3MHSA

Structure of the saga ubp8/sgf11/sus1/sgf73 dub module bound to ubiquitin aldehyde
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
472
structure length
455
Chain Sequence
AMSICPHIQQVFQNEKSKDGVLKTCNAARYILNHSVPKEKFLNTMKCGTCHEINSGATFMCLQCGFCGCWNHSHFLSHSKQIGHIFGINSNNGLLFCFKCEDYIGNIDLINDAILAKYWDDVCTKTMVPSMERRDGLSGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNNCKVRSPDKCFSCALDKIVHELYGALNTSTNRQTGFIYLLTCAWKINQNLAGYSQQDAHEFWQFIINQIHQSYVLDLPNNNKQCECIVHTVFEGSLESSIVCPGCQNNSKTTIDPFLDLSLDIKDKKKLYECLDSFHKKEQLKDFNYHCGECNSTQDAIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKNYCSTKEKDKENGKVPDIIYELIGIVSHKGTVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQAYLLFYTIRQVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the assembly and function of the SAGA deubiquitinating module.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/transcription regulator/protein binding
molecule keywords Ubiquitin carboxyl-terminal hydrolase 8
total genus 134
structure length 455
sequence length 472
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2010-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3mhsA01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3mhsA02
1V87A 2BAYA 4MVTA 2VJFA 2LGLA 2BDLA 4DMXA 4UP5A 1KXRA 2R9FA 9PAPA 3S3QA 1WEOA 3O0UA 2KGIA 1CB5A 3ERVA 1U6GB 3KV6A 4AXLA 1YT7A 1LDJB 2VJFB 4AUQB 1AYUA 1CS8A 4HWYA 2OXQC 1JOCA 2YT5A 4WZ0A 3LQHA 4CDFB 1PE6A 4YYRA 4I05A 2HDPA 3DPLR 2FUDA 2AS8A 4YBMA 1GMYA 3IMAA 2WBFX 1CJLA 3K24A 2KFTA 2YYRA 4C9ZA 5PADA 1X4JA 1Z6UA 4I7CA 2ACTA 4XR7A 1AU3A 4MSXA 2E00A 2KYUA 3C6WA 4PTBA 1CSBB 3QJ3A 5I3LA 3HTKC 4YYVA 4V3KC 2DJGB 3PHDA 4YYWA 5JH3A 2YHNA 5DINA 3HCSA 1GECE 5CVNB 1PIPA 3KKUA 3KWBX 5LKZA 2GHUA 1BORA 5AITA 4W5CA 3GCBA 1GLOA 1MEMA 2FT2A 2FSAA 2FO5A 1BGOA 2VHFA 1PCIA 3BOWA 3ZVYA 2L5UA 4NN2A 5D1MB 5JA7A 5EF4A 4YBTA 3PUQA 1WEQA 3H6SA 2I50A 4B86C 3KSEA 3CBKA 4FJCA 2EODA 2ATOA 3N9OA 3MHHA 4LK9A 1HYIA 3GL6A 5CHTA 2P86A 3O35A 2KWOA 3H7DA 3PNRA 2DC8A 2KWNA 3H8CA 4GNDA 2L80A 2G7YA 1PPNA 1YALA 4QRGA 5G0FA 2MUMA 3C5KA 3ZNIA 3PBHA 3SOWA 2M1RA 1PADA 4YC9A 2LRIC 1PBHA 2G8EA 4CCGX 2P0RA 2NQIA 4YV8A 3RPGB 2JMIA 2YSMA 1PXVA 3C9EA 1QDQA 3LXSA 4I04A 2AIMA 3N9LA 1F2BA 3KWZA 1VFYA 2PNXA 3ZPV1 1ME3A 1TLOA 1JM7B 4YBSA 2JMDA 1WEUA 3OF8A 2FYEA 4PADA 3QT4A 2MA6A 2K4DA 3BPFA 2VPEA 3HCTA 4GB0A 2NQGA 4PP1A 1QXPA 1F62A 5AIUA 2YW8A 3KW9A 2C2LA 2LGGA 3D6SA 2MIQA 1KHPA 1S4VA 1MDWA 1KFXL 1M6DA 4P6EA 1YVBA 2VHSA 3WXFA 4X3GA 3KQIA 3HHIA 2G43A 2FRQA 4QRVA 4YYSA 2EA6A 3BPMA 1CHCA 4V3LC 5D1KB 4YADA 3U5MA 4WZ2A 4N4ZA 1X9YA 1MM2A 5B79A 2AYNA 2DCCA 3E1ZB 3SHBA 3U5NA 2K1JA 5K16A 2IPPB 3HWNA 2E03A 5B77A 5H1UA 2AVWA 3I2DA 4Q6FA 5H1TA 1VJVA 4LLBA 1WESA 4FO9A 2B1NA 1N87A 3O34A 3HHAA 3RVXA 1F2CA 1TU6A 4IC2A 4WA6A 3BWKA 4X6HA 3MORA 5TDWA 1E4UA 1NLJA 3IHPA 2FUIA 1U9QX 5TRBA 5FB0A 4Q8GA 2GFOA 2L0BA 3I3TA 1ICFA 2R9NA 1KHQA 3N9QA 4CDCB 1EWPA 1CQDA 1EF7A 2OZ2A 5LKXA 4O64A 2C0YA 2F1GA 4MZOA 2O6XA 5TABA 3TNXA 4BPVA 3FL2A 4P6GA 2Y1NA 5J94A 2P7UA 2K16A 1WEEA 2ZETC 5JG6A 2ECWA 4PI3A 2F7DA 4FK5A 3EB6A 3L11A 4TKPB 4I7BA 2R9CA 5D1LB 3O70A 1Z2QA 1SP4B 4R7EA 4QF2A 2CIOA 1ZIVA 2HYED 2E01A 4OEMA 5EGWA 3N9PA 2YUCA 2XU4A 8PCHA 5LKUA 3KNVA 2CSZA 3SOUA 1XWHA 2F6JA 3PURA 5F02A 1U5IA 3NG2A 4PP2E 3HCUA 4CZWA 3V6CA 2NQAA 4UP0A 2KR4A 2ECTA 2DZZA 2L43A 3CH2X 1HUCB 3RPGC 4KLBA 1EWLA 2VPDA 2RSDA 3LFYA 3KX1A 4YATA 3U5OA 3P5UA 4YYUA 2ECJA 4I07A 5A24A 4A4BA 4AXMA 5CHVA 4YYQA 4B7YC 2F42A 2HH5A 3ZPVE 2CSYA 1VYXA 2ARYA 1MEGA 1A6RA 4N8WA 2F6NA 5G04B 1K2FA 2MA5A 2YJBA 5H9MA 3O1GA 4A49A 1Y4HA 3H8BA 3F75A 3RTRB 2IDAA 2DCAA 5KH3A 4CDDB 3BC3A 1STFE 4L58A 4W5BA 3IEJA 1SNKA 3PDFA 2XU3A 3O36A 2AUXA 4AYCA 3N3GA 4QRXA 1X4IA 1TL9A 2QJ0A 4ZDTA 5B78A 2XU5A 4N79A 1BP4A 3O37A 1CTEA 2DC6A 4AVXA 4OELA 1HYJA 3BCNA 4BS6A 3L1XA 3SOXA 2HD5A 3ZUAA 1U9WA 1NB3A 2CKLB 1WIMA 2LGKA 5EYAF 5FB1A 2NAAA 2PNSA 4CDEB 3CH3X 3ZYQA 2AU1A 2CT2A 1K3BB 2VPBA 1VD4A 1NL6A 1F2AA 2LDRA 2LN0A 4A0CD 3RVWA 1WENA 5FERA 3DF0A 4G54A 2KGGA 2VJEA 4LJNA 1PPDA 1KFUL 3IV2A 4S3OB 5LCWB 2YURA 4F52B 2G45A 2DC7A 3T7LA 2HXZA 2ECVA 1AYWA 1FBVA 1WEVA 2FQ9A 2OP3A 3P5WA 2UZGA 2XU1A 4I7DA 2Y43A 1Z60A 4RY2A 4BBQA 1AECA 2KWJA 2G8JA 4K7CA 5CVMA 4BS5A 2LV9A 2YREA 5B75A 6PADA 2MD8C 1MM3A 2JRJA 2Y1MA 2CB5A 3K8UA 2LXHC 3LQIA 2H0DA 3OF9A 3RVVA 4WZ3B 2C2VS 1XKGA 1Y08A 1AU4A 3N9MA 2JQFR 2E02A 2LQ6A 1AYVA 4IC3A 5CVOB 1POPA 3CBJA 2PADA 3IOQA 4L7XA 3PW3A 2VJEB 3N3KA 1WEPA 2DC9A 2YHOA 1LDKC 1AU2A 3L1ZB 3B79A 3LRQA 2KIZA 1ITOA 4A4CA 1VSNA 2VP7A 4R2YA 4YVAA 1PPPA 1QMYA 2KREA 2IBIA 2YJ8A 2H7JA 1G25A 2AYOA 4P5OB 3KV5A 3F5VA 1BQIA 5FEYA 2RI7A 3HD3A 1EWMA 3ZVZB 2JMJA 3U5PA 1ZBDB 2FUUA 1DEUA 2MT5A 1NPZA 2DZYA 2QIZA 5KH7A 1AU0A 2KE1A 3AI8A 1RMDA 1FP0A 1WEMA 1JM7A 1WEWA 3GV4A 4FIPA 1IWDA 1X4UA 2R6NA 2KWKA 3ZTGA 1T1HA 1DVPA 2YQMA 1AIMA 3KFQA 2OULA 2MD7B 2MNZA 