3MHSA

Structure of the saga ubp8/sgf11/sus1/sgf73 dub module bound to ubiquitin aldehyde
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
472
structure length
455
Chain Sequence
AMSICPHIQQVFQNEKSKDGVLKTCNAARYILNHSVPKEKFLNTMKCGTCHEINSGATFMCLQCGFCGCWNHSHFLSHSKQIGHIFGINSNNGLLFCFKCEDYIGNIDLINDAILAKYWDDVCTKTMVPSMERRDGLSGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNNCKVRSPDKCFSCALDKIVHELYGALNTSTNRQTGFIYLLTCAWKINQNLAGYSQQDAHEFWQFIINQIHQSYVLDLPNNNKQCECIVHTVFEGSLESSIVCPGCQNNSKTTIDPFLDLSLDIKDKKKLYECLDSFHKKEQLKDFNYHCGECNSTQDAIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKNYCSTKEKDKENGKVPDIIYELIGIVSHKGTVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQAYLLFYTIRQVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the assembly and function of the SAGA deubiquitinating module.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/transcription regulator/protein binding
molecule keywords Ubiquitin carboxyl-terminal hydrolase 8
total genus 134
structure length 455
sequence length 472
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2010-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3mhsA01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3mhsA02
2KWJA 3S3QA 4KLBA 4AXMA 1WILA 3IV2A 1NQCA 3BOWA 2YSJA 5AITA 1X4JA 4QF3A 2R9CA 2LN0A 1QDQA 2JQFR 4YYVA 1PPPA 3PURA 2XU3A 2NAAA 4L7XA 1JOCA 2AUXA 2VJEA 3T7LA 2VPEA 2YJ9A 2L5UA 2HYED 4A4CA 4GNEA 3KWBX 4UP0A 5H9MA 2XU4A 1PPDA 2R9OA 2YJ2A 4AVXA 1LDJB 4ZUXU 2LXPC 2YQLA 3PNRA 1U6GB 5H1TA 2DC6A 4WZ2A 4QF2A 3LQJA 2FRAA 1EWMA 2BAYA 2LQ6A 3I2DA 3QZVA 2IPPB 4UI9B 4YBMA 3B79A 1WE9A 2YHNA 2YURA 3HCSA 1AIMA 1CHCA 4YV8A 4AYCA 4W5BA 5D1LB 2ECNA 2E6RA 3I3TA 4AUQB 3ZVYA 3PDFA 3ERVA 3BC3A 5LKUA 1MEGA 3C9EA 5C13A 1ME4A 2G45A 5G04B 4N4ZA 1CVZA 4N8WA 3AI8A 2Y43A 2LGKA 2MIQA 1MEMA 3OVXA 1EWOA 2KGGA 2CSYA 4YATA 1WEQA 4K7CA 3H89A 3U8EA 3O1GA 3K9MA 2QICA 2G8JA 4LADB 1KHPA 1U9XA 4OELA 4YYWA 1JQPA 1FP0A 5A24A 4A0CD 1EWLA 3RVXA 3BPFA 3SHBA 2PADA 1PPNA 3O34A 1YK8A 2YUCA 2MD8C 2DCAA 3NG2A 4YYSA 2CT2A 4N79A 4BSQA 1TLOA 2JQGR 2YQMA 3PBHA 1PCIA 1TL9A 2F42A 4R8PK 3C6WA 2MA5A 2KR4A 2ECVA 2KREA 2L43A 4BS5A 3LFYA 2AYOA 2ECWA 3CH2X 2VJFB 2H7JA 3SOXA 1AU0A 3QT4A 4CDDB 2L80A 4I7CA 4UP5A 4I7BA 3KKUA 4PPEA 4YADA 4X6IA 7PCKA 5JA7A 2OXQC 4B7YC 2KIZA 3KNVA 2F6JA 2LXHC 2LV9A 1G25A 3DF0A 2H0DA 2AN6A 4BHWA 1NB5A 3ZYQA 3V43A 4XUIA 5LKZA 1VYXA 2MNZA 