3OF9 A;  4ZQL A;  3S3R A;  4W4U A;  5J94 A;  2AYO A;  3BOW A;  3KKU A;  5FB1 A;  4CZW A;  4GND A;  2R9C A;  2E6S A;  2LGV A;  2VP7 A;  1EWM A;  1U5I A;  1QOL A;  4NN2 A;  2DCB A;  2OZ2 A;  5CHT A;  2CSY A;  2H7J A;  1CQD A;  4BBQ A;  4BPV A;  1WEP A;  3L1X A;  1FP0 A;  3H6S A;  3U5P A;  5TDR A;  6PAD A;  5B76 A;  4WZ0 A;  2FO5 A;  1AU2 A;  5LCW B;  1TLO A;  2MNZ A;  2R6N A;  3KNV A;  2FUU A;  2Y1M A;  4YV8 A;  3KSE A;  2R9M A;  2KRE A;  4X6H A;  4CDC B;  3CBJ A;  3WXF A;  4R7E A;  4S3O B;  2YJ2 A;  2O6X A;  1ME4 A;  3O34 A;  1WEQ A;  2YYR A;  5G05 B;  1CB5 A;  2ACT A;  2VJE B;  5I3L A;  3IEJ A;  3GCB A;  2GHU A;  3MTN A;  1ME3 A;  4UP5 A;  3VK6 A;  3LXS A;  2VJF B;  5EF4 A;  1KFX L;  1Z2Q A;  2P86 A;  5KH9 A;  1G25 A;  3BPM A;  1RMD A;  2KWO A;  5LKX A;  2NQI A;  3E1Z B;  1O0E A;  2E03 A;  4YBM A;  2YUC A;  5H1V A;  3ZNI A;  2VHF A;  2HXZ A;  4WZ3 B;  2FSA A;  3N9O A;  1AU0 A;  2R9F A;  3N3K A;  3QZV A;  1ZCM A;  2DX8 A;  3RVW A;  4YYS A;  1WEW A;  5DKA A;  2VJE A;  1WEV A;  1CPJ A;  3IHP A;  1WES A;  2E00 A;  4L7X A;  1WEO A;  5FER A;  1F2B A;  2CB5 A;  2L0B A;  1YAL A;  4PP2 E;  3O7A A;  1DEU A;  2HH5 A;  1LDK C;  5AIT A;  3BC3 A;  3HHA A;  3LQJ A;  3KW9 A;  4AUQ B;  1EWP A;  3HCT A;  3D6S A;  4Q8G A;  2ECG A;  1KHP A;  1WEM A;  3EB6 A;  1AYV A;  2YSJ A;  2Y43 A;  2HHN A;  3IOQ A;  5D1K B;  4CDF B;  3L11 A;  1ZBD B;  3RPG C;  3H8B A;  1AEC A;  1YT7 A;  2FTD A;  2AU1 A;  4XI1 A;  4LKA A;  3H7D A;  3L1Z B;  4YYV A;  5B79 A;  3N9N A;  4W5C A;  2CSZ A;  2DC8 A;  4A4B A;  2E6R A;  5EYA F;  1WGM A;  2G8E A;  1FBV A;  1MM3 A;  2F6N A;  2YQL A;  2OP3 A;  2MNY A;  9PAP A;  3CH3 X;  3DF0 A;  1QXP A;  1PBH A;  4PP1 A;  3KV5 A;  5H1T A;  5G0F A;  2XU1 A;  1STF E;  2DCC A;  4MZO A;  4QBB A;  4DMX A;  2I50 A;  2QIC A;  1WE9 A;  2C0Y A;  1K3B B;  4G54 A;  5F02 A;  2LXH C;  2DZY A;  4MSX A;  5FEY A;  4A0C D;  2H0D A;  3NG2 A;  5PAD A;  5TRB A;  5FB0 A;  2ARY A;  3RVX A;  3MOR A;  3O70 A;  1IYM A;  5CVM A;  1Z6U A;  2YHN A;  3EB5 A;  1JM7 A;  3N9Q A;  1HYI A;  1KHQ A;  2E02 A;  1NLJ A;  4GB0 A;  5K16 A;  1QDQ A;  2LXP C;  1ATK A;  3SOU A;  1M6D A;  4PI3 A;  2Y1N A;  1XKG A;  3I06 A;  4YBT A;  2FRA A;  3O1G A;  1EWL A;  4AYC A;  5D1L B;  4A49 A;  4X6I A;  2NQD B;  2EGP A;  5KH3 A;  5LKU A;  2B1M A;  4PAD A;  1X4J A;  1GEC E;  3OVX A;  1EF7 A;  1QMY A;  4AYC B;  2YSM A;  1DF0 A;  4YVA A;  2HYE D;  5B77 A;  2KWN A;  1GCB A;  3BCN A;  1AIM A;  2P0R A;  3P5U A;  3QSD A;  1X4U A;  3RVV A;  3U8E A;  2JMI A;  1JQP A;  5H9M A;  2LGK A;  2KU3 A;  2FYE A;  2OUL A;  2KYU A;  2DJG B;  4Q8H A;  2G6D A;  2JMJ A;  2C2V S;  1WIL A;  1U9V A;  2JQG R;  3H8C A;  1F2A A;  5JH3 A;  