5DKAA 1FH0A 1CV8A 3I06A 1DF0A 2XB1A 3H89A 5J3XA 2DX8A 5LKTA 1EWOA 1WGMA 5B76A 5TBNA 2FRAA 2R9OA 2K17A 4BHWA 2R9MA 4GNGA 2MNYA 2LXPC 3N9NA 4W4UA 2DJFB 3WXGA 2G6DA 1JQPA 2YSJA 3MHSA 2DCDA 3VK6A 1U9VA 3OISA 1PPOA 4AP4A 2L75A 2M3HA 3M63A 3U8EA 1CPJA 1NQCA 2KU3A 4N3WA 2G6QA 3DQVR 4QH6A 3O33A 1ATKA 4DMYA 2VPGA 3EB5A 2BDZA 1BY8A 3MTNA 3N4CA 4ZQLA 3P5VA 2Y5BA 3M99A 5B8DA 1ZCMA 2EGPA 2M6MA 4X6JA 3M62A 2XEUA 3ASLA 2JQGR 1MIRA 5TDRA 4XI1A 1F29A 5FPWA 3NHEA 4LADB 3K9MA 3OVXA 4BQVA 3USVA 2NQDB 2ECIA 5C13A 1WFKA 4UI9B 1CVZA 2H0DB 2AN6A 3LQJA 2YQLA 2CKLA 1MHWA 7PCKA 4QBBA 4AYCB 2YJ2A 1GCBA 4LKAA 2E6SA 1O0EA 3O7AA 1Q6KA 1U9XA 3S3RA 1WE9A 3P5XA 3T6RA 5C11A 1THEA 1WILA 4N4FA 2YU4A 2PUYA 4QF3A 2B1MA 2LGVA 2FTDA 4X6IA 4Q8HA 5H1VA 2ECGA 4PPEA 2ECNA 4MZSA 4CA1A 4YABA 3IUTA 2AUZA 4ZUXU 4S3OC 1YK7A 2YJ9A 1NB5A 4GNEA 3V43A 1ME4A 3OVZA 3QZVA 5G05B 2Y6EA 4R8PK 4BSQA 2HHNA 2PBHA 2PREA 3QSDA 5KH9A 2DCBA 2E6RA 4YAXA 4GNFA 1MS6A 3V6EA 2D8SA 1YK8A 2QICA 3WXEA 1QOLA 4XUIA 2YJCA 2VNFA 2M85A 1IYMA
chains in the Genus database with same CATH superfamily
1V87A 2BAYA 4MVTA 2VJFA 2LGLA 4H9DA 2BDLA 4DMXA 4UP5A 1KXRA 2R9FA 9PAPA 3S3QA 2L7PA 3Q1DA 1WEOA 3O0UA 2KGIA 1CB5A 3ERVA 1U6GB 3KV6A 4AXLA 1YT7A 1LDJB 2VJFB 4AUQB 1AYUA 1CS8A 4HWYA 2DSMA 2OXQC 1JOCA 2YT5A 4WZ0A 3LQHA 4CDFB 1PE6A 4YYRA 4I05A 2HDPA 3DPLR 2FUDA 2AS8A 4YBMA 2DOSA 1GMYA 2AGAA 3IMAA 2WBFX 1CJLA 3K24A 2KFTA 2YYRA 4C9ZA 4Z0RA 5PADA 1X4JA 1Z6UA 4MI7A 4I7CA 2ACTA 4XR7A 1AU3A 4MSXA 2E00A 3PHUA 2KYUA 3C6WA 4PTBA 1CSBB 3QJ3A 5I3LA 3HTKC 3BY4A 4YYVA 4V3KC 2DJGB 3PHDA 4YYWA 2Z84A 5KO3A 5JH3A 2YHNA 5DINA 3HCSA 1GECE 5CVNB 1PIPA 3KKUA 3KWBX 5LKZA 2GHUA 1BORA 5AITA 4W5CA 3GCBA 1GLOA 1MEMA 2FT2A 2FSAA 2MKEA 3MDBC 2FO5A 1BGOA 1YZBA 1PCIA 2VHFA 3BOWA 3ZVYA 3OQCA 2L5UA 4NN2A 5D1MB 5JA7A 5EF4A 4YBTA 3PUQA 1WEQA 3H6SA 2I50A 4B86C 3KSEA 3CBKA 3PRPA 3O47A 4FJCA 3PRMA 2EODA 2ATOA 4A5UA 3N9OA 5SVXA 3MHHA 4LK9A 1HYIA 3GL6A 5CHTA 2KKYA 2P86A 4IP3A 3O35A 2KWOA 2B0OE 3H7DA 3PNRA 2DC8A 2KWNA 3H8CA 4GNDA 2L80A 2G7YA 1PPNA 4ZTBA 1YALA 4QRGA 5G0FA 2MUMA 3C5KA 3PHWA 3ZNIA 3PBHA 3SOWA 1DCQA 2M1RA 1PADA 4YC9A 2LRIC 1PBHA 2G8EA 4OGEA 4CCGX 2P0RA 2NQIA 4YV8A 3RPGB 2JMIA 2YSMA 1PXVA 3C9EA 1QDQA 3LXSA 4I04A 3T9KA 2AIMA 3TMPA 3N9LA 1F2BA 3KWZA 1VFYA 2PNXA 3ZPV1 1ME3A 4F1PA 1TLOA 1JM7B 4YBSA 2JMDA 1WEUA 4OVZB 3OF8A 2FYEA 4PADA 3QT4A 4IUMA 2MA6A 2K4DA 3BPFA 2VPEA 3HCTA 4GB0A 2NQGA 4PP1A 1QXPA 3MJ5A 1F62A 5AIUA 2YW8A 3KW9A 2C2LA 2LGGA 3D6SA 2MIQA 1KHPA 1PVJA 1S4VA 1MDWA 1KFXL 1M6DA 4P6EA 1YVBA 2VHSA 3WXFA 4X3GA 3KQIA 3HHIA 2G43A 2FRQA 4QRVA 4WURA 4YYSA 2EA6A 3BPMA 1CHCA 4V3LC 5D1KB 3PSEA 4YADA 3U5MA 3E9SA 4WZ2A 4N4ZA 1X9YA 1MM2A 5B79A 2AYNA 2BTWB 2DCCA 3E1ZB 4RF0A 3SHBA 3U5NA 3W30A 2K1JA 5K16A 4D8BA 2IPPB 3HWNA 2E03A 5B77A 3E2DA 5H1UA 2AVWA 3I2DA 4Q6FA 5H1TA 1VJVA 3LVQE 4LLBA 4XZXA 1WESA 4FO9A 2B1NA 1N87A 3O34A 3HHAA 3RVXA 3LJUX 1F2CA 1TU6A 4BOSA 4IC2A 4WA6A 3BWKA 4X6HA 3MORA 4D8EA 5TDWA 2XP0A 1E4UA 1NLJA 3IHPA 2FUIA 1U9QX 5TRBA 5FB0A 4Q8GA 2GFOA 2L0BA 3I3TA 1ICFA 2R9NA 1KHQA 2P57A 3N9QA 4PT5A 4CDCB 1EWPA 3BBAA 1CQDA 1EF7A 2OZ2A 5LKXA 4O64A 2C0YA 4D8IA 2JUNA 2F1GA 4MZOA 2O6XA 5TABA 3TNXA 4BPVA 3FL2A 4P6GA 2Y1NA 5J94A 2P7UA 2K16A 1WEEA 2ZETC 5JG6A 2ECWA 4PI3A 2F7DA 4FK5A 3EB6A 3L11A 4TKPB 4I7BA 2R9CA 4REZA 5D1LB 2XOZA 3O70A 1Z2QA 1SP4B 3MP2A 3PLWA 4R7EA 4QF2A 2CIOA 1ZIVA 2HYED 5K3QA 2E01A 3IFUA 4OEMA 5EGWA 3N9PA 2YUCA 2XU4A 8PCHA 5LKUA 4Z0OA 3KNVA 2OWAA 2CSZA 3SOUA 1XWHA 2F6JA 3PURA 5F02A 1U5IA 2JRIA 3NG2A 4PP2E 3HCUA 4CZWA 3V6CA 2NQAA 2CRRA 2KR4A 4UP0A 2ECTA 2DZZA 2L43A 2LAUA 3CH2X 1HUCB 3RPGC 4KLBA 1EWLA 2VPDA 2RSDA 2YVRA 3LFYA 3KX1A 4YATA 3U5OA 3P5UA 4YYUA 2ECJA 4I07A 5A24A 4A4BA 4AXMA 5CHVA 2BU3A 4YYQA 4B7YC 2F42A 2HH5A 3ZPVE 2CSYA 1VYXA 2ARYA 1MEGA 1A6RA 4OVZA 4N8WA 2F6NA 2JM3A 5G04B 1K2FA 2MA5A 2YJBA 5H9MA 3O1GA 4P16A 4A49A 1Y4HA 3H8BA 3F75A 3RTRB 2IDAA 2DCAA 5KH3A 4CDDB 2UZJA 3BC3A 4BOZA 2RR4A 1STFE 4L58A 4W5BA 4OGCA 3IEJA 1SNKA 3PDFA 2XOCA 2XU3A 3O36A 2AUXA 4AYCA 3N3GA 4QRXA 1X4IA 1TL9A 1DKIA 2QJ0A 4ZDTA 5B78A 2XU5A 4N79A 1BP4A 3O37A 1CTEA 2DC6A 2XOYA 3FEHA 2IQJA 4AVXA 4OELA 1HYJA 2BTWA 3M7KA 3BCNA 3PHXA 4BS6A 3L1XA 3SOXA 2HD5A 3W31A 3ZUAA 1U9WA 1NB3A 2CKLB 1WIMA 2LGKA 5EYAF 5FB1A 2NAAA 2PNSA 4CDEB 3CH3X 4BOPA 2EXUA 3ZYQA 2AU1A 2CT2A 3ZNHA 1K3BB 2VPBA 1VD4A 1NL6A 1F2AA 2LDRA 4BOQA 2E61A 3MTVA 2LN0A 4A0CD 3RVWA 5JZEA 1WENA 5FERA 3DF0A 4G54A 2KGGA 2VJEA 4LJNA 1PPDA 1KFUL 3IV2A 4S3OB 5LCWB 2YURA 4F52B 2G45A 2DC7A 3T7LA 2HXZA 2ECVA 5SVYA 1AYWA 1FBVA 1WEVA 2FQ9A 2OP3A 3P5WA 3LDYA 2UZGA 2XU1A 4I7DA 2Y43A 3H7HA 1Z60A 4RY2A 4BBQA 1AECA 2KWJA 3DWDA 2G8JA 4K7CA 5CVMA 4BS5A 2LV9A 3JUEA 2YREA 5B75A 6PADA 2MD8C 3FJUB 1MM3A 1UKFA 2JRJA 2Y1MA 2CB5A 3K8UA 2LXHC 2D8UA 2H0DA 3LQIA 3OF9A 4WZ3B 3RVVA 4QQ4A 2C2VS 1XKGA 1Y08A 1AU4A 3N9MA 2JQFR 2E02A 2LQ6A 1AYVA 4IC3A 5CVOB 