4GNDA 5F02A 2DJFB 3M63A 1WENA 1CJLA 4L58A 1X4IA 2XB1A 2KGIA 4MZOA 2O6XA 2MT5A 1U5IA 3N9OA 3KSEA 4ZDTA 3T6RA 3HCUA 2MD7B 5CHTA 1EWPA 4G54A 4WA6A 2MA6A 1HYIA 2ECIA 1NL6A 2YHOA 2DC7A 4AP4A 2G43A 5H1VA 3O7AA 2YJBA 2YJCA 5C11A 2K17A 1S4VA 1F2BA 1JM7B 2AU1A 3KV5A 2FUDA 5J94A 2VPDA 2VHFA 2DCBA 3H7DA 3BCNA 3O0UA 2XU5A 1X9YA 2CKLA 2GHUA 1NPZA 3VK6A 4Q8GA 3LQIA 1NLJA 4IC3A 2VJFA 1WEWA 2EA6A 4FIPA 3OISA 1GCBA 3QSDA 4FO9A 2NQGA 5LKXA 5EF4A 3N4CA 3GV4A 2LGGA 2FQ9A 3D6SA 3H8CA 2EGPA 1WEVA 5TRBA 2MNYA 2DC9A 3HWNA 1KHQA 5J3XA 3CH3X 3ASLA 5I3LA 1NB3A 1RMDA 2M3HA 3SOWA 1GECE 2DC8A 2G7YA 3GCBA 3KFQA 3MTNA 3F5VA 5H1UA 3CBJA 3PW3A 3HD3A 2G6DA 1CV8A 3MORA 3RPGB 2PNSA 1POPA 2OULA 3O36A 2HDPA 3N9MA 3ZPV1 1PIPA 2VP7A 5CVNB 4F52B 9PAPA 5B79A 4QBBA 5EGWA 2JRJA 2R9NA 2ACTA 1MM2A 1AU2A 3IOQA 2ZETC 5PADA 3KX1A 1GMYA 2NQDB 1PPOA 2VPBA 1GLOA 3RTRB 1V87A 3L1ZB 3O70A 1M6DA 4O64A 4GNGA 2CIOA 2ECJA 1AECA 4P6GA 2ECTA 4AYCB 5B75A 5B77A 3WXFA 3KW9A 5FB1A 1AU4A 2DJGB 1SNKA 3EB5A 5LCWB 2XEUA 4C9ZA 2JMDA 1CQDA 2Y6EA 1K2FA 4YC9A 4BBQA 2UZGA 1PXVA 2YW8A 1WEMA 5FB0A 1HYJA 3OVZA 2E03A 1BGOA 3K8UA 3N9NA 3PHDA 2RSDA 1ZCMA 4LLBA 1WEEA 4B86C 5LKTA 3WXEA 1MM3A 2K16A 4A4BA 4R2YA 2AYNA 2Y1MA 2HXZA 4I7DA 2P86A 3RVWA 4YBSA 5JG6A 4CDFB 1QMYA 2FTDA 4AXLA 2JMIA 2LRIC 4LJNA 4W5CA 4WZ0A 1TU6A 3WXGA 4W4UA 3LRQA 2AVWA 1KFUL 1FBVA 4XR7A 2AS8A 6PADA 3ZTGA 1WEUA 4A49A 3FL2A 3L1XA 5B76A 3M99A 3O33A 4PI3A 2FSAA 1KFXL 1XKGA 1PBHA 2WBFX 2IBIA 3O35A 3ZNIA 2MUMA 4FK5A 1CSBB 3P5UA 2LGVA 2VNFA 1Y08A 2KE1A 1AYWA 5FERA 4I05A 1F2AA 3E1ZB 2DCCA 5TDRA 2M85A 2KYUA 3IUTA 1ICFA 2HD5A 2YU4A 1U9QX 2FUUA 1VJVA 2VJEB 4WZ3B 1YVBA 2JMJA 3P5VA 4QRXA 3MHSA 2KWKA 2YJ8A 4DMXA 2ATOA 2NQIA 2FUIA 1Z6UA 3KQIA 3M62A 1ME3A 1DF0A 1THEA 2XU1A 2F6NA 5DINA 3CBKA 4Q6FA 4I07A 3V6EA 1MHWA 3N3KA 4CZWA 1MIRA 1Z60A 2IDAA 5DKAA 3KWZA 4MZSA 4YYQA 1F62A 2FRQA 2P0RA 1Q6KA 2VPGA 2VHSA 3PUQA 3EB6A 1X4UA 2CKLB 1Z2QA 2KWOA 1A6RA 4X3GA 3LXSA 1VSNA 3HHAA 4MVTA 2E6SA 3F75A 2M1RA 5G0FA 2DZZA 2R9MA 4YYRA 1BORA 2EODA 8PCHA 3RPGC 2RI7A 4N4FA 5G05B 1MS6A 4Q8HA 3MHHA 1AYUA 1IWDA 4NN2A 5TBNA 1SP4B 4FJCA 5FPWA 4N3WA 2R6NA 2FYEA 2AUZA 2CB5A 1EF7A 2KU3A 2E01A 4CA1A 3HTKC 1CTEA 3I06A 4XI1A 3U5NA 3P5WA 1KXRA 5B8DA 2YREA 1STFE 4P6EA 2YT5A 1DEUA 2FT2A 2KWNA 2PUYA 3U5MA 1T1HA 2LDRA 4V3LC 2ECGA 1XWHA 2B1NA 4YYUA 4YABA 3P5XA 2QJ0A 1ATKA 1QXPA 3K24A 2DZYA 3S3RA 1VFYA 4X6HA 3HCTA 5JH3A 1HUCB 2L75A 