3BPF A;  2K4D A;  4PPE A;  4QRV A;  3M99 A;  2VNF A;  3PUQ A;  4S3O C;  2EOD A;  2YW8 A;  1PPO A;  2AYN A;  4QH6 A;  2YRE A;  4FO9 A;  3P5V A;  1LDJ B;  3MHH A;  2YHO A;  3QJ3 A;  2DC7 A;  3U5N A;  2LQ6 A;  2ECT A;  3KWZ A;  2PRE A;  3RPG B;  3GV4 A;  4N4F A;  4QF2 A;  1HYJ A;  1NPZ A;  1VFY A;  2OXQ C;  2CIO A;  4RY2 A;  2LGL A;  4QF3 A;  2G8J A;  3B79 A;  5CVO B;  5LKT A;  1KXR A;  1WIM A;  2VPE A;  2ATO A;  2YJ8 A;  1U9Q X;  1MDW A;  3F5V A;  2XB1 A;  2BDZ A;  2ECV A;  1JOC A;  2LGG A;  2AUX A;  4BQV A;  2VPB A;  3OVZ A;  2DCA A;  2KE1 A;  1X4I A;  1XWH A;  4GNE A;  4FIP A;  1BP4 A;  2F1G A;  3PHD A;  4O64 A;  4X3G A;  4UP0 A;  4X6J A;  3N4C A;  1K2F A;  1PXV A;  2BDL A;  4YC9 A;  1MEM A;  1MM2 A;  2RSD A;  3U5O A;  3DQV R;  5C13 A;  2ECI A;  5J3X A;  2AUZ A;  3SOW A;  2G6Q A;  2DC6 A;  2KGI A;  3N9M A;  1YK7 A;  2FUI A;  2AS8 A;  5H1U A;  4I7B A;  1BY8 A;  1MHW A;  1NQC A;  2DC9 A;  2KWJ A;  4P6E A;  2KWK A;  2IBI A;  4ZUX U;  1F62 A;  2BAY A;  4N4Z A;  1WEN A;  3O0U A;  3TNX A;  2CKL A;  4K7C A;  3GL6 A;  1THE A;  4I7D A;  1TU6 A;  4BHW A;  4MVT A;  3IUT A;  2L80 A;  1PPN A;  5JG6 A;  4WA6 A;  1GLO A;  2MD7 B;  1BQI A;  4B86 C;  3O36 A;  4YYW A;  4BS5 A;  1TL9 A;  3HCS A;  3K8U A;  1WEE A;  3KQI A;  2DCD A;  4F52 B;  3HWN A;  1DVP A;  2XEU A;  3P5X A;  4KLB A;  2KGG A;  5CVN B;  4W5B A;  3IMA A;  3SOX A;  1IWD A;  2YQM A;  3PBH A;  1Q6K A;  2YU4 A;  5DIN A;  3T6R A;  3HCU A;  5AIU A;  1U9X A;  2YT5 A;  4OEL A;  1ZIV A;  2PAD A;  1AU4 A;  2GFO A;  5A24 A;  5LKZ A;  3PUR A;  1AYU A;  4QRG A;  4FK5 A;  3ZPV E;  3ZVY A;  1ICF A;  3PW3 A;  2K1J A;  2F42 A;  3ZVZ B;  1F2C A;  2NQA A;  1A6R A;  3OIS A;  4YAX A;  1PCI A;  3KX1 A;  4P6G A;  1PPP A;  2IDA A;  4PTB A;  4YYU A;  1CVZ A;  4AXM A;  2C2L A;  3N9L A;  2B1N A;  3ZYQ A;  2XU3 A;  4V3L C;  4LJN A;  2NAA A;  1AYW A;  2JMD A;  1V87 A;  5G04 B;  1MEG A;  4BS6 A;  3C5K A;  4IC2 A;  1F29 A;  4I05 A;  2FQ9 A;  3OF8 A;  8PCH A;  2RI7 A;  7PCK A;  1KFU L;  2MUM A;  1NB3 A;  2EA6 A;  2MIQ A;  4GNF A;  4YBS A;  3HHI A;  4TKP B;  1ITO A;  5B78 A;  5B75 A;  1CS8 A;  3T7L A;  4A4C A;  2FUD A;  3KWB X;  2Y5B A;  4OEM A;  2L43 A;  3I3T A;  2G45 A;  2HDP A;  2CT2 A;  2QIZ A;  3U5M A;  3M62 A;  1E4U A;  3C9E A;  2M6M A;  2PUY A;  2UZG A;  1MIR A;  1BOR A;  1AU3 A;  3BWK A;  2L75 A;  4CDE B;  3USV A;  1EWO A;  5TAB A;  4P5O B;  2MT5 A;  2D8S A;  1Y4H A;  1WFK A;  1FH0 A;  1T1H A;  1JM7 B;  1PPD A;  2AN6 A;  1POP A;  1VYX A;  2MA5 A;  1PIP A;  1PAD A;  4XR7 A;  1VJV A;  2YJC A;  3I2D A;  2K16 A;  1BGO A;  1CTE A;  3KV6 A;  1VSN A;  3ZUA A;  2AVW A;  2H0D B;  2IPP B;  1WEU A;  4CA1 A;  3NHE A;  2HD5 A;  2LV9 