1POPA 3CBJA 2PADA 3IOQA 4L7XA 3PW3A 2VJEB 3N3KA 1WEPA 2DC9A 2YHOA 3FAOA 1LDKC 3KDEC 1AU2A 3B21A 3L1ZB 3B79A 3LRQA 2KIZA 3C0RA 1ITOA 4RNAA 4A4CA 1VSNA 2VP7A 4R2YA 4YVAA 1PPPA 1QMYA 2KREA 2IBIA 2YJ8A 3PT2A 2H7JA 1G25A 2AYOA 4P5OB 3KV5A 3F5VA 1BQIA 5FEYA 2RI7A 3HD3A 1EWMA 3ZVZB 2J7QA 2DJAA 3FM8C 2JMJA 2FD4A 1ZBDB 2FUUA 3U5PA 1DEUA 2MT5A 1NPZA 2DZYA 2EGMA 2QIZA 5KH7A 1AU0A 2KE1A 3AI8A 1RMDA 1FP0A 1WEMA 1JM7A 1WEWA 3GV4A 4FIPA 2FE8A 1IWDA 1X4UA 2R6NA 3TRKA 2KWKA 3ZTGA 3O65A 1T1HA 1DVPA 2YQMA 1AIMA 3KFQA 2M13A 2OULA 2MD7B 2MNZA 5DKAA 1FH0A 1CV8A 3I06A 1DF0A 2XB1A 3H89A 5J3XA 2DX8A 5LKTA 5EZSA 1EWOA 1WGMA 5B76A 5TBNA 2FRAA 3SUBA 2R9OA 4R3DA 2K17A 4BHWA 2R9MA 4GNGA 2MNYA 2LXPC 3N9NA 3DDTA 4W4UA 2DJFB 5EZQA 3WXGA 2G6DA 1JQPA 2YSJA 3MHSA 2DCDA 2J7QC 3VK6A 4HXDB 4BOUA 1U9VA 3OISA 1PPOA 4AP4A 2L75A 2M3HA 3M63A 3BB7A 3U8EA 1CPJA 1NQCA 4RF1A 2KU3A 4N3WA 2G6QA 3DQVR 4QH6A 3O33A 5SVIB 1ATKA 4DMYA 2CRWA 2VPGA 3RNVA 2KKXA 3EB5A 2BDZA 1BY8A 3MTNA 3N4CA 4ZQLA 2CSVA 3P5VA 2CONA 2Y5BA 3M99A 1MBMA 5B8DA 1ZCMA 2EGPA 2M6MA 4GUAA 4X6JA 3M62A 2XEUA 3ASLA 2JQGR 1MIRA 5TDRA 4XI1A 1F29A 4RKXA 5FPWA 3NHEA 4LADB 3K9MA 3OVXA 4BQVA 3USVA 2NQDB 2ECIA 5C13A 1WFKA 4O62A 4UI9B 1CVZA 2H0DB 2AN6A 3LQJA 2YQLA 2CKLA 1MHWA 7PCKA 4QBBA 4AYCB 2YJ2A 1GCBA 3LVRE 4M0WA 4LKAA 2E6SA 1O0EA 3O7AA 1Q6KA 1U9XA 3S3RA 5SVIA 1WE9A 3P5XA 3T6RA 5C11A 1THEA 1WILA 4N4FA 2YU4A 2PUYA 4QF3A 2B1MA 2LGVA 2FTDA 4X6IA 4Q8HA 5H1VA 2ECGA 3FANA 4PPEA 2ECNA 2HWKA 4MZSA 4CA1A 4YABA 3IUTA 2AUZA 4ZUXU 4S3OC 1YK7A 2YJ9A 1NB5A 4GNEA 3V43A 1ME4A 3OVZA 3QZVA 5G05B 2Y6EA 4R8PK 4OW0A 2HHNA 4BSQA 2PBHA 4MM3B 2PREA 3QSDA 5KH9A 2DCBA 2E6RA 4YAXA 4GNFA 1MS6A 2JTCA 3V6EA 2D8SA 2FFWA 2QICA 1YK8A 3WXEA 5E6JA 1QOLA 4XUIA 2YJCA 2VNFA 2M85A 1IYMA
chains in the Genus database with same CATH topology
1V87A 2BAYA 4MVTA 2VJFA 2LGLA 2BDLA 4DMXA 4UP5A 1KXRA 2R9FA 9PAPA 3S3QA 1WEOA 3O0UA 2KGIA 1CB5A 3ERVA 1U6GB 3KV6A 4AXLA 1YT7A 1LDJB 2VJFB 4AUQB 1AYUA 1CS8A 4HWYA 2OXQC 1JOCA 2YT5A 4WZ0A 3LQHA 4CDFB 1PE6A 4YYRA 1E2TA 4I05A 2HDPA 3DPLR 2FUDA 2AS8A 4YBMA 1GMYA 3IMAA 2WBFX 1CJLA 3K24A 2KFTA 2YYRA 4C9ZA 5PADA 1X4JA 1Z6UA 4I7CA 2ACTA 4XR7A 1AU3A 4MSXA 2E00A 2KYUA 3C6WA 4PTBA 1CSBB 3QJ3A 5I3LA 3HTKC 4YYVA 4V3KC 2DJGB 3PHDA 4YYWA 5JH3A 2YHNA 5DINA 3HCSA 1GECE 5CVNB 1PIPA 3KKUA 3KWBX 5LKZA 2GHUA 1BORA 5AITA 4W5CA 1GX3A 3GCBA 1GLOA 1MEMA 2FT2A 2FSAA 2FO5A 1BGOA 2VHFA 1PCIA 3BOWA 3ZVYA 2L5UA 4NN2A 5D1MB 5JA7A 5EF4A 4YBTA 3PUQA 1WEQA 3H6SA 2I50A 4B86C 3KSEA 3CBKA 4FJCA 2EODA 2ATOA 3N9OA 3MHHA 4LK9A 1HYIA 3GL6A 5CHTA 2P86A 3O35A 2KWOA 3H7DA 3PNRA 2DC8A 2KWNA 3H8CA 4GNDA 2L80A 2G7YA 1PPNA 1YALA 4QRGA 5G0FA 2MUMA 3C5KA 3ZNIA 3PBHA 3SOWA 2M1RA 1PADA 4YC9A 2LRIC 1PBHA 2G8EA 4CCGX 2P0RA 2NQIA 4YV8A 3RPGB 2JMIA 2YSMA 1PXVA 3C9EA 1QDQA 3LXSA 4I04A 2AIMA 3N9LA 1F2BA 3KWZA 1VFYA 2PNXA 3ZPV1 1ME3A 1TLOA 1JM7B 4YBSA 2JMDA 1WEUA 3OF8A 2FYEA 4PADA 3QT4A 2MA6A 2K4DA 3BPFA 2VPEA 3HCTA 4GB0A 2NQGA 4PP1A 1QXPA 1F62A 5AIUA 2YW8A 3KW9A 2C2LA 2LGGA 3D6SA 2MIQA 1KHPA 1S4VA 1MDWA 1KFXL 1M6DA 4P6EA 1YVBA 2VHSA 3WXFA 4X3GA 3KQIA 3HHIA 2G43A 2FRQA 4QRVA 4YYSA 2EA6A 3BPMA 1CHCA 4V3LC 5D1KB 4YADA 3U5MA 4WZ2A 4N4ZA 1X9YA 1MM2A 5B79A 2AYNA 2DCCA 3E1ZB 3SHBA 4NV7A 3U5NA 2K1JA 5K16A 2IPPB 3HWNA 2E03A 2VFCA 5B77A 5H1UA 2AVWA 3I2DA 4Q6FA 5H1TA 1VJVA 4LLBA 1WESA 4FO9A 2B1NA 1N87A 3O34A 3HHAA 3RVXA 1F2CA 1TU6A 4IC2A 4WA6A 3BWKA 4X6HA 3MORA 5TDWA 1E4UA 1NLJA 3IHPA 2FUIA 1U9QX 5TRBA 5FB0A 2BSZA 4Q8GA 2GFOA 4NV8A 2L0BA 3I3TA 1ICFA 2R9NA 1KHQA 3N9QA 4CDCB 1EWPA 1CQDA 1EF7A 2OZ2A 5LKXA 4O64A 2C0YA 2F1GA 4MZOA 2O6XA 5TABA 3TNXA 4BPVA 3FL2A 4P6GA 2Y1NA 5J94A 2P7UA 2K16A 1WEEA 2ZETC 5JG6A 2ECWA 4PI3A 2F7DA 4FK5A 3EB6A 3L11A 4TKPB 4I7BA 2R9CA 5D1LB 3O70A 1Z2QA 1SP4B 4R7EA 4QF2A 2CIOA 1ZIVA 2HYED 2E01A 4OEMA 5EGWA 4B55A 3N9PA 2YUCA 2XU4A 8PCHA 5LKUA 3KNVA 2CSZA 3SOUA 1XWHA 4C5PA 2F6JA 3PURA 5F02A 1U5IA 3NG2A 4PP2E 3HCUA 4CZWA 3V6CA 2NQAA 4UP0A 2KR4A 2VFBA 2ECTA 2DZZA 2L43A 3CH2X 1HUCB 3RPGC 4KLBA 1EWLA 2VPDA 2RSDA 3LFYA 3KX1A 4YATA 3U5OA 3P5UA 4YYUA 2ECJA 4I07A 5A24A 4A4BA 4AXMA 5CHVA 4YYQA 4B7YC 2F42A 2HH5A 3ZPVE 2CSYA 1VYXA 2ARYA 1MEGA 1A6RA 4N8WA 2F6NA 5G04B 1K2FA 2MA5A 2YJBA 5H9MA 3O1GA 4A49A 1Y4HA 3H8BA 3F75A 3RTRB 2IDAA 2DCAA 5KH3A 4CDDB 3BC3A 1STFE 4L58A 4W5BA 3IEJA 1SNKA 3PDFA 2XU3A 3O36A 2AUXA 4AYCA 3N3GA 4QRXA 1X4IA 1TL9A 2QJ0A 4ZDTA 5B78A 2XU5A 4N79A 1BP4A 3O37A 1CTEA 2DC6A 4AVXA 4OELA 1HYJA 3BCNA 4BS6A 3L1XA 3SOXA 2HD5A 3ZUAA 1U9WA 1NB3A 2CKLB 1WIMA 2LGKA 5EYAF 5FB1A 2NAAA 2PNSA 4CDEB 3CH3X 3ZYQA 2AU1A 2CT2A 1K3BB 2VPBA 1VD4A 1NL6A 1F2AA 2LDRA 2LN0A 4A0CD 3RVWA 1WENA 5FERA 3DF0A 4G54A 2KGGA 2VJEA 4LJNA 1PPDA 1KFUL 3IV2A 4S3OB 5LCWB 2YURA 4F52B 2G45A 2DC7A 3T7LA 2HXZA 2ECVA 1AYWA 1FBVA 1WEVA 2FQ9A 2OP3A 3P5WA 2UZGA 2XU1A 4I7DA 2Y43A 1Z60A 4RY2A 4BBQA 1AECA 2KWJA 2G8JA 4K7CA 5CVMA 4BS5A 