3N9LA 2E02A 1WIMA 1WFKA 5B78A 2YYRA 1F29A 3BWKA 1BQIA 1BP4A 3GL6A 3C5KA 3SOUA 1AYVA 1LDKC 1CPJA 1E4UA 4I04A 3V6CA 1U9VA 4LK9A 2GFOA 4CDCB 3KV6A 1VD4A 3IMAA 2B1MA 4GB0A 2BDLA 1YK7A 1K3BB 2LGLA 2YSMA 1BY8A 5TABA 5CVOB 2D8SA 5EYAF 3L11A 3N9QA 3IEJA 3NHEA 5TDWA 1MDWA 4QRVA 2CSZA 2BDZA 1U9WA 1N87A 1YALA 1CB5A 3H8BA 4YAXA 5D1KB 2NQAA 4HWYA 5K16A 2I50A 3BPMA 4BS6A 3ZPVE 4CDEB 4P5OB 4S3OB 2OZ2A 2K1JA 4V3KC 3QJ3A 4QH6A 2F1GA 2G6QA 4BPVA 1WEOA 1IYMA 4QRGA 2M6MA 5KH7A 2F7DA 4X6JA 3TNXA 1ITOA 2OP3A 3RVVA 4R7EA 1PE6A 4PP1A 4DMYA 2K4DA 1F2CA 2DX8A 1WGMA 4PADA 3U5PA 3IHPA 1WESA 4S3OC 2QIZA 2Y1NA 4ZQLA 3LQHA 1CS8A 2H0DB 1YT7A 3N3GA 2C0YA 2HHNA 2DCDA 3H6SA 2L0BA 2PREA 4MSXA 4GNFA 4OEMA 1WEPA 5KH9A 4PTBA 3ZVZB 4CCGX 2HH5A 2FO5A 4PP2E 2AIMA 1FH0A 2PBHA 3HHIA 3O37A 3OF9A 1ZIVA 4RY2A 5KH3A 3N9PA 5CHVA 1AU3A 1Y4HA 5CVMA 2Y5BA 2C2VS 2ARYA 2KFTA 3OF8A 2E00A 5AIUA 1ZBDB 1JM7A 3USVA 4IC2A 4BQVA 2C2LA 5FEYA 5D1MB 4LKAA 2P7UA 3DQVR 1QOLA 1PADA 2R9FA 1DVPA 2G8EA 3U5OA 2PNXA 3DPLR 3ZUAA 4YBTA 4TKPB 4YVAA 1O0EA
chains in the Genus database with same CATH superfamily
2KWJA 3S3QA 1DKIA 4KLBA 4AXMA 1WILA 3IV2A 1NQCA 3BOWA 2YSJA 5AITA 1X4JA 4QF3A 2RR4A 2LN0A 2R9CA 1QDQA 2JQFR 2Z84A 4YYVA 1PPPA 3PURA 2XU3A 2NAAA 4L7XA 1JOCA 2KKXA 2AUXA 5JZEA 4IUMA 2VJEA 3T7LA 2VPEA 2YJ9A 2L5UA 2HYED 4A4CA 4GNEA 3KWBX 4UP0A 5H9MA 2XU4A 1PPDA 2R9OA 2YJ2A 3TRKA 4AVXA 2CRWA 1LDJB 4ZUXU 2LXPC 2YQLA 3BBAA 1U6GB 5H1TA 2DC6A 4WZ2A 3PNRA 4QF2A 3LQJA 2FRAA 1EWMA 2BAYA 2LQ6A 3I2DA 3QZVA 2IPPB 4UI9B 2D8UA 4YBMA 4MM3B 3B79A 1WE9A 2YHNA 2YURA 3HCSA 1AIMA 1CHCA 2DOSA 4YV8A 4AYCA 4W5BA 5D1LB 2ECNA 2E6RA 3I3TA 4AUQB 3ZVYA 3PDFA 3ERVA 3PRPA 3BC3A 5LKUA 1MEGA 3C9EA 5C13A 1ME4A 2G45A 5G04B 4N4ZA 1CVZA 4N8WA 3AI8A 2Y43A 2LGKA 2MIQA 1MEMA 3OVXA 3PLWA 1EWOA 2KGGA 2CSYA 4YATA 1WEQA 4Z0OA 4K7CA 3H89A 4PT5A 3U8EA 3O1GA 3K9MA 2QICA 2G8JA 4LADB 1KHPA 3ZNHA 1U9XA 4OELA 4YYWA 1JQPA 1FP0A 3FANA 2JTCA 5A24A 4A0CD 1EWLA 3MTVA 3RVXA 3BPFA 3SHBA 2PADA 4IP3A 1PPNA 3O34A 1YK8A 4RF1A 2YUCA 2MD8C 2DCAA 3NG2A 4YYSA 2CT2A 4N79A 4BSQA 1TLOA 2JQGR 2YQMA 3PBHA 1PCIA 1TL9A 2F42A 4R8PK 3C6WA 2MA5A 2KR4A 2ECVA 2KREA 2L43A 4BS5A 3LFYA 2AYOA 2ECWA 3CH2X 2VJFB 2H7JA 3TMPA 3SOXA 1AU0A 5SVIA 3OQCA 3QT4A 4XZXA 2L80A 4CDDB 2EXUA 4I7CA 4I7BA 4UP5A 3KKUA 4PPEA 4YADA 4X6IA 2IQJA 7PCKA 2CRRA 5JA7A 2OXQC 4B7YC 3KDEC 3H7HA 2KIZA 3KNVA 2F6JA 2LXHC 3T9KA 2LV9A 1G25A 3DF0A 2H0DA 