A;  2ZET C;  3V43 A;  4N3W A;  2XU4 A;  3AI8 A;  2KIZ A;  2LN0 A;  1CJL A;  3IV2 A;  2JRJ A;  1YK8 A;  2PNS A;  3LFY A;  4L58 A;  5B8D A;  4AP4 A;  1NB5 A;  1CV8 A;  2KR4 A;  2M85 A;  1S4V A;  4DMY A;  2R9O A;  1YVB A;  2VPG A;  2P7U A;  3CBK A;  1CSB B;  2LDR A;  4GNG A;  2L5U A;  3N3G A;  2M3H A;  3LQI A;  2G7Y A;  4CDD B;  2PBH A;  2YJ9 A;  4YYQ A;  1X9Y A;  3CH2 X;  1PE6 A;  4HWY A;  5JA7 A;  4I7C A;  2DJF B;  3V6C A;  2VJF A;  1Y08 A;  2NQG A;  2F7D A;  4YAD A;  3FL2 A;  2ECN A;  1N87 A;  4ZDT A;  4QRX A;  2XU5 A;  4FJC A;  4I04 A;  3LQH A;  4YYR A;  4LK9 A;  4XUI A;  4UI9 B;  3PNR A;  4YAT A;  1HUC B;  4N8W A;  4B7Y C;  3M63 A;  3F75 A;  1VD4 A;  2WBF X;  3PDF A;  2MD8 C;  2AIM A; 
#chains in the Genus database with same CATH topology
 4LAD B;  1NL6 A;  3ZTG A;  1GMY A;  2Y6E A;  5KH7 A;  2F6J A;  2XP0 A;  4WZ2 A;  1U9W A;  4R8P K;  3ZPV 1;  3WXE A;  2M1R A;  2JQF R;  3DPL R;  3O33 A;  4LLB A;  2XOZ A;  2MA6 A;  2FE8 A;  2EXU A;  2YUR A;  1SP4 B;  3DWD A;  2P57 A;  5CHV A;  3LRQ A;  3ASL A;  2YJB A;  3PLW A;  3ERV A;  4V3K C;  4BSQ A;  2FRQ A;  3K9M A;  1Z60 A;  4CCG X;  5FPW A;  3SHB A;  4MZS A;  4AXL A;  5TDW A;  2G43 A;  3K24 A;  1MS6 A;  1SNK A;  3P5W A;  2K17 A;  4C9Z A;  3HD3 A;  2PNX A;  2FT2 A;  2J7Q A;  2VPD A;  2KFT A;  4Q6F A;  3N9P A;  4YAB A;  3S3Q A;  1U6G B;  2ECW A;  2DZZ A;  3O35 A;  3WXG A;  2VHS A;  3C6W A;  4I07 A;  4IC3 A;  2CKL B;  4N79 A;  3O37 A;  5C11 A;  2LRI C;  4AVX A;  5TBN A;  3HTK C;  2R9N A;  2CRR A;  5EGW A;  2E01 A;  4R2Y A;  3V6E A;  5D1M B;  4F1P A;  2ECJ A;  3QT4 A;  3DDT A;  3MHS A;  1CHC A;  3H89 A;  3RTR B;  3KFQ A;  2QJ0 A;  2UZJ A;  3OF9 A;  4ZQL A;  3S3R A;  4W4U A;  5J94 A;  2AYO A;  3BOW A;  2DSM A;  3KKU A;  5FB1 A;  3FJU B;  2LAU A;  4CZW A;  4GND A;  2R9C A;  2E6S A;  2LGV A;  2VP7 A;  1EWM A;  1U5I A;  2MKE A;  1QOL A;  4NN2 A;  2KKY A;  2DCB A;  2OZ2 A;  5CHT A;  2CSY A;  2H7J A;  1CQD A;  4BBQ A;  3PHX A;  4BPV A;  1WEP A;  3L1X A;  1FP0 A;  3H6S A;  3U5P A;  5TDR A;  6PAD A;  5B76 A;  4WZ0 A;  2FO5 A;  1AU2 A;  2BTW A;  5LCW B;  1TLO A;  2MNZ A;  2R6N A;  3KNV A;  2FUU A;  4OGC A;  2Y1M A;  4YV8 A;  2KKX A;  3KSE A;  2R9M A;  2CSV A;  2KRE A;  4X6H A;  4OVZ A;  4CDC B;  3CBJ A;  3WXF A;  4R7E A;  2OWA A;  4XZX A;  4S3O B;  2YJ2 A;  2O6X A;  3C0R A;  1ME4 A;  3O34 A;  1WEQ A;  2YYR A;  5G05 B;  1CB5 A;  2ACT A;  2VJE B;  5I3L A;  3IEJ A;  3GCB A;  2GHU A;  3MTN A;  1ME3 A;  4UP5 A;  3VK6 A;  3LXS A;  2VJF B;  5EF4 A;  2BTW B;  3B21 A;  1KFX L;  1Z2Q A;  2P86 A;  2Z84 A;  5KH9 A;  3MDB C;  1G25 A;  3BPM A;  1RMD A;  2KWO A;  5LKX A;  2NQI A;  2E61 A;  3E1Z B;  4OVZ B;  1O0E A;  4HXD B;  4D8I