2LV9A 2YREA 5B75A 6PADA 2MD8C 1MM3A 2JRJA 2Y1MA 2CB5A 3K8UA 2LXHC 3LQIA 2H0DA 3OF9A 3RVVA 4WZ3B 2C2VS 1XKGA 1Y08A 1AU4A 3N9MA 2JQFR 2E02A 2LQ6A 1AYVA 4IC3A 5CVOB 1POPA 3CBJA 2PADA 3IOQA 4L7XA 3PW3A 2VJEB 3N3KA 1WEPA 2DC9A 2YHOA 1LDKC 1AU2A 3L1ZB 3B79A 3LRQA 2KIZA 1ITOA 4A4CA 1VSNA 2VP7A 4R2YA 4YVAA 1PPPA 1QMYA 2KREA 2IBIA 2YJ8A 2H7JA 1G25A 2AYOA 4P5OB 3KV5A 3F5VA 1BQIA 5FEYA 2RI7A 3HD3A 1EWMA 3ZVZB 2JMJA 3U5PA 1ZBDB 2FUUA 1DEUA 2MT5A 1NPZA 2DZYA 2QIZA 5KH7A 1AU0A 2KE1A 3AI8A 1RMDA 1FP0A 1WEMA 1JM7A 1WEWA 3GV4A 4FIPA 1IWDA 1X4UA 2R6NA 2KWKA 3ZTGA 1W5RA 1T1HA 1DVPA 2YQMA 1AIMA 3KFQA 2OULA 2MD7B 2MNZA 5DKAA 1FH0A 1CV8A 3I06A 1DF0A 2XB1A 3H89A 5J3XA 2DX8A 5LKTA 1EWOA 1WGMA 5B76A 5TBNA 2FRAA 2R9OA 2K17A 4BHWA 2R9MA 4GNGA 2MNYA 2LXPC 3N9NA 4W4UA 2DJFB 3WXGA 2G6DA 1JQPA 2YSJA 3MHSA 2DCDA 3VK6A 1U9VA 3OISA 1PPOA 4AP4A 2L75A 2M3HA 3M63A 3U8EA 1CPJA 1NQCA 2KU3A 4N3WA 2G6QA 3DQVR 4QH6A 3O33A 1ATKA 4DMYA 2VPGA 3EB5A 2BDZA 1BY8A 3MTNA 3N4CA 4ZQLA 3P5VA 2Y5BA 3M99A 5B8DA 1ZCMA 2EGPA 2M6MA 3D9WA 4X6JA 3M62A 2XEUA 3ASLA 2JQGR 1MIRA 5TDRA 4XI1A 1F29A 5FPWA 3NHEA 4LADB 3K9MA 1W4TA 3OVXA 4BQVA 3USVA 2NQDB 2ECIA 3LTWA 4BGFA 5C13A 1WFKA 4UI9B 1CVZA 2H0DB 2AN6A 3LQJA 2YQLA 2CKLA 1MHWA 7PCKA 4QBBA 4AYCB 2YJ2A 1GCBA 4LKAA 2E6SA 1O0EA 3O7AA 1Q6KA 1U9XA 3S3RA 1W6FA 1WE9A 3P5XA 3T6RA 5C11A 1THEA 4GUZA 1WILA 4N4FA 2YU4A 2PUYA 4QF3A 2B1MA 2LGVA 2FTDA 4X6IA 4Q8HA 5H1VA 2ECGA 4PPEA 2ECNA 4MZSA 4CA1A 4YABA 3IUTA 2AUZA 4ZUXU 4S3OC 1YK7A 2YJ9A 1NB5A 4GNEA 3V43A 1ME4A 3OVZA 3QZVA 5G05B 2Y6EA 4R8PK 4BSQA 2HHNA 2PBHA 2PREA 3QSDA 5KH9A 2DCBA 2E6RA 4YAXA 4GNFA 1MS6A 3V6EA 2D8SA 1YK8A 2QICA 3WXEA 1QOLA 4XUIA 2YJCA 2VNFA 2M85A 1IYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V87 A;  2BAY A;  4MVT A;  2VJF A;  2LGL A;  2BDL A;  4DMX A;  4UP5 A;  1KXR A;  2R9F A;  9PAP A;  3S3Q A;  1WEO A;  3O0U A;  2KGI A;  1CB5 A;  3ERV A;  1U6G B;  3KV6 A;  4AXL A;  1YT7 A;  1LDJ B;  2VJF B;  4AUQ B;  1AYU A;  1CS8 A;  4HWY A;  2OXQ C;  1JOC A;  2YT5 A;  4WZ0 A;  3LQH A;  4CDF B;  1PE6 A;  4YYR A;  4I05 A;  2HDP A;  3DPL R;  2FUD A;  2AS8 A;  4YBM A;  1GMY A;  3IMA A;  2WBF X;  1CJL A;  3K24 A;  2KFT A;  2YYR A;  4C9Z A;  5PAD A;  1X4J A;  1Z6U A;  4I7C A;  2ACT A;  4XR7 A;  1AU3 A;  4MSX A;  2E00 A;  2KYU A;  3C6W A;  4PTB A;  1CSB B;  3QJ3 A;  5I3L A;  3HTK C;  4YYV A;  4V3K C;  2DJG B;  3PHD A;  4YYW A;  5JH3 A;  2YHN A;  5DIN A;  3HCS A;  1GEC E;  5CVN B;  1PIP A;  3KKU A;  3KWB X;  5LKZ A;  2GHU A;  1BOR A;  5AIT A;  4W5C A;  3GCB A;  1GLO A;  1MEM A;  2FT2 A;  2FSA A;  2FO5 A;  1BGO A;  2VHF A;  1PCI A;  3BOW A;  3ZVY A;  2L5U A;  4NN2 A;  5D1M B;  5JA7 A;  5EF4 A;  4YBT A;  3PUQ A;  1WEQ A;  3H6S A;  2I50 A;  4B86 C;  3KSE A;  3CBK A;  4FJC A;  2EOD A;  2ATO A;  3N9O A;  3MHH A;  4LK9 A;  1HYI A;  3GL6 A;  5CHT A;  2P86 A;  3O35 A;  2KWO A;  3H7D A;  3PNR A;  2DC8 A;  2KWN A;  3H8C A;  4GND A;  2L80 A;  2G7Y A;  1PPN A;  1YAL A;  4QRG A;  5G0F A;  2MUM A;  3C5K A;  3ZNI A;  3PBH A;  3SOW A;  2M1R A;  1PAD A;  4YC9 A;  2LRI C;  1PBH A;  2G8E A;  4CCG X;  2P0R A;  2NQI A;  4YV8 A;  3RPG B;  2JMI A;  2YSM A;  1PXV A;  3C9E A;  1QDQ A;  3LXS A;  4I04 A;  2AIM A;  3N9L A;  1F2B A;  3KWZ A;  1VFY A;  2PNX A;  3ZPV 1;  1ME3 A;  1TLO A;  1JM7 B;  4YBS A;  2JMD A;  1WEU A;  3OF8 A;  2FYE A;  4PAD A;  3QT4 A;  2MA6 A;  2K4D A;  3BPF A;  2VPE A;  3HCT A;  4GB0 A;  2NQG A;  4PP1 A;  1QXP A;  1F62 A;  5AIU A;  2YW8 A;  3KW9 A;  2C2L A;  2LGG A;  3D6S A;  2MIQ A;  1KHP A;  1S4V A;  1MDW A;  1KFX L;  1M6D A;  4P6E A;  1YVB A;  2VHS A;  3WXF A;  4X3G A;  3KQI A;  3HHI A;  2G43 A;  2FRQ A;  4QRV A;  4YYS A;  2EA6 A;  3BPM A;  1CHC A;  4V3L C;  5D1K B;  4YAD A;  3U5M A;  4WZ2 A;  4N4Z A;  1X9Y A;  1MM2 A;  5B79 A;  2AYN A;  2DCC A;  3E1Z B;  3SHB A;  3U5N A;  2K1J A;  5K16 A;  2IPP B;  3HWN A;  2E03 A;  5B77 A;  5H1U A;  2AVW A;  3I2D A;  4Q6F A;  5H1T A;  1VJV A;  4LLB A;  1WES A;  4FO9 A;  2B1N A;  1N87 A;  3O34 A;  3HHA A;  3RVX A;  1F2C A;  1TU6 A;  4IC2 A;  4WA6 A;  3BWK A;  4X6H A;  3MOR A;  5TDW A;  1E4U A;  1NLJ A;  3IHP A;  2FUI A;  1U9Q X;  5TRB A;  5FB0 A;  4Q8G A;  2GFO A;  2L0B A;  3I3T A;  1ICF A;  2R9N A;  1KHQ A;  3N9Q A;  4CDC B;  1EWP A;  1CQD A;  1EF7 A;  2OZ2 A;  5LKX A;  4O64 A;  2C0Y A;  2F1G A;  4MZO A;  2O6X A;  5TAB A;  3TNX A;  4BPV A;  3FL2 A;  4P6G A;  2Y1N A;  5J94 A;  2P7U A;  2K16 A;  1WEE A;  2ZET C;  5JG6 A;  2ECW A;  4PI3 A;  2F7D A;  4FK5 A;  3EB6 A;  3L11 A;  4TKP B;  4I7B A;  2R9C A;  5D1L B;  3O70 A;  1Z2Q A;  1SP4 B;  4R7E A;  4QF2 A;  2CIO A;  1ZIV A;  2HYE D;  2E01 A;  4OEM A;  5EGW A;  3N9P A;  2YUC A;  2XU4 A;  8PCH A;  5LKU A;  3KNV A;  2CSZ A;  3SOU A;  1XWH A;  2F6J A;  3PUR A;  5F02 A;  1U5I A;  3NG2 A;  4PP2 E;  3HCU A;  4CZW A;  3V6C A;  2NQA A;  4UP0 