2AN6A 4BHWA 1NB5A 3ZYQA 2J7QC 3V43A 4XUIA 5LKZA 1VYXA 2MNZA 4GNDA 5F02A 2DJFB 3M63A 1WENA 1CJLA 4L58A 1X4IA 3FEHA 2XB1A 2KGIA 4MZOA 2O6XA 2MT5A 3JUEA 3FAOA 1U5IA 3N9OA 3KSEA 4ZDTA 3T6RA 3B21A 3HCUA 2MD7B 5CHTA 1EWPA 4G54A 4WA6A 5SVIB 2MA6A 1HYIA 2ECIA 1NL6A 2YHOA 2DC7A 4AP4A 2XOCA 2G43A 5H1VA 2EGMA 3O7AA 2YJBA 1DCQA 2YJCA 5C11A 2K17A 1S4VA 1F2BA 1JM7B 2AU1A 3KV5A 2FUDA 5J94A 2OWAA 2VPDA 2XOYA 2VHFA 2DCBA 3H7DA 3BCNA 3O0UA 3Q1DA 2XU5A 1X9YA 5EZSA 2CKLA 3SUBA 2GHUA 1NPZA 3VK6A 4Q8GA 3LQIA 1NLJA 4IC3A 2VJFA 1WEWA 2EA6A 4FIPA 3OISA 1GCBA 3QSDA 4FO9A 2NQGA 5LKXA 5EF4A 3N4CA 3GV4A 2LGGA 2FQ9A 3D6SA 3PHWA 2UZJA 3H8CA 2EGPA 1WEVA 5TRBA 2MNYA 2DC9A 4M0WA 3HWNA 1KHQA 5J3XA 3CH3X 3ASLA 5I3LA 1NB3A 1RMDA 2M3HA 2YVRA 3SOWA 1GECE 2DC8A 2G7YA 3GCBA 3KFQA 3MTNA 3F5VA 5H1UA 3CBJA 3PW3A 3HD3A 2G6DA 3PRMA 1CV8A 2JRIA 3MJ5A 2AGAA 3MORA 3RPGB 2PNSA 1POPA 4D8BA 2OULA 3O36A 2HDPA 3N9MA 3ZPV1 3IFUA 1PIPA 2VP7A 5CVNB 4F52B 9PAPA 5B79A 4QBBA 5EGWA 2JRJA 2R9NA 2ACTA 1MM2A 4Z0RA 1AU2A 3IOQA 2ZETC 5PADA 3KX1A 1GMYA 2L7PA 2NQDB 1PPOA 2VPBA 4OVZB 4P16A 2JM3A 1GLOA 3O65A 3RTRB 1V87A 3L1ZB 4HXDB 2XP0A 3O70A 1M6DA 4O64A 4GNGA 2CIOA 2ECJA 4OW0A 4RKXA 3MP2A 1AECA 4P6GA 2ECTA 4AYCB 5B75A 5B77A 3WXFA 2M13A 3KW9A 5FB1A 1AU4A 5EZQA 2DJGB 2BU3A 1SNKA 3EB5A 4O62A 5LCWB 2XEUA 4C9ZA 2JMDA 1CQDA 3DWDA 2Y6EA 1K2FA 4R3DA 4YC9A 2CSVA 4BBQA 2UZGA 1PXVA 2YW8A 1WEMA 5FB0A 1HYJA 3OVZA 2E03A 1BGOA 4REZA 3LVQE 2LAUA 3K8UA 3N9NA 3PHDA 2RSDA 1ZCMA 4LLBA 1WEEA 4B86C 5LKTA 3WXEA 1MM3A 2K16A 4A4BA 4R2YA 2AYNA 2Y1MA 2HXZA 4I7DA 2P86A 3RVWA 4YBSA 5JG6A 4CDFB 1QMYA 2FTDA 4AXLA 2JMIA 2LRIC 4LJNA 4W5CA 4WZ0A 1TU6A 3WXGA 4D8EA 4W4UA 3LRQA 2AVWA 2B0OE 2J7QA 1KFUL 1FBVA 4XR7A 2AS8A 2DSMA 6PADA 3ZTGA 1WEUA 4A49A 3FL2A 3L1XA 3E9SA 5B76A 3M99A 2JUNA 4RF0A 3O33A 2P57A 4PI3A 2FSAA 1KFXL 1XKGA 1PBHA 2WBFX 2IBIA 3BY4A 3O35A 3ZNIA 2MUMA 4FK5A 1CSBB 2BTWB 3P5UA 2LGVA 2VNFA 1Y08A 2KE1A 1AYWA 3BB7A 5FERA 4I05A 1F2AA 3E1ZB 2XOZA 2DCCA 5TDRA 2M85A 2KYUA 2MKEA 1ICFA 3IUTA 2HD5A 2YU4A 3O47A 3FJUB 1U9QX 2FUUA 1VJVA 3PSEA 2VJEB 4WZ3B 1UKFA 2JMJA 1YVBA 3P5VA 4QRXA 3MHSA 2KWKA 2YJ8A 4DMXA 2ATOA 2NQIA 2FUIA 1Z6UA 3KQIA 3M62A 4H9DA 1ME3A 1DF0A 1THEA 2XU1A 2F6NA 5DINA 3CBKA 4Q6FA 4I07A 3V6EA 1MHWA 3N3KA 4CZWA 1MIRA 1Z60A 2IDAA 5DKAA 3KWZA 4MZSA 4YYQA 1F62A 2FRQA 2P0RA 1Q6KA 2VPGA 2VHSA 3PUQA 3EB6A 3LDYA 1X4UA 2CKLB 1Z2QA 2KWOA 1A6RA 4BOPA 4X3GA 3LXSA 