A;  2E03 A;  4O62 A;  4YBM A;  2YUC A;  5H1V A;  3ZNI A;  2VHF A;  1MBM A;  2D8U A;  4WZ3 B;  2HXZ A;  2FSA A;  4BOZ A;  3N9O A;  2XOY A;  1AU0 A;  2R9F A;  3N3K A;  3QZV A;  1ZCM A;  2DX8 A;  3RVW A;  4YYS A;  1WEW A;  5DKA A;  2VJE A;  1WEV A;  1CPJ A;  3IHP A;  1WES A;  2E00 A;  4L7X A;  3H7H A;  5EZS A;  1WEO A;  4BOU A;  5FER A;  1F2B A;  3KDE C;  2CB5 A;  2L0B A;  1YAL A;  4PP2 E;  3O7A A;  1DEU A;  2HH5 A;  1LDK C;  5AIT A;  3BC3 A;  3HHA A;  2L7P A;  3LQJ A;  4QQ4 A;  3KW9 A;  4REZ A;  2IQJ A;  4AUQ B;  1EWP A;  3HCT A;  3D6S A;  4Q8G A;  2ECG A;  1KHP A;  1WEM A;  3EB6 A;  1AYV A;  3W31 A;  2YSJ A;  2Y43 A;  2HHN A;  3IOQ A;  5D1K B;  4CDF B;  3L11 A;  4IUM A;  1ZBD B;  3RPG C;  3H8B A;  3BY4 A;  1AEC A;  1YT7 A;  2FTD A;  2AU1 A;  4XI1 A;  4LKA A;  5SVI B;  3H7D A;  3L1Z B;  4YYV A;  5B79 A;  3N9N A;  4W5C A;  2CSZ A;  2JRI A;  4WUR A;  2DC8 A;  4A4B A;  2E6R A;  5EYA F;  1WGM A;  2G8E A;  3SUB A;  1FBV A;  1MM3 A;  2F6N A;  2YQL A;  2OP3 A;  2MNY A;  2JTC A;  9PAP A;  3CH3 X;  3DF0 A;  1QXP A;  4BOS A;  1PBH A;  3MP2 A;  4PP1 A;  3KV5 A;  5H1T A;  5G0F A;  1DKI A;  2XU1 A;  1STF E;  3PHU A;  2DCC A;  4MZO A;  4QBB A;  4DMX A;  2I50 A;  2QIC A;  4H9D A;  1WE9 A;  2C0Y A;  1K3B B;  4G54 A;  2CRW A;  5F02 A;  3LDY A;  2LXH C;  2DZY A;  4MSX A;  5FEY A;  4A0C D;  2H0D A;  3NG2 A;  5PAD A;  5TRB A;  5FB0 A;  2ARY A;  3RVX A;  2FFW A;  3MOR A;  3O70 A;  1IYM A;  5CVM A;  1Z6U A;  2YHN A;  3EB5 A;  3FM8 C;  2JM3 A;  1JM7 A;  3N9Q A;  1HYI A;  1KHQ A;  5KO3 A;  2E02 A;  1NLJ A;  4GB0 A;  5K16 A;  1QDQ A;  2LXP C;  1ATK A;  3SOU A;  1M6D A;  4PI3 A;  2B0O E;  2Y1N A;  2DOS A;  1XKG A;  3I06 A;  4D8E A;  4YBT A;  2FRA A;  3O1G A;  1EWL A;  3PT2 A;  4AYC A;  5D1L B;  4A49 A;  4X6I A;  4OGE A;  2NQD B;  2EGP A;  5KH3 A;  5LKU A;  2J7Q C;  3M7K A;  2B1M A;  2DJA A;  4PAD A;  1X4J A;  1GEC E;  3OVX A;  1EF7 A;  1QMY A;  4AYC B;  2YSM A;  5SVY A;  1DF0 A;  3BB7 A;  4YVA A;  2HYE D;  5B77 A;  2KWN A;  1GCB A;  5EZQ A;  3BCN A;  1AIM A;  2P0R A;  3P5U A;  3QSD A;  1X4U A;  3RVV A;  3U8E A;  2JMI A;  1JQP A;  5H9M A;  4BOQ A;  2LGK A;  2KU3 A;  2FYE A;  2OUL A;  2KYU A;  2DJG B;  4Q8H A;  2G6D A;  2JMJ A;  2C2V S;  1WIL A;  5SVI A;  1U9V A;  2JQG R;  3H8C A;  1YZB A;  1F2A A;  5JH3 A;  3LJU X;  3BPF A;  2K4D A;  4PPE A;  3W30 A;  4QRV A;  3M99 A;  2VNF A;  3PUQ A;  4S3O C;  2EOD A;  2YW8 A;  1PPO A;  2AYN A;  4QH6 A;  4OW0 A;  2YRE A;  4FO9 A;  3P5V A;  1LDJ B;  3MHH A;  2YHO A;  4BOP A;  3QJ3 A;  2DC7 A;  4IP3 A;  3U5N A;  2LQ6 A;  2ECT A;  3KWZ A;  2PRE A;  3RPG B;  3GV4 A;  4N4F A;  4QF2 A;  4RF0 A;  1HYJ A;  1NPZ A;  1VFY A;  2OXQ C;  2CIO A;  4RY2 