A;  2KR4 A;  2ECT A;  2DZZ A;  2L43 A;  3CH2 X;  1HUC B;  3RPG C;  4KLB A;  1EWL A;  2VPD A;  2RSD A;  3LFY A;  3KX1 A;  4YAT A;  3U5O A;  3P5U A;  4YYU A;  2ECJ A;  4I07 A;  5A24 A;  4A4B A;  4AXM A;  5CHV A;  4YYQ A;  4B7Y C;  2F42 A;  2HH5 A;  3ZPV E;  2CSY A;  1VYX A;  2ARY A;  1MEG A;  1A6R A;  4N8W A;  2F6N A;  5G04 B;  1K2F A;  2MA5 A;  2YJB A;  5H9M A;  3O1G A;  4A49 A;  1Y4H A;  3H8B A;  3F75 A;  3RTR B;  2IDA A;  2DCA A;  5KH3 A;  4CDD B;  3BC3 A;  1STF E;  4L58 A;  4W5B A;  3IEJ A;  1SNK A;  3PDF A;  2XU3 A;  3O36 A;  2AUX A;  4AYC A;  3N3G A;  4QRX A;  1X4I A;  1TL9 A;  2QJ0 A;  4ZDT A;  5B78 A;  2XU5 A;  4N79 A;  1BP4 A;  3O37 A;  1CTE A;  2DC6 A;  4AVX A;  4OEL A;  1HYJ A;  3BCN A;  4BS6 A;  3L1X A;  3SOX A;  2HD5 A;  3ZUA A;  1U9W A;  1NB3 A;  2CKL B;  1WIM A;  2LGK A;  5EYA F;  5FB1 A;  2NAA A;  2PNS A;  4CDE B;  3CH3 X;  3ZYQ A;  2AU1 A;  2CT2 A;  1K3B B;  2VPB A;  1VD4 A;  1NL6 A;  1F2A A;  2LDR A;  2LN0 A;  4A0C D;  3RVW A;  1WEN A;  5FER A;  3DF0 A;  4G54 A;  2KGG A;  2VJE A;  4LJN A;  1PPD A;  1KFU L;  3IV2 A;  4S3O B;  5LCW B;  2YUR A;  4F52 B;  2G45 A;  2DC7 A;  3T7L A;  2HXZ A;  2ECV A;  1AYW A;  1FBV A;  1WEV A;  2FQ9 A;  2OP3 A;  3P5W A;  2UZG A;  2XU1 A;  4I7D A;  2Y43 A;  1Z60 A;  4RY2 A;  4BBQ A;  1AEC A;  2KWJ A;  2G8J A;  4K7C A;  5CVM A;  4BS5 A;  2LV9 A;  2YRE A;  5B75 A;  6PAD A;  2MD8 C;  1MM3 A;  2JRJ A;  2Y1M A;  2CB5 A;  3K8U A;  2LXH C;  3LQI A;  2H0D A;  3OF9 A;  3RVV A;  4WZ3 B;  2C2V S;  1XKG A;  1Y08 A;  1AU4 A;  3N9M A;  2JQF R;  2E02 A;  2LQ6 A;  1AYV A;  4IC3 A;  5CVO B;  1POP A;  3CBJ A;  2PAD A;  3IOQ A;  4L7X A;  3PW3 A;  2VJE B;  3N3K A;  1WEP A;  2DC9 A;  2YHO A;  1LDK C;  1AU2 A;  3L1Z B;  3B79 A;  3LRQ A;  2KIZ A;  1ITO A;  4A4C A;  1VSN A;  2VP7 A;  4R2Y A;  4YVA A;  1PPP A;  1QMY A;  2KRE A;  2IBI A;  2YJ8 A;  2H7J A;  1G25 A;  2AYO A;  4P5O B;  3KV5 A;  3F5V A;  1BQI A;  5FEY A;  2RI7 A;  3HD3 A;  1EWM A;  3ZVZ B;  2JMJ A;  3U5P A;  1ZBD B;  2FUU A;  1DEU A;  2MT5 A;  1NPZ A;  2DZY A;  2QIZ A;  5KH7 A;  1AU0 A;  2KE1 A;  3AI8 A;  1RMD A;  1FP0 A;  1WEM A;  1JM7 A;  1WEW A;  3GV4 A;  4FIP A;  1IWD A;  1X4U A;  2R6N A;  2KWK A;  3ZTG A;  1T1H A;  1DVP A;  2YQM A;  1AIM A;  3KFQ A;  2OUL A;  2MD7 B;  2MNZ A;  5DKA A;  1FH0 A;  1CV8 A;  3I06 A;  1DF0 A;  2XB1 A;  3H89 A;  5J3X A;  2DX8 A;  5LKT A;  1EWO A;  1WGM A;  5B76 A;  5TBN A;  2FRA A;  2R9O A;  2K17 A;  4BHW A;  2R9M A;  4GNG A;  2MNY A;  2LXP C;  3N9N A;  4W4U A;  2DJF B;  3WXG A;  2G6D A;  1JQP A;  2YSJ A;  3MHS A;  2DCD A;  3VK6 A;  1U9V A;  3OIS A;  1PPO A;  4AP4 A;  2L75 A;  2M3H A;  3M63 A;  3U8E A;  1CPJ A;  1NQC A;  2KU3 A;  4N3W A;  2G6Q A;  3DQV R;  4QH6 A;  3O33 A;  1ATK A;  4DMY A;  2VPG A;  3EB5 A;  2BDZ A;  1BY8 A;  3MTN A;  3N4C A;  4ZQL A;  3P5V A;  2Y5B A;  3M99 A;  5B8D A;  1ZCM A;  2EGP A;  2M6M A;  4X6J A;  3M62 A;  2XEU A;  3ASL A;  2JQG R;  1MIR A;  5TDR A;  4XI1 A;  1F29 A;  5FPW A;  3NHE A;  4LAD B;  3K9M A;  3OVX A;  4BQV A;  3USV A;  2NQD B;  2ECI A;  5C13 A;  1WFK A;  4UI9 B;  1CVZ A;  2H0D B;  2AN6 A;  3LQJ A;  2YQL A;  2CKL A;  1MHW A;  7PCK A;  4QBB A;  4AYC B;  2YJ2 A;  1GCB A;  4LKA A;  2E6S A;  1O0E A;  3O7A A;  1Q6K A;  1U9X A;  3S3R A;  1WE9 A;  3P5X A;  3T6R A;  5C11 A;  1THE A;  1WIL A;  4N4F A;  2YU4 A;  2PUY A;  4QF3 A;  2B1M A;  2LGV A;  2FTD A;  4X6I A;  4Q8H A;  5H1V A;  2ECG A;  4PPE A;  2ECN A;  4MZS A;  4CA1 A;  4YAB A;  3IUT A;  2AUZ A;  4ZUX U;  4S3O C;  1YK7 A;  2YJ9 A;  1NB5 A;  4GNE A;  3V43 A;  1ME4 A;  3OVZ A;  3QZV A;  5G05 B;  2Y6E A;  4R8P K;  4BSQ A;  2HHN A;  2PBH A;  2PRE A;  3QSD A;  5KH9 A;  2DCB A;  2E6R A;  4YAX A;  4GNF A;  1MS6 A;  3V6E A;  2D8S A;  1YK8 A;  2QIC A;  3WXE A;  1QOL A;  4XUI A;  2YJC A;  2VNF A;  2M85 A;  1IYM A; 
#chains in the Genus database with same CATH topology
 1V87 A;  2BAY A;  4MVT A;  2VJF A;  2LGL A;  4H9D A;  2BDL A;  4DMX A;  4UP5 A;  1KXR A;  2R9F A;  9PAP A;  3S3Q A;  2L7P A;  3Q1D A;  1WEO A;  3O0U A;  2KGI A;  1CB5 A;  3ERV A;  1U6G B;  3KV6 A;  4AXL A;  1YT7 A;  1LDJ B;  2VJF B;  4AUQ B;  1AYU A;  1CS8 A;  4HWY A;  2DSM A;  2OXQ C;  1JOC A;  2YT5 A;  4WZ0 A;  3LQH A;  4CDF B;  1PE6 A;  4YYR A;  4I05 A;  2HDP A;  3DPL R;  2FUD A;  2AS8 A;  4YBM A;  2DOS A;  1GMY A;  2AGA A;  3IMA A;  2WBF X;  1CJL A;  3K24 A;  2KFT A;  2YYR A;  4C9Z A;  4Z0R A;  5PAD A;  1X4J A;  1Z6U A;  4MI7 A;  4I7C A;  2ACT A;  4XR7 A;  1AU3 A;  4MSX A;  2E00 A;  3PHU A;  2KYU A;  3C6W A;  4PTB A;  1CSB B;  3QJ3 A;  5I3L A;  3HTK C;  3BY4 A;  4YYV A;  4V3K C;  2DJG B;  3PHD A;  4YYW A;  2Z84 A;  5KO3 A;  5JH3 A;  2YHN A;  5DIN A;  3HCS A;  1GEC E;  5CVN B;  1PIP A;  3KKU A;  3KWB X;  5LKZ A;  2GHU A;  1BOR A;  5AIT A;  4W5C A;  3GCB A;  1GLO A;  1MEM A;  2FT2 A;  2FSA A;  