4BOSA 1VSNA 3HHAA 4MVTA 4A5UA 2E6SA 3PT2A 3F75A 4RNAA 2M1RA 5G0FA 2DZZA 2R9MA 4YYRA 2HWKA 1BORA 2EODA 8PCHA 2KKYA 3RPGC 2RI7A 4N4FA 3PHXA 1YZBA 5G05B 1MS6A 4Q8HA 3MHHA 1AYUA 1IWDA 3C0RA 4NN2A 4BOUA 5TBNA 1SP4B 4FJCA 5FPWA 4N3WA 2R6NA 2FYEA 3RNVA 2AUZA 2CB5A 3LJUX 2KU3A 1EF7A 2E01A 3HTKC 4CA1A 1CTEA 4GUAA 3DDTA 3I06A 4XI1A 3U5NA 3P5WA 1KXRA 5B8DA 2YREA 5KO3A 1STFE 4P6EA 2YT5A 1DEUA 3PHUA 2FT2A 2KWNA 2PUYA 3U5MA 1T1HA 2LDRA 4V3LC 2ECGA 1XWHA 2B1NA 4YYUA 4YABA 3P5XA 2E61A 2QJ0A 1ATKA 1QXPA 3K24A 2DZYA 3S3RA 1VFYA 4X6HA 3HCTA 1PVJA 5JH3A 1HUCB 2L75A 3N9LA 2E02A 1WIMA 1WFKA 4ZTBA 5B78A 2YYRA 1F29A 3BWKA 1BQIA 1BP4A 4WURA 3GL6A 3C5KA 3SOUA 1AYVA 1LDKC 1CPJA 1E4UA 4I04A 3V6CA 1U9VA 4LK9A 4QQ4A 2GFOA 4CDCB 3KV6A 1VD4A 3LVRE 3IMAA 2B1MA 4GB0A 5E6JA 2BDLA 5SVXA 1YK7A 4OVZA 3W31A 1K3BB 2LGLA 2YSMA 5K3QA 5TABA 1BY8A 5CVOB 2D8SA 5EYAF 3L11A 3N9QA 3IEJA 3W30A 4BOZA 3NHEA 4OGEA 5TDWA 1MDWA 4QRVA 2CSZA 2BDZA 1U9WA 1N87A 5SVYA 1CB5A 1YALA 3H8BA 4YAXA 5D1KB 2NQAA 4HWYA 5K16A 2I50A 3BPMA 2CONA 2DJAA 4BS6A 3ZPVE 4F1PA 4CDEB 4P5OB 4S3OB 2OZ2A 2K1JA 4V3KC 3QJ3A 4QH6A 2F1GA 2G6QA 4BPVA 1WEOA 1IYMA 4QRGA 2M6MA 5KH7A 2F7DA 4X6JA 3TNXA 1ITOA 2OP3A 3RVVA 4R7EA 1PE6A 4PP1A 4OGCA 2K4DA 1F2CA 4DMYA 2DX8A 1WGMA 2FE8A 1MBMA 4PADA 3U5PA 3IHPA 1WESA 3MDBC 4S3OC 2QIZA 2Y1NA 4ZQLA 3LQHA 1CS8A 2H0DB 1YT7A 3FM8C 3N3GA 2C0YA 2HHNA 2DCDA 3H6SA 2L0BA 2PREA 4MSXA 4GNFA 4OEMA 1WEPA 5KH9A 4PTBA 3ZVZB 4CCGX 2HH5A 4BOQA 2FO5A 4PP2E 2AIMA 1FH0A 2PBHA 3HHIA 3O37A 3OF9A 1ZIVA 4RY2A 5KH3A 3N9PA 5CHVA 1AU3A 1Y4HA 5CVMA 2Y5BA 4D8IA 2C2VS 2ARYA 2KFTA 2BTWA 3OF8A 2E00A 5AIUA 1ZBDB 3E2DA 1JM7A 3USVA 2FD4A 4IC2A 4BQVA 2C2LA 4MI7A 5FEYA 5D1MB 4LKAA 2FFWA 2P7UA 3DQVR 1QOLA 1PADA 2R9FA 1DVPA 2G8EA 3U5OA 2PNXA 3DPLR 3ZUAA 4YBTA 3M7KA 4TKPB 4YVAA 1O0EA
chains in the Genus database with same CATH topology
2KWJA 3S3QA 2BSZA 4KLBA 4AXMA 1WILA 3IV2A 1NQCA 3BOWA 2YSJA 5AITA 1X4JA 4QF3A 2R9CA 2LN0A 1QDQA 1E2TA 2JQFR 4YYVA 1PPPA 3PURA 2XU3A 2NAAA 4L7XA 1JOCA 2AUXA 2VJEA 3T7LA 2VPEA 2YJ9A 2L5UA 2HYED 4A4CA 4GNEA 3KWBX 4UP0A 5H9MA 2XU4A 1PPDA 2R9OA 2YJ2A 4AVXA 1LDJB 4ZUXU 2LXPC 2YQLA 3PNRA 1U6GB 5H1TA 2DC6A 4WZ2A 4QF2A 2VFBA 3LQJA 2FRAA 1EWMA 2BAYA 2LQ6A 3I2DA 3QZVA 2IPPB 4UI9B 4YBMA 3B79A 1WE9A 2YHNA 2YURA 3HCSA 1AIMA 1CHCA 4YV8A 4AYCA 4W5BA 5D1LB 2ECNA 2E6RA 3I3TA 4AUQB 3ZVYA 3PDFA 3ERVA 3BC3A 5LKUA 1MEGA 3C9EA 5C13A 1ME4A 2G45A 5G04B 