A;  2LGL A;  4QF3 A;  2G8J A;  3B79 A;  5CVO B;  5LKT A;  1KXR A;  1WIM A;  2VPE A;  2ATO A;  2YJ8 A;  1U9Q X;  1MDW A;  3F5V A;  2XB1 A;  2BDZ A;  2ECV A;  3PSE A;  1JOC A;  2LGG A;  2AUX A;  4BQV A;  2VPB A;  3OVZ A;  2DCA A;  2KE1 A;  1X4I A;  1XWH A;  4GNE A;  4FIP A;  1BP4 A;  2F1G A;  3PHD A;  4O64 A;  4X3G A;  4UP0 A;  4X6J A;  3N4C A;  1K2F A;  1PXV A;  2BDL A;  4YC9 A;  1MEM A;  3FAN A;  1MM2 A;  2RSD A;  3U5O A;  3DQV R;  5C13 A;  2ECI A;  5J3X A;  2AUZ A;  3SOW A;  1DCQ A;  2G6Q A;  2DC6 A;  2KGI A;  3N9M A;  1YK7 A;  4M0W A;  2FUI A;  2AS8 A;  3PRP A;  5H1U A;  4I7B A;  1BY8 A;  1MHW A;  1NQC A;  2DC9 A;  2KWJ A;  4P6E A;  3RNV A;  2KWK A;  2IBI A;  4ZUX U;  1F62 A;  2BAY A;  4N4Z A;  1WEN A;  3O0U A;  3TNX A;  2CKL A;  4K7C A;  3GL6 A;  1THE A;  4I7D A;  1TU6 A;  4BHW A;  4MVT A;  3IUT A;  3MTV A;  2L80 A;  4RF1 A;  1PPN A;  5JG6 A;  4WA6 A;  1GLO A;  2MD7 B;  1BQI A;  4B86 C;  3O36 A;  4YYW A;  2JUN A;  4BS5 A;  1TL9 A;  3HCS A;  3K8U A;  1WEE A;  3KQI A;  3T9K A;  2HWK A;  2DCD A;  4F52 B;  3HWN A;  1DVP A;  2XEU A;  3P5X A;  4KLB A;  2KGG A;  5CVN B;  4W5B A;  3TRK A;  3IMA A;  3SOX A;  1IWD A;  2YQM A;  3PBH A;  1Q6K A;  2YU4 A;  5DIN A;  5AIU A;  2FD4 A;  3HCU A;  3T6R A;  1U9X A;  2YT5 A;  4OEL A;  1ZIV A;  2PAD A;  3IFU A;  1AU4 A;  2GFO A;  3ZNH A;  5A24 A;  5LKZ A;  3PUR A;  1AYU A;  3LVR E;  4ZTB A;  4QRG A;  4FK5 A;  3ZPV E;  3ZVY A;  1ICF A;  3E9S A;  2K1J A;  3PW3 A;  1UKF A;  2F42 A;  3ZVZ B;  1F2C A;  2NQA A;  5JZE A;  4D8B A;  1A6R A;  3OIS A;  4YAX A;  1PCI A;  3KX1 A;  4P6G A;  1PPP A;  4P16 A;  2IDA A;  4PTB A;  4YYU A;  3Q1D A;  1CVZ A;  4AXM A;  3FEH A;  2C2L A;  2CON A;  3N9L A;  2B1N A;  3ZYQ A;  2XU3 A;  4V3L C;  4LJN A;  2NAA A;  1AYW A;  2JMD A;  1V87 A;  5G04 B;  1MEG A;  4BS6 A;  3C5K A;  4IC2 A;  1F29 A;  3O47 A;  4I05 A;  2FQ9 A;  3OF8 A;  8PCH A;  2RI7 A;  7PCK A;  1KFU L;  3PRM A;  2MUM A;  4Z0O A;  1NB3 A;  3TMP A;  2EA6 A;  2MIQ A;  3LVQ E;  4GNF A;  3PHW A;  4GUA A;  4YBS A;  3HHI A;  4TKP B;  1ITO A;  4MI7 A;  5B78 A;  5B75 A;  1CS8 A;  3T7L A;  4A4C A;  2FUD A;  2XOC A;  3KWB X;  2Y5B A;  4OEM A;  2L43 A;  3I3T A;  2G45 A;  2HDP A;  2CT2 A;  2QIZ A;  3U5M A;  3M62 A;  1E4U A;  3FAO A;  3C9E A;  2M6M A;  2PUY A;  2UZG A;  1MIR A;  1BOR A;  1AU3 A;  3OQC A;  3BWK A;  3JUE A;  2L75 A;  4CDE B;  3USV A;  5K3Q A;  5SVX A;  1EWO A;  5TAB A;  4P5O B;  2MT5 A;  2D8S A;  1Y4H A;  1WFK A;  1FH0 A;  1T1H A;  1JM7 B;  2EGM A;  1PPD A;  2AN6 A;  1POP A;  2AGA A;  1VYX A;  2MA5 A;  1PIP A;  1PAD A;  3O65 A;  4XR7 A;  1VJV A;  2YJC A;  3I2D A;  2K16 A;  3E2D A;  1BGO A;  1CTE A;  3KV6 A;  1VSN A;  3ZUA A;  