2MKE A;  3MDB C;  2FO5 A;  1BGO A;  1YZB A;  1PCI A;  2VHF A;  3BOW A;  3ZVY A;  3OQC A;  2L5U A;  4NN2 A;  5D1M B;  5JA7 A;  5EF4 A;  4YBT A;  3PUQ A;  1WEQ A;  3H6S A;  2I50 A;  4B86 C;  3KSE A;  3CBK A;  3PRP A;  3O47 A;  4FJC A;  3PRM A;  2EOD A;  2ATO A;  4A5U A;  3N9O A;  5SVX A;  3MHH A;  4LK9 A;  1HYI A;  3GL6 A;  5CHT A;  2KKY A;  2P86 A;  4IP3 A;  3O35 A;  2KWO A;  2B0O E;  3H7D A;  3PNR A;  2DC8 A;  2KWN A;  3H8C A;  4GND A;  2L80 A;  2G7Y A;  1PPN A;  4ZTB A;  1YAL A;  4QRG A;  5G0F A;  2MUM A;  3C5K A;  3PHW A;  3ZNI A;  3PBH A;  3SOW A;  1DCQ A;  2M1R A;  1PAD A;  4YC9 A;  2LRI C;  1PBH A;  2G8E A;  4OGE A;  4CCG X;  2P0R A;  2NQI A;  4YV8 A;  3RPG B;  2JMI A;  2YSM A;  1PXV A;  3C9E A;  1QDQ A;  3LXS A;  4I04 A;  3T9K A;  2AIM A;  3TMP A;  3N9L A;  1F2B A;  3KWZ A;  1VFY A;  2PNX A;  3ZPV 1;  1ME3 A;  4F1P A;  1TLO A;  1JM7 B;  4YBS A;  2JMD A;  1WEU A;  4OVZ B;  3OF8 A;  2FYE A;  4PAD A;  3QT4 A;  4IUM A;  2MA6 A;  2K4D A;  3BPF A;  2VPE A;  3HCT A;  4GB0 A;  2NQG A;  4PP1 A;  1QXP A;  3MJ5 A;  1F62 A;  5AIU A;  2YW8 A;  3KW9 A;  2C2L A;  2LGG A;  3D6S A;  2MIQ A;  1KHP A;  1PVJ A;  1S4V A;  1MDW A;  1KFX L;  1M6D A;  4P6E A;  1YVB A;  2VHS A;  3WXF A;  4X3G A;  3KQI A;  3HHI A;  2G43 A;  2FRQ A;  4QRV A;  4WUR A;  4YYS A;  2EA6 A;  3BPM A;  1CHC A;  4V3L C;  5D1K B;  3PSE A;  4YAD A;  3U5M A;  3E9S A;  4WZ2 A;  4N4Z A;  1X9Y A;  1MM2 A;  5B79 A;  2AYN A;  2BTW B;  2DCC A;  3E1Z B;  4RF0 A;  3SHB A;  3U5N A;  3W30 A;  2K1J A;  5K16 A;  4D8B A;  2IPP B;  3HWN A;  2E03 A;  5B77 A;  3E2D A;  5H1U A;  2AVW A;  3I2D A;  4Q6F A;  5H1T A;  1VJV A;  3LVQ E;  4LLB A;  4XZX A;  1WES A;  4FO9 A;  2B1N A;  1N87 A;  3O34 A;  3HHA A;  3RVX A;  3LJU X;  1F2C A;  1TU6 A;  4BOS A;  4IC2 A;  4WA6 A;  3BWK A;  4X6H A;  3MOR A;  4D8E A;  5TDW A;  2XP0 A;  1E4U A;  1NLJ A;  3IHP A;  2FUI A;  1U9Q X;  5TRB A;  5FB0 A;  4Q8G A;  2GFO A;  2L0B A;  3I3T A;  1ICF A;  2R9N A;  1KHQ A;  2P57 A;  3N9Q A;  4PT5 A;  4CDC B;  1EWP A;  3BBA A;  1CQD A;  1EF7 A;  2OZ2 A;  5LKX A;  4O64 A;  2C0Y A;  4D8I A;  2JUN A;  2F1G A;  4MZO A;  2O6X A;  5TAB A;  3TNX A;  4BPV A;  3FL2 A;  4P6G A;  2Y1N A;  5J94 A;  2P7U A;  2K16 A;  1WEE A;  2ZET C;  5JG6 A;  2ECW A;  4PI3 A;  2F7D A;  4FK5 A;  3EB6 A;  3L11 A;  4TKP B;  4I7B A;  2R9C A;  4REZ A;  5D1L B;  2XOZ A;  3O70 A;  1Z2Q A;  1SP4 B;  3MP2 A;  3PLW A;  4R7E A;  4QF2 A;  2CIO A;  1ZIV A;  2HYE D;  5K3Q A;  2E01 A;  3IFU A;  4OEM A;  5EGW A;  3N9P A;  2YUC A;  2XU4 A;  8PCH A;  5LKU A;  4Z0O A;  3KNV A;  2OWA A;  2CSZ A;  3SOU A;  1XWH A;  2F6J A;  3PUR A;  5F02 A;  1U5I A;  2JRI A;  3NG2 A;  4PP2 E;  3HCU A;  4CZW A;  3V6C A;  2NQA A;  2CRR A;  2KR4 A;  4UP0 A;  2ECT A;  2DZZ A;  2L43 A;  2LAU A;  3CH2 X;  1HUC B;  3RPG C;  4KLB A;  1EWL A;  2VPD A;  2RSD A;  2YVR A;  3LFY A;  3KX1 A;  4YAT A;  3U5O A;  3P5U A;  4YYU A;  2ECJ A;  4I07 A;  5A24 A;  4A4B A;  4AXM A;  5CHV A;  2BU3 A;  4YYQ A;  4B7Y C;  2F42 A;  2HH5 A;  3ZPV E;  2CSY A;  1VYX A;  2ARY A;  1MEG A;  1A6R A;  4OVZ A;  4N8W A;  2F6N A;  2JM3 A;  5G04 B;  1K2F A;  2MA5 A;  2YJB A;  5H9M A;  3O1G A;  4P16 A;  4A49 A;  1Y4H A;  3H8B A;  3F75 A;  3RTR B;  2IDA A;  2DCA A;  5KH3 A;  4CDD B;  2UZJ A;  3BC3 A;  4BOZ A;  2RR4 A;  1STF E;  4L58 A;  4W5B A;  4OGC A;  3IEJ A;  1SNK A;  3PDF A;  2XOC A;  2XU3 A;  3O36 A;  2AUX A;  4AYC A;  3N3G A;  4QRX A;  1X4I A;  1TL9 A;  1DKI A;  2QJ0 A;  4ZDT A;  5B78 A;  2XU5 A;  4N79 A;  1BP4 A;  3O37 A;  1CTE A;  2DC6 A;  2XOY A;  3FEH A;  2IQJ A;  4AVX A;  4OEL A;  1HYJ A;  2BTW A;  3M7K A;  3BCN A;  3PHX A;  4BS6 A;  3L1X A;  3SOX A;  2HD5 A;  3W31 A;  3ZUA A;  1U9W A;  1NB3 A;  2CKL B;  1WIM A;  2LGK A;  5EYA F;  5FB1 A;  2NAA A;  2PNS A;  4CDE B;  3CH3 X;  4BOP A;  2EXU A;  3ZYQ A;  2AU1 A;  2CT2 A;  3ZNH A;  1K3B B;  2VPB A;  1VD4 A;  1NL6 A;  1F2A A;  2LDR A;  4BOQ A;  2E61 A;  3MTV A;  2LN0 A;  4A0C D;  3RVW A;  5JZE A;  1WEN A;  5FER A;  3DF0 A;  4G54 A;  2KGG A;  2VJE A;  4LJN A;  1PPD A;  1KFU L;  3IV2 A;  4S3O B;  5LCW B;  2YUR A;  4F52 B;  2G45 A;  2DC7 A;  3T7L A;  2HXZ A;  2ECV A;  5SVY A;  1AYW A;  1FBV A;  1WEV A;  2FQ9 A;  2OP3 A;  3P5W A;  3LDY A;  2UZG A;  2XU1 A;  4I7D A;  2Y43 A;  3H7H A;  1Z60 A;  4RY2 A;  4BBQ A;  1AEC A;  2KWJ A;  3DWD A;  2G8J A;  4K7C A;  5CVM A;  4BS5 A;  2LV9 A;  3JUE A;  2YRE A;  5B75 A;  6PAD A;  2MD8 C;  3FJU B;  1MM3 A;  1UKF A;  2JRJ A;  2Y1M A;  2CB5 A;  3K8U A;  2LXH C;  2D8U A;  2H0D A;  3LQI A;  3OF9 A;  4WZ3 B;  3RVV A;  4QQ4 A;  2C2V S;  1XKG A;  1Y08 A;  1AU4 A;  3N9M A;  2JQF R;  2E02 A;  2LQ6 A;  1AYV A;  4IC3 A;  5CVO B;  1POP A;  3CBJ A;  2PAD A;  3IOQ A;  4L7X A;  3PW3 A;  2VJE B;  3N3K A;  1WEP A;  2DC9 A;  2YHO A;  3FAO A;  1LDK C;  3KDE C;  1AU2 A;  3B21 A;  