4N4ZA 1CVZA 4N8WA 3AI8A 2Y43A 2LGKA 2MIQA 1MEMA 3OVXA 1EWOA 2KGGA 2CSYA 4YATA 1WEQA 4K7CA 3H89A 3U8EA 3O1GA 3K9MA 2QICA 2G8JA 4LADB 1KHPA 1U9XA 4OELA 4YYWA 1JQPA 1FP0A 5A24A 4A0CD 1EWLA 3RVXA 3BPFA 3SHBA 2PADA 1PPNA 3O34A 1YK8A 2YUCA 2MD8C 2DCAA 3NG2A 4YYSA 2CT2A 4N79A 4BSQA 1TLOA 2JQGR 2YQMA 3PBHA 1PCIA 1TL9A 2F42A 4R8PK 3C6WA 2MA5A 2KR4A 2ECVA 2KREA 2L43A 4BS5A 3LFYA 2AYOA 2ECWA 3CH2X 2VJFB 2H7JA 3SOXA 1AU0A 3QT4A 4CDDB 2L80A 4I7CA 4UP5A 4I7BA 3KKUA 4PPEA 4YADA 4X6IA 7PCKA 5JA7A 2OXQC 4B7YC 2KIZA 3KNVA 4BGFA 2F6JA 2LXHC 2LV9A 1G25A 3DF0A 2H0DA 2AN6A 4BHWA 1NB5A 3ZYQA 3V43A 4XUIA 5LKZA 1VYXA 2MNZA 4C5PA 4GNDA 1W4TA 5F02A 2DJFB 3M63A 1WENA 1CJLA 4L58A 1X4IA 2XB1A 2KGIA 4MZOA 2O6XA 2MT5A 1U5IA 3N9OA 3KSEA 4ZDTA 3T6RA 3HCUA 2MD7B 5CHTA 1EWPA 4G54A 4WA6A 2MA6A 1HYIA 2ECIA 1NL6A 2YHOA 2DC7A 4AP4A 2G43A 5H1VA 3O7AA 2YJBA 2YJCA 5C11A 2K17A 1S4VA 1F2BA 1JM7B 2AU1A 3KV5A 2FUDA 5J94A 2VPDA 2VHFA 2DCBA 3H7DA 3BCNA 3O0UA 2XU5A 1X9YA 2CKLA 2GHUA 1NPZA 3VK6A 4Q8GA 3LQIA 1NLJA 4IC3A 2VJFA 1WEWA 2EA6A 4FIPA 1GX3A 3OISA 1GCBA 3QSDA 4FO9A 2NQGA 5LKXA 5EF4A 3N4CA 3GV4A 2LGGA 2FQ9A 3D6SA 3H8CA 2EGPA 1WEVA 5TRBA 2MNYA 2DC9A 3HWNA 1KHQA 5J3XA 3CH3X 3ASLA 5I3LA 1NB3A 1RMDA 2M3HA 3SOWA 1GECE 2DC8A 2G7YA 3GCBA 3KFQA 3MTNA 3F5VA 5H1UA 3CBJA 3PW3A 3HD3A 2G6DA 1CV8A 3MORA 3RPGB 2PNSA 1POPA 2OULA 3O36A 2HDPA 3N9MA 3ZPV1 1PIPA 2VP7A 5CVNB 4F52B 9PAPA 5B79A 4QBBA 5EGWA 2JRJA 2R9NA 2ACTA 1MM2A 1AU2A 3IOQA 2ZETC 4B55A 5PADA 3KX1A 1GMYA 2NQDB 1PPOA 2VPBA 1GLOA 3RTRB 2VFCA 1V87A 3L1ZB 3O70A 1M6DA 4O64A 4GNGA 2CIOA 2ECJA 1AECA 4P6GA 2ECTA 4AYCB 5B75A 5B77A 3WXFA 3KW9A 5FB1A 1AU4A 2DJGB 1SNKA 3EB5A 5LCWB 2XEUA 4C9ZA 2JMDA 1CQDA 2Y6EA 1K2FA 4YC9A 4BBQA 2UZGA 1PXVA 2YW8A 1WEMA 5FB0A 1HYJA 3OVZA 2E03A 1BGOA 3K8UA 3N9NA 3PHDA 2RSDA 1ZCMA 4LLBA 1WEEA 4B86C 5LKTA 3WXEA 1MM3A 2K16A 4A4BA 4R2YA 2AYNA 2Y1MA 2HXZA 4I7DA 2P86A 3RVWA 4YBSA 5JG6A 4CDFB 1QMYA 2FTDA 4AXLA 2JMIA 2LRIC 4LJNA 4W5CA 4WZ0A 1TU6A 3WXGA 4W4UA 3LRQA 2AVWA 1KFUL 1FBVA 4XR7A 2AS8A 6PADA 3ZTGA 1WEUA 4A49A 3FL2A 3L1XA 5B76A 3M99A 3O33A 4PI3A 2FSAA 1KFXL 1XKGA 1PBHA 2WBFX 2IBIA 3O35A 3ZNIA 2MUMA 4FK5A 1CSBB 3P5UA 2LGVA 2VNFA 1Y08A 2KE1A 1AYWA 4GUZA 5FERA 4I05A 1F2AA 3E1ZB 2DCCA 5TDRA 2M85A 2KYUA 3IUTA 1ICFA 2HD5A 2YU4A 1U9QX 2FUUA 1VJVA 2VJEB 4WZ3B 1YVBA 2JMJA 3P5VA 4QRXA 3MHSA 2KWKA 2YJ8A 4DMXA 2ATOA 2NQIA 2FUIA 1Z6UA 3KQIA 3M62A 1ME3A 1DF0A 