2AVW A;  4MM3 B;  2H0D B;  2IPP B;  3BBA A;  1WEU A;  4CA1 A;  2BU3 A;  3NHE A;  3MJ5 A;  2HD5 A;  4RKX A;  2LV9 A;  2ZET C;  4R3D A;  3V43 A;  4N3W A;  2XU4 A;  3AI8 A;  2KIZ A;  2LN0 A;  2YVR A;  1CJL A;  3IV2 A;  2JRJ A;  1YK8 A;  2PNS A;  3LFY A;  4L58 A;  5B8D A;  4AP4 A;  1NB5 A;  1CV8 A;  2KR4 A;  4A5U A;  2M85 A;  1S4V A;  4DMY A;  2R9O A;  1YVB A;  2VPG A;  2P7U A;  3CBK A;  1CSB B;  2LDR A;  4GNG A;  2L5U A;  3N3G A;  2M3H A;  3LQI A;  2G7Y A;  4CDD B;  2PBH A;  2YJ9 A;  4YYQ A;  1X9Y A;  3CH2 X;  1PE6 A;  4HWY A;  5JA7 A;  2M13 A;  4I7C A;  2DJF B;  3V6C A;  2VJF A;  1Y08 A;  5E6J A;  4PT5 A;  2NQG A;  2F7D A;  4YAD A;  3FL2 A;  2ECN A;  1N87 A;  4ZDT A;  4QRX A;  2XU5 A;  4FJC A;  4I04 A;  3LQH A;  4YYR A;  4LK9 A;  4Z0R A;  4XUI A;  4UI9 B;  3PNR A;  4YAT A;  1HUC B;  4N8W A;  4B7Y C;  4RNA A;  1PVJ A;  3M63 A;  3F75 A;  1VD4 A;  2WBF X;  3PDF A;  2MD8 C;  2RR4 A;  2AIM A; 
#chains in the Genus database with same CATH homology
 4LAD B;  1NL6 A;  3ZTG A;  1GMY A;  2Y6E A;  5KH7 A;  2F6J A;  4WZ2 A;  1U9W A;  4R8P K;  3ZPV 1;  3WXE A;  2M1R A;  2JQF R;  3DPL R;  3O33 A;  4LLB A;  2MA6 A;  2YUR A;  1SP4 B;  5CHV A;  3LRQ A;  3ASL A;  2YJB A;  1W6F A;  3ERV A;  4V3K C;  4BSQ A;  2FRQ A;  3K9M A;  1Z60 A;  4CCG X;  5FPW A;  3SHB A;  4MZS A;  4AXL A;  5TDW A;  2G43 A;  3K24 A;  1MS6 A;  1SNK A;  3P5W A;  2K17 A;  4C9Z A;  3HD3 A;  2PNX A;  2FT2 A;  2VPD A;  2KFT A;  4Q6F A;  3N9P A;  4YAB A;  3S3Q A;  1U6G B;  2ECW A;  2DZZ A;  3O35 A;  3WXG A;  2VHS A;  3C6W A;  4I07 A;  4IC3 A;  2CKL B;  4N79 A;  3O37 A;  5C11 A;  2LRI C;  4AVX A;  5TBN A;  3HTK C;  2R9N A;  5EGW A;  2E01 A;  4R2Y A;  3V6E A;  5D1M B;  3QT4 A;  2ECJ A;  3H89 A;  3MHS A;  1CHC A;  3RTR B;  3KFQ A;  2QJ0 A;  3OF9 A;  4ZQL A;  3S3R A;  4W4U A;  5J94 A;  2AYO A;  3BOW A;  3KKU A;  5FB1 A;  4BGF A;  4CZW A;  4GND A;  2R9C A;  2E6S A;  2LGV A;  2VP7 A;  1EWM A;  1U5I A;  1QOL A;  4NN2 A;  2DCB A;  2OZ2 A;  5CHT A;  2CSY A;  2H7J A;  1CQD A;  4BBQ A;  4BPV A;  1WEP A;  3L1X A;  1FP0 A;  3H6S A;  3U5P A;  5TDR A;  6PAD A;  5B76 A;  4WZ0 A;  2FO5 A;  1AU2 A;  5LCW B;  1TLO A;  2MNZ A;  2R6N A;  3KNV A;  2FUU A;  2Y1M A;  4YV8 A;  3KSE A;  2R9M A;  2KRE A;  4X6H A;  4CDC B;  3CBJ A;  3WXF A;  4R7E A;  4S3O B;  2YJ2 A;  2O6X A;  1ME4 A;  3O34 A;  1WEQ A;  2YYR A;  5G05 B;  1CB5 A;  2ACT A;  2VJE B;  5I3L A;  3IEJ A;  3GCB A;  2GHU A;  3MTN A;  1ME3 A;  4UP5 A;  3VK6 A;  3LXS A;  2VJF B;  5EF4 A;  1KFX L;  1Z2Q A;  2P86 A;  5KH9 A;  1G25 A;  3BPM A;  1RMD A;  2KWO A;  5LKX A;  2NQI A;  3E1Z B;  1O0E A;  2E03 A;  4YBM A;  2YUC A;  5H1V A;  3ZNI A;  2VHF A;  2HXZ A;  4WZ3 B;  2FSA A;  