3L1Z B;  3B79 A;  3LRQ A;  2KIZ A;  3C0R A;  1ITO A;  4RNA A;  4A4C A;  1VSN A;  2VP7 A;  4R2Y A;  4YVA A;  1PPP A;  1QMY A;  2KRE A;  2IBI A;  2YJ8 A;  3PT2 A;  2H7J A;  1G25 A;  2AYO A;  4P5O B;  3KV5 A;  3F5V A;  1BQI A;  5FEY A;  2RI7 A;  3HD3 A;  1EWM A;  3ZVZ B;  2J7Q A;  2DJA A;  3FM8 C;  2JMJ A;  2FD4 A;  1ZBD B;  2FUU A;  3U5P A;  1DEU A;  2MT5 A;  1NPZ A;  2DZY A;  2EGM A;  2QIZ A;  5KH7 A;  1AU0 A;  2KE1 A;  3AI8 A;  1RMD A;  1FP0 A;  1WEM A;  1JM7 A;  1WEW A;  3GV4 A;  4FIP A;  2FE8 A;  1IWD A;  1X4U A;  2R6N A;  3TRK A;  2KWK A;  3ZTG A;  3O65 A;  1T1H A;  1DVP A;  2YQM A;  1AIM A;  3KFQ A;  2M13 A;  2OUL A;  2MD7 B;  2MNZ A;  5DKA A;  1FH0 A;  1CV8 A;  3I06 A;  1DF0 A;  2XB1 A;  3H89 A;  5J3X A;  2DX8 A;  5LKT A;  5EZS A;  1EWO A;  1WGM A;  5B76 A;  5TBN A;  2FRA A;  3SUB A;  2R9O A;  4R3D A;  2K17 A;  4BHW A;  2R9M A;  4GNG A;  2MNY A;  2LXP C;  3N9N A;  3DDT A;  4W4U A;  2DJF B;  5EZQ A;  3WXG A;  2G6D A;  1JQP A;  2YSJ A;  3MHS A;  2DCD A;  2J7Q C;  3VK6 A;  4HXD B;  4BOU A;  1U9V A;  3OIS A;  1PPO A;  4AP4 A;  2L75 A;  2M3H A;  3M63 A;  3BB7 A;  3U8E A;  1CPJ A;  1NQC A;  4RF1 A;  2KU3 A;  4N3W A;  2G6Q A;  3DQV R;  4QH6 A;  3O33 A;  5SVI B;  1ATK A;  4DMY A;  2CRW A;  2VPG A;  3RNV A;  2KKX A;  3EB5 A;  2BDZ A;  1BY8 A;  3MTN A;  3N4C A;  4ZQL A;  2CSV A;  3P5V A;  2CON A;  2Y5B A;  3M99 A;  1MBM A;  5B8D A;  1ZCM A;  2EGP A;  2M6M A;  4GUA A;  4X6J A;  3M62 A;  2XEU A;  3ASL A;  2JQG R;  1MIR A;  5TDR A;  4XI1 A;  1F29 A;  4RKX A;  5FPW A;  3NHE A;  4LAD B;  3K9M A;  3OVX A;  4BQV A;  3USV A;  2NQD B;  2ECI A;  5C13 A;  1WFK A;  4O62 A;  4UI9 B;  1CVZ A;  2H0D B;  2AN6 A;  3LQJ A;  2YQL A;  2CKL A;  1MHW A;  7PCK A;  4QBB A;  4AYC B;  2YJ2 A;  1GCB A;  3LVR E;  4M0W A;  4LKA A;  2E6S A;  1O0E A;  3O7A A;  1Q6K A;  1U9X A;  3S3R A;  5SVI A;  1WE9 A;  3P5X A;  3T6R A;  5C11 A;  1THE A;  1WIL A;  4N4F A;  2YU4 A;  2PUY A;  4QF3 A;  2B1M A;  2LGV A;  2FTD A;  4X6I A;  4Q8H A;  5H1V A;  2ECG A;  3FAN A;  4PPE A;  2ECN A;  2HWK A;  4MZS A;  4CA1 A;  4YAB A;  3IUT A;  2AUZ A;  4ZUX U;  4S3O C;  1YK7 A;  2YJ9 A;  1NB5 A;  4GNE A;  3V43 A;  1ME4 A;  3OVZ A;  3QZV A;  5G05 B;  2Y6E A;  4R8P K;  4OW0 A;  2HHN A;  4BSQ A;  2PBH A;  4MM3 B;  2PRE A;  3QSD A;  5KH9 A;  2DCB A;  2E6R A;  4YAX A;  4GNF A;  1MS6 A;  2JTC A;  3V6E A;  2D8S A;  2FFW A;  2QIC A;  1YK8 A;  3WXE A;  5E6J A;  1QOL A;  4XUI A;  2YJC A;  2VNF A;  2M85 A;  1IYM A; 
#chains in the Genus database with same CATH homology
 1V87 A;  2BAY A;  4MVT A;  2VJF A;  2LGL A;  2BDL A;  4DMX A;  4UP5 A;  1KXR A;  2R9F A;  9PAP A;  3S3Q A;  1WEO A;  3O0U A;  2KGI A;  1CB5 A;  3ERV A;  1U6G B;  3KV6 A;  4AXL A;  1YT7 A;  1LDJ B;  2VJF B;  4AUQ B;  1AYU A;  1CS8 A;  4HWY A;  2OXQ C;  1JOC A;  2YT5 A;  4WZ0 A;  3LQH A;  4CDF B;  1PE6 A;  4YYR A;  1E2T A;  4I05 A;  2HDP A;  3DPL R;  2FUD A;  2AS8 A;  4YBM A;  1GMY A;  3IMA A;  2WBF X;  1CJL A;  3K24 A;  2KFT A;  2YYR A;  4C9Z A;  5PAD A;  1X4J A;  1Z6U A;  4I7C A;  2ACT A;  4XR7 A;  1AU3 A;  4MSX A;  2E00 A;  2KYU A;  3C6W A;  4PTB A;  1CSB B;  3QJ3 A;  5I3L A;  3HTK C;  4YYV A;  4V3K C;  2DJG B;  3PHD A;  4YYW A;  5JH3 A;  2YHN A;  5DIN A;  3HCS A;  1GEC E;  5CVN B;  1PIP A;  3KKU A;  3KWB X;  5LKZ A;  2GHU A;  1BOR A;  5AIT A;  4W5C A;  1GX3 A;  3GCB A;  1GLO A;  1MEM A;  2FT2 A;  2FSA A;  2FO5 A;  1BGO A;  2VHF A;  1PCI A;  3BOW A;  3ZVY A;  2L5U A;  4NN2 A;  5D1M B;  5JA7 A;  5EF4 A;  4YBT A;  3PUQ A;  1WEQ A;  3H6S A;  2I50 A;  4B86 C;  3KSE A;  3CBK A;  4FJC A;  2EOD A;  2ATO A;  3N9O A;  3MHH A;  4LK9 A;  1HYI A;  3GL6 A;  5CHT A;  2P86 A;  3O35 A;  2KWO A;  3H7D A;  3PNR A;  2DC8 A;  2KWN A;  3H8C A;  4GND A;  2L80 A;  2G7Y A;  1PPN A;  1YAL A;  4QRG A;  5G0F A;  2MUM A;  3C5K A;  3ZNI A;  3PBH A;  3SOW A;  2M1R A;  1PAD A;  4YC9 A;  2LRI C;  1PBH A;  2G8E A;  4CCG X;  2P0R A;  2NQI A;  4YV8 A;  3RPG B;  2JMI A;  2YSM A;  1PXV A;  3C9E A;  1QDQ A;  3LXS A;  4I04 A;  2AIM A;  3N9L A;  1F2B A;  3KWZ A;  1VFY A;  2PNX A;  3ZPV 1;  1ME3 A;  1TLO A;  1JM7 B;  4YBS A;  2JMD A;  1WEU A;  3OF8 A;  2FYE A;  4PAD A;  3QT4 A;  2MA6 A;  2K4D A;  3BPF A;  2VPE A;  3HCT A;  4GB0 A;  2NQG A;  4PP1 A;  1QXP A;  1F62 A;  5AIU A;  2YW8 A;  3KW9 A;  2C2L A;  2LGG A;  3D6S A;  2MIQ A;  1KHP A;  1S4V A;  1MDW A;  1KFX L;  1M6D A;  4P6E A;  1YVB A;  2VHS A;  3WXF A;  4X3G A;  3KQI A;  3HHI A;  2G43 A;  2FRQ A;  4QRV A;  4YYS A;  2EA6 A;  3BPM A;  1CHC A;  4V3L C;  5D1K B;  4YAD A;  3U5M A;  4WZ2 A;  4N4Z A;  1X9Y A;  1MM2 A;  5B79 A;  2AYN A;  2DCC A;  3E1Z B;  3SHB A;  4NV7 A;  3U5N A;  2K1J A;  5K16 A;  2IPP B;  3HWN A;  2E03 A;  2VFC A;  5B77 A;  5H1U A;  2AVW A;  3I2D A;  4Q6F A;  5H1T A;  1VJV A;  4LLB A;  1WES A;  4FO9 A;  2B1N A;  1N87 A;  