1THEA 2XU1A 2F6NA 5DINA 3CBKA 4Q6FA 4I07A 3V6EA 1MHWA 3N3KA 4CZWA 1MIRA 1Z60A 2IDAA 5DKAA 3KWZA 4MZSA 4YYQA 1F62A 2FRQA 2P0RA 1Q6KA 2VPGA 2VHSA 3PUQA 3EB6A 1X4UA 2CKLB 1Z2QA 2KWOA 1A6RA 4X3GA 3LXSA 1VSNA 3HHAA 4MVTA 2E6SA 3F75A 2M1RA 5G0FA 2DZZA 2R9MA 4YYRA 1BORA 2EODA 8PCHA 3RPGC 2RI7A 4N4FA 5G05B 1MS6A 4Q8HA 3MHHA 1AYUA 1IWDA 4NN2A 5TBNA 1SP4B 4FJCA 5FPWA 4N3WA 2R6NA 2FYEA 3D9WA 2AUZA 2CB5A 1EF7A 2KU3A 2E01A 4CA1A 3HTKC 1CTEA 3I06A 4XI1A 3U5NA 3P5WA 1KXRA 5B8DA 2YREA 1STFE 4P6EA 2YT5A 1DEUA 2FT2A 2KWNA 2PUYA 3U5MA 1T1HA 2LDRA 4V3LC 2ECGA 1XWHA 2B1NA 4YYUA 4YABA 3P5XA 2QJ0A 1ATKA 1QXPA 3K24A 2DZYA 3S3RA 1VFYA 4X6HA 3HCTA 5JH3A 1HUCB 2L75A 3N9LA 2E02A 1WIMA 1WFKA 5B78A 2YYRA 1F29A 3BWKA 1BQIA 1BP4A 3GL6A 3C5KA 3SOUA 1AYVA 1LDKC 1CPJA 1E4UA 4I04A 3V6CA 1U9VA 4LK9A 2GFOA 4CDCB 3KV6A 1VD4A 3IMAA 2B1MA 4GB0A 2BDLA 1YK7A 1K3BB 2LGLA 2YSMA 1BY8A 5TABA 5CVOB 2D8SA 5EYAF 3L11A 3N9QA 3IEJA 3NHEA 5TDWA 1MDWA 4QRVA 2CSZA 2BDZA 1U9WA 1N87A 1YALA 1CB5A 3H8BA 1W5RA 4YAXA 5D1KB 2NQAA 4HWYA 5K16A 2I50A 3BPMA 4BS6A 3LTWA 3ZPVE 4NV8A 4CDEB 4P5OB 4S3OB 2OZ2A 2K1JA 4V3KC 3QJ3A 4QH6A 2F1GA 2G6QA 4BPVA 1WEOA 1IYMA 4QRGA 2M6MA 5KH7A 2F7DA 4X6JA 3TNXA 1ITOA 2OP3A 3RVVA 4R7EA 1PE6A 4PP1A 4DMYA 2K4DA 1F2CA 2DX8A 1WGMA 4PADA 3U5PA 3IHPA 1WESA 4S3OC 2QIZA 2Y1NA 4ZQLA 3LQHA 1CS8A 2H0DB 1YT7A 3N3GA 2C0YA 2HHNA 2DCDA 3H6SA 2L0BA 2PREA 4MSXA 4GNFA 4OEMA 1WEPA 5KH9A 4PTBA 3ZVZB 4CCGX 2HH5A 2FO5A 4PP2E 2AIMA 1FH0A 2PBHA 3HHIA 3O37A 3OF9A 1ZIVA 4RY2A 5KH3A 3N9PA 5CHVA 1AU3A 1Y4HA 5CVMA 2Y5BA 2C2VS 2ARYA 2KFTA 3OF8A 2E00A 5AIUA 1ZBDB 4NV7A 1W6FA 1JM7A 3USVA 4IC2A 4BQVA 2C2LA 5FEYA 5D1MB 4LKAA 2P7UA 3DQVR 1QOLA 1PADA 2R9FA 1DVPA 2G8EA 3U5OA 2PNXA 3DPLR 3ZUAA 4YBTA 4TKPB 4YVAA 1O0EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KWJ A;  3S3Q A;  4KLB A;  4AXM A;  1WIL A;  3IV2 A;  1NQC A;  3BOW A;  2YSJ A;  5AIT A;  1X4J A;  4QF3 A;  2R9C A;  2LN0 A;  1QDQ A;  2JQF R;  4YYV A;  1PPP A;  3PUR A;  2XU3 A;  2NAA A;  4L7X A;  1JOC A;  2AUX A;  2VJE A;  3T7L A;  2VPE A;  2YJ9 A;  2L5U A;  2HYE D;  4A4C A;  4GNE A;  3KWB X;  4UP0 A;  5H9M A;  2XU4 A;  1PPD A;  2R9O A;  2YJ2 A;  4AVX A;  1LDJ B;  4ZUX U;  2LXP C;  2YQL A;  3PNR A;  1U6G B;  5H1T A;  2DC6 A;  4WZ2 A;  4QF2 A;  3LQJ A;  2FRA A;  1EWM A;  2BAY A;  2LQ6 A;  3I2D A;  3QZV A;  2IPP B;  4UI9 B;  4YBM A;  3B79 A;  1WE9 A;  2YHN A;  2YUR A;  3HCS