3N9O A;  1AU0 A;  2R9F A;  3N3K A;  3QZV A;  1ZCM A;  2DX8 A;  3RVW A;  1W4T A;  4YYS A;  1WEW A;  5DKA A;  2VJE A;  1WEV A;  1CPJ A;  3IHP A;  1WES A;  2E00 A;  4L7X A;  1WEO A;  5FER A;  1F2B A;  2CB5 A;  2L0B A;  1YAL A;  4PP2 E;  3O7A A;  1DEU A;  2HH5 A;  1LDK C;  5AIT A;  3BC3 A;  3HHA A;  3LQJ A;  3KW9 A;  4AUQ B;  1E2T A;  1EWP A;  3HCT A;  3D6S A;  4Q8G A;  2ECG A;  1KHP A;  1WEM A;  3EB6 A;  1AYV A;  2YSJ A;  2Y43 A;  2HHN A;  3IOQ A;  5D1K B;  4CDF B;  3L11 A;  1ZBD B;  3RPG C;  3H8B A;  1AEC A;  1YT7 A;  2FTD A;  2AU1 A;  4XI1 A;  4LKA A;  3H7D A;  3L1Z B;  4YYV A;  5B79 A;  3N9N A;  4W5C A;  2CSZ A;  2DC8 A;  4A4B A;  2E6R A;  5EYA F;  1WGM A;  2G8E A;  1W5R A;  1FBV A;  1MM3 A;  2F6N A;  2YQL A;  2OP3 A;  2MNY A;  9PAP A;  3CH3 X;  3DF0 A;  1QXP A;  3LTW A;  1PBH A;  4PP1 A;  3KV5 A;  5H1T A;  5G0F A;  4NV8 A;  2XU1 A;  1STF E;  2DCC A;  4MZO A;  4QBB A;  4DMX A;  2I50 A;  2QIC A;  1WE9 A;  2C0Y A;  1K3B B;  4G54 A;  5F02 A;  2LXH C;  2DZY A;  4MSX A;  5FEY A;  4A0C D;  2H0D A;  3NG2 A;  5PAD A;  5TRB A;  5FB0 A;  2ARY A;  3RVX A;  3MOR A;  3O70 A;  1IYM A;  5CVM A;  1Z6U A;  2YHN A;  3EB5 A;  1JM7 A;  3N9Q A;  1HYI A;  1KHQ A;  2E02 A;  1NLJ A;  4GB0 A;  5K16 A;  1QDQ A;  2LXP C;  1ATK A;  3SOU A;  1M6D A;  4PI3 A;  2Y1N A;  1XKG A;  3I06 A;  4YBT A;  2FRA A;  3O1G A;  1EWL A;  4AYC A;  5D1L B;  4A49 A;  4X6I A;  2NQD B;  2EGP A;  5KH3 A;  5LKU A;  2B1M A;  4PAD A;  1X4J A;  1GEC E;  3OVX A;  1EF7 A;  1QMY A;  4AYC B;  2YSM A;  1DF0 A;  4YVA A;  2HYE D;  5B77 A;  2KWN A;  1GCB A;  3BCN A;  1AIM A;  2P0R A;  3P5U A;  3QSD A;  1X4U A;  3RVV A;  3U8E A;  2JMI A;  1JQP A;  5H9M A;  2LGK A;  2KU3 A;  2FYE A;  2OUL A;  2KYU A;  2DJG B;  4Q8H A;  2G6D A;  2JMJ A;  2C2V S;  1WIL A;  1U9V A;  2JQG R;  3H8C A;  1F2A A;  5JH3 A;  3BPF A;  2K4D A;  4PPE A;  4QRV A;  3M99 A;  2VNF A;  3PUQ A;  4S3O C;  2EOD A;  2YW8 A;  1PPO A;  2AYN A;  4QH6 A;  2YRE A;  4FO9 A;  3P5V A;  1LDJ B;  3MHH A;  2YHO A;  4GUZ A;  3QJ3 A;  2DC7 A;  3U5N A;  2LQ6 A;  2ECT A;  3KWZ A;  2PRE A;  3RPG B;  3GV4 A;  4N4F A;  4QF2 A;  1HYJ A;  1NPZ A;  1VFY A;  2OXQ C;  2CIO A;  4RY2 A;  2LGL A;  4QF3 A;  2G8J A;  2VFB A;  3B79 A;  5CVO B;  5LKT A;  1KXR A;  1WIM A;  2VPE A;  2ATO A;  2YJ8 A;  1U9Q X;  1MDW A;  3F5V A;  2XB1 A;  2BDZ A;  2ECV A;  1JOC A;  2LGG A;  2AUX A;  4BQV A;  2VPB A;  3OVZ A;  2DCA A;  2KE1 A;  1X4I A;  1XWH A;  4GNE A;  4FIP A;  1BP4 A;  2F1G A;  3PHD A;  4O64 A;  4X3G A;  4UP0 A;  4X6J A;  3N4C A;  1K2F A;  1PXV A;  2BDL A;  4YC9 A;  1MEM A;  1MM2 A;  2RSD A;  3U5O A;  2BSZ A;  3DQV R;  5C13 A;  2ECI A;  5J3X A;  2AUZ A;  3SOW A;  2G6Q A;  2DC6 A;  