3O34 A;  3HHA A;  3RVX A;  1F2C A;  1TU6 A;  4IC2 A;  4WA6 A;  3BWK A;  4X6H A;  3MOR A;  5TDW A;  1E4U A;  1NLJ A;  3IHP A;  2FUI A;  1U9Q X;  5TRB A;  5FB0 A;  2BSZ A;  4Q8G A;  2GFO A;  4NV8 A;  2L0B A;  3I3T A;  1ICF A;  2R9N A;  1KHQ A;  3N9Q A;  4CDC B;  1EWP A;  1CQD A;  1EF7 A;  2OZ2 A;  5LKX A;  4O64 A;  2C0Y A;  2F1G A;  4MZO A;  2O6X A;  5TAB A;  3TNX A;  4BPV A;  3FL2 A;  4P6G A;  2Y1N A;  5J94 A;  2P7U A;  2K16 A;  1WEE A;  2ZET C;  5JG6 A;  2ECW A;  4PI3 A;  2F7D A;  4FK5 A;  3EB6 A;  3L11 A;  4TKP B;  4I7B A;  2R9C A;  5D1L B;  3O70 A;  1Z2Q A;  1SP4 B;  4R7E A;  4QF2 A;  2CIO A;  1ZIV A;  2HYE D;  2E01 A;  4OEM A;  5EGW A;  4B55 A;  3N9P A;  2YUC A;  2XU4 A;  8PCH A;  5LKU A;  3KNV A;  2CSZ A;  3SOU A;  1XWH A;  4C5P A;  2F6J A;  3PUR A;  5F02 A;  1U5I A;  3NG2 A;  4PP2 E;  3HCU A;  4CZW A;  3V6C A;  2NQA A;  4UP0 A;  2KR4 A;  2VFB A;  2ECT A;  2DZZ A;  2L43 A;  3CH2 X;  1HUC B;  3RPG C;  4KLB A;  1EWL A;  2VPD A;  2RSD A;  3LFY A;  3KX1 A;  4YAT A;  3U5O A;  3P5U A;  4YYU A;  2ECJ A;  4I07 A;  5A24 A;  4A4B A;  4AXM A;  5CHV A;  4YYQ A;  4B7Y C;  2F42 A;  2HH5 A;  3ZPV E;  2CSY A;  1VYX A;  2ARY A;  1MEG A;  1A6R A;  4N8W A;  2F6N A;  5G04 B;  1K2F A;  2MA5 A;  2YJB A;  5H9M A;  3O1G A;  4A49 A;  1Y4H A;  3H8B A;  3F75 A;  3RTR B;  2IDA A;  2DCA A;  5KH3 A;  4CDD B;  3BC3 A;  1STF E;  4L58 A;  4W5B A;  3IEJ A;  1SNK A;  3PDF A;  2XU3 A;  3O36 A;  2AUX A;  4AYC A;  3N3G A;  4QRX A;  1X4I A;  1TL9 A;  2QJ0 A;  4ZDT A;  5B78 A;  2XU5 A;  4N79 A;  1BP4 A;  3O37 A;  1CTE A;  2DC6 A;  4AVX A;  4OEL A;  1HYJ A;  3BCN A;  4BS6 A;  3L1X A;  3SOX A;  2HD5 A;  3ZUA A;  1U9W A;  1NB3 A;  2CKL B;  1WIM A;  2LGK A;  5EYA F;  5FB1 A;  2NAA A;  2PNS A;  4CDE B;  3CH3 X;  3ZYQ A;  2AU1 A;  2CT2 A;  1K3B B;  2VPB A;  1VD4 A;  1NL6 A;  1F2A A;  2LDR A;  2LN0 A;  4A0C D;  3RVW A;  1WEN A;  5FER A;  3DF0 A;  4G54 A;  2KGG A;  2VJE A;  4LJN A;  1PPD A;  1KFU L;  3IV2 A;  4S3O B;  5LCW B;  2YUR A;  4F52 B;  2G45 A;  2DC7 A;  3T7L A;  2HXZ A;  2ECV A;  1AYW A;  1FBV A;  1WEV A;  2FQ9 A;  2OP3 A;  3P5W A;  2UZG A;  2XU1 A;  4I7D A;  2Y43 A;  1Z60 A;  4RY2 A;  4BBQ A;  1AEC A;  2KWJ A;  2G8J A;  4K7C A;  5CVM A;  4BS5 A;  2LV9 A;  2YRE A;  5B75 A;  6PAD A;  2MD8 C;  1MM3 A;  2JRJ A;  2Y1M A;  2CB5 A;  3K8U A;  2LXH C;  3LQI A;  2H0D A;  3OF9 A;  3RVV A;  4WZ3 B;  2C2V S;  1XKG A;  1Y08 A;  1AU4 A;  3N9M A;  2JQF R;  2E02 A;  2LQ6 A;  1AYV A;  4IC3 A;  5CVO B;  1POP A;  3CBJ A;  2PAD A;  3IOQ A;  4L7X A;  3PW3 A;  2VJE B;  3N3K A;  1WEP A;  2DC9 A;  2YHO A;  1LDK C;  1AU2 A;  3L1Z B;  3B79 A;  3LRQ A;  2KIZ A;  1ITO A;  4A4C A;  1VSN A;  2VP7 A;  4R2Y A;  4YVA A;  1PPP A;  1QMY A;  2KRE A;  2IBI A;  2YJ8 A;  2H7J A;  1G25 A;  2AYO A;  4P5O B;  3KV5 A;  3F5V A;  1BQI A;  5FEY A;  2RI7 A;  3HD3 A;  1EWM A;  3ZVZ B;  2JMJ A;  3U5P A;  1ZBD B;  2FUU A;  1DEU A;  2MT5 A;  1NPZ A;  2DZY A;  2QIZ A;  5KH7 A;  1AU0 A;  2KE1 A;  3AI8 A;  1RMD A;  1FP0 A;  1WEM A;  1JM7 A;  1WEW A;  3GV4 A;  4FIP A;  1IWD A;  1X4U A;  2R6N A;  2KWK A;  3ZTG A;  1W5R A;  1T1H A;  1DVP A;  2YQM A;  1AIM A;  3KFQ A;  2OUL A;  2MD7 B;  2MNZ A;  5DKA A;  1FH0 A;  1CV8 A;  3I06 A;  1DF0 A;  2XB1 A;  3H89 A;  5J3X A;  2DX8 A;  5LKT A;  1EWO A;  1WGM A;  5B76 A;  5TBN A;  2FRA A;  2R9O A;  2K17 A;  4BHW A;  2R9M A;  4GNG A;  2MNY A;  2LXP C;  3N9N A;  4W4U A;  2DJF B;  3WXG A;  2G6D A;  1JQP A;  2YSJ A;  3MHS A;  2DCD A;  3VK6 A;  1U9V A;  3OIS A;  1PPO A;  4AP4 A;  2L75 A;  2M3H A;  3M63 A;  3U8E A;  1CPJ A;  1NQC A;  2KU3 A;  4N3W A;  2G6Q A;  3DQV R;  4QH6 A;  3O33 A;  1ATK A;  4DMY A;  2VPG A;  3EB5 A;  2BDZ A;  1BY8 A;  3MTN A;  3N4C A;  4ZQL A;  3P5V A;  2Y5B A;  3M99 A;  5B8D A;  1ZCM A;  2EGP A;  2M6M A;  3D9W A;  4X6J A;  3M62 A;  2XEU A;  3ASL A;  2JQG R;  1MIR A;  5TDR A;  4XI1 A;  1F29 A;  5FPW A;  3NHE A;  4LAD B;  3K9M A;  1W4T A;  3OVX A;  4BQV A;  3USV A;  2NQD B;  2ECI A;  3LTW A;  4BGF A;  5C13 A;  1WFK A;  4UI9 B;  1CVZ A;  2H0D B;  2AN6 A;  3LQJ A;  2YQL A;  2CKL A;  1MHW A;  7PCK A;  4QBB A;  4AYC B;  2YJ2 A;  1GCB A;  4LKA A;  2E6S A;  1O0E A;  3O7A A;  1Q6K A;  1U9X A;  3S3R A;  1W6F A;  1WE9 A;  3P5X A;  3T6R A;  5C11 A;  1THE A;  4GUZ A;  1WIL A;  4N4F A;  2YU4 A;  2PUY A;  4QF3 A;  2B1M A;  2LGV A;  2FTD A;  4X6I A;  4Q8H A;  5H1V A;  2ECG A;  4PPE A;  2ECN A;  4MZS A;  4CA1 A;  4YAB A;  3IUT A;  2AUZ A;  4ZUX U;  4S3O C;  1YK7 A;  2YJ9 A;  1NB5 A;  4GNE A;  3V43 A;  1ME4 A;  3OVZ A;  3QZV A;  5G05 B;  2Y6E A;  4R8P K;  4BSQ A;  2HHN A;  2PBH A;  2PRE A;  3QSD A;  5KH9 A;  2DCB A;  2E6R A;  4YAX A;  4GNF A;  1MS6 A;  3V6E A;  2D8S A;  1YK8 A;  2QIC A;  3WXE A;  1QOL A;  4XUI A;  2YJC A;  2VNF A;  2M85 A;  1IYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...