2KGI A;  3N9M A;  1YK7 A;  2FUI A;  2AS8 A;  5H1U A;  4I7B A;  1BY8 A;  1MHW A;  1NQC A;  2DC9 A;  2KWJ A;  4P6E A;  2KWK A;  2IBI A;  4ZUX U;  1F62 A;  2BAY A;  4N4Z A;  1WEN A;  3O0U A;  3TNX A;  2CKL A;  4K7C A;  3GL6 A;  1THE A;  4I7D A;  1TU6 A;  4BHW A;  4MVT A;  3IUT A;  2L80 A;  1PPN A;  5JG6 A;  4WA6 A;  1GLO A;  2MD7 B;  1BQI A;  4B86 C;  3O36 A;  4YYW A;  4BS5 A;  1TL9 A;  3HCS A;  3K8U A;  1WEE A;  3KQI A;  2DCD A;  4F52 B;  3HWN A;  1DVP A;  2XEU A;  3P5X A;  4KLB A;  2KGG A;  5CVN B;  4W5B A;  3IMA A;  3SOX A;  1IWD A;  2YQM A;  3PBH A;  1Q6K A;  2YU4 A;  5DIN A;  3T6R A;  3HCU A;  5AIU A;  1U9X A;  2YT5 A;  4OEL A;  1ZIV A;  2PAD A;  1AU4 A;  2GFO A;  5A24 A;  5LKZ A;  3PUR A;  1AYU A;  4QRG A;  4FK5 A;  3ZPV E;  3ZVY A;  1ICF A;  3PW3 A;  2K1J A;  2F42 A;  3ZVZ B;  1F2C A;  2NQA A;  1A6R A;  3OIS A;  4YAX A;  1PCI A;  3KX1 A;  4P6G A;  1PPP A;  2IDA A;  4PTB A;  4YYU A;  1CVZ A;  4AXM A;  2C2L A;  3N9L A;  2B1N A;  3ZYQ A;  2XU3 A;  4V3L C;  4LJN A;  2NAA A;  1AYW A;  2JMD A;  1V87 A;  5G04 B;  1MEG A;  4BS6 A;  3C5K A;  4IC2 A;  1F29 A;  4NV7 A;  4I05 A;  2FQ9 A;  3OF8 A;  8PCH A;  2RI7 A;  7PCK A;  1KFU L;  2MUM A;  1NB3 A;  2EA6 A;  2MIQ A;  4GNF A;  4C5P A;  4YBS A;  3HHI A;  4TKP B;  1ITO A;  5B78 A;  5B75 A;  1CS8 A;  3T7L A;  4A4C A;  2FUD A;  3KWB X;  2Y5B A;  4OEM A;  2VFC A;  2L43 A;  3I3T A;  2G45 A;  2HDP A;  2CT2 A;  2QIZ A;  3U5M A;  3M62 A;  1E4U A;  3C9E A;  2M6M A;  2PUY A;  2UZG A;  1MIR A;  1BOR A;  1AU3 A;  3BWK A;  2L75 A;  4CDE B;  3USV A;  1EWO A;  5TAB A;  4P5O B;  2MT5 A;  2D8S A;  1Y4H A;  1WFK A;  1FH0 A;  1T1H A;  1JM7 B;  4B55 A;  1PPD A;  2AN6 A;  1POP A;  1VYX A;  2MA5 A;  1PIP A;  1PAD A;  4XR7 A;  1VJV A;  2YJC A;  3I2D A;  2K16 A;  1BGO A;  1CTE A;  3KV6 A;  1VSN A;  3ZUA A;  2AVW A;  2H0D B;  2IPP B;  1WEU A;  4CA1 A;  3NHE A;  2HD5 A;  2LV9 A;  2ZET C;  3V43 A;  4N3W A;  2XU4 A;  3AI8 A;  2KIZ A;  2LN0 A;  1CJL A;  3IV2 A;  2JRJ A;  1YK8 A;  2PNS A;  3LFY A;  4L58 A;  5B8D A;  4AP4 A;  1NB5 A;  1CV8 A;  2KR4 A;  2M85 A;  1S4V A;  4DMY A;  2R9O A;  1YVB A;  2VPG A;  2P7U A;  3CBK A;  1CSB B;  2LDR A;  4GNG A;  2L5U A;  3N3G A;  2M3H A;  3LQI A;  2G7Y A;  4CDD B;  2PBH A;  2YJ9 A;  4YYQ A;  1X9Y A;  3CH2 X;  1PE6 A;  4HWY A;  5JA7 A;  4I7C A;  2DJF B;  3V6C A;  2VJF A;  1Y08 A;  1GX3 A;  2NQG A;  2F7D A;  4YAD A;  3FL2 A;  2ECN A;  1N87 A;  4ZDT A;  4QRX A;  2XU5 A;  4FJC A;  4I04 A;  3LQH A;  4YYR A;  4LK9 A;  4XUI A;  3D9W A;  4UI9 B;  3PNR A;  4YAT A;  1HUC B;  4N8W A;  4B7Y C;  3M63 A;  3F75 A;  1VD4 A;  2WBF X;  3PDF A;  2MD8 C;  2AIM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...