A;  1AIM A;  1CHC A;  4YV8 A;  4AYC A;  4W5B A;  5D1L B;  2ECN A;  2E6R A;  3I3T A;  4AUQ B;  3ZVY A;  3PDF A;  3ERV A;  3BC3 A;  5LKU A;  1MEG A;  3C9E A;  5C13 A;  1ME4 A;  2G45 A;  5G04 B;  4N4Z A;  1CVZ A;  4N8W A;  3AI8 A;  2Y43 A;  2LGK A;  2MIQ A;  1MEM A;  3OVX A;  1EWO A;  2KGG A;  2CSY A;  4YAT A;  1WEQ A;  4K7C A;  3H89 A;  3U8E A;  3O1G A;  3K9M A;  2QIC A;  2G8J A;  4LAD B;  1KHP A;  1U9X A;  4OEL A;  4YYW A;  1JQP A;  1FP0 A;  5A24 A;  4A0C D;  1EWL A;  3RVX A;  3BPF A;  3SHB A;  2PAD A;  1PPN A;  3O34 A;  1YK8 A;  2YUC A;  2MD8 C;  2DCA A;  3NG2 A;  4YYS A;  2CT2 A;  4N79 A;  4BSQ A;  1TLO A;  2JQG R;  2YQM A;  3PBH A;  1PCI A;  1TL9 A;  2F42 A;  4R8P K;  3C6W A;  2MA5 A;  2KR4 A;  2ECV A;  2KRE A;  2L43 A;  4BS5 A;  3LFY A;  2AYO A;  2ECW A;  3CH2 X;  2VJF B;  2H7J A;  3SOX A;  1AU0 A;  3QT4 A;  4CDD B;  2L80 A;  4I7C A;  4UP5 A;  4I7B A;  3KKU A;  4PPE A;  4YAD A;  4X6I A;  7PCK A;  5JA7 A;  2OXQ C;  4B7Y C;  2KIZ A;  3KNV A;  2F6J A;  2LXH C;  2LV9 A;  1G25 A;  3DF0 A;  2H0D A;  2AN6 A;  4BHW A;  1NB5 A;  3ZYQ A;  3V43 A;  4XUI A;  5LKZ A;  1VYX A;  2MNZ A;  4GND A;  5F02 A;  2DJF B;  3M63 A;  1WEN A;  1CJL A;  4L58 A;  1X4I A;  2XB1 A;  2KGI A;  4MZO A;  2O6X A;  2MT5 A;  1U5I A;  3N9O A;  3KSE A;  4ZDT A;  3T6R A;  3HCU A;  2MD7 B;  5CHT A;  1EWP A;  4G54 A;  4WA6 A;  2MA6 A;  1HYI A;  2ECI A;  1NL6 A;  2YHO A;  2DC7 A;  4AP4 A;  2G43 A;  5H1V A;  3O7A A;  2YJB A;  2YJC A;  5C11 A;  2K17 A;  1S4V A;  1F2B A;  1JM7 B;  2AU1 A;  3KV5 A;  2FUD A;  5J94 A;  2VPD A;  2VHF A;  2DCB A;  3H7D A;  3BCN A;  3O0U A;  2XU5 A;  1X9Y A;  2CKL A;  2GHU A;  1NPZ A;  3VK6 A;  4Q8G A;  3LQI A;  1NLJ A;  4IC3 A;  2VJF A;  1WEW A;  2EA6 A;  4FIP A;  3OIS A;  1GCB A;  3QSD A;  4FO9 A;  2NQG A;  5LKX A;  5EF4 A;  3N4C A;  3GV4 A;  2LGG A;  2FQ9 A;  3D6S A;  3H8C A;  2EGP A;  1WEV A;  5TRB A;  2MNY A;  2DC9 A;  3HWN A;  1KHQ A;  5J3X A;  3CH3 X;  3ASL A;  5I3L A;  1NB3 A;  1RMD A;  2M3H A;  3SOW A;  1GEC E;  2DC8 A;  2G7Y A;  3GCB A;  3KFQ A;  3MTN A;  3F5V A;  5H1U A;  3CBJ A;  3PW3 A;  3HD3 A;  2G6D A;  1CV8 A;  3MOR A;  3RPG B;  2PNS A;  1POP A;  2OUL A;  3O36 A;  2HDP A;  3N9M A;  3ZPV 1;  1PIP A;  2VP7 A;  5CVN B;  4F52 B;  9PAP A;  5B79 A;  4QBB A;  5EGW A;  2JRJ A;  2R9N A;  2ACT A;  1MM2 A;  1AU2 A;  3IOQ A;  2ZET C;  5PAD A;  3KX1 A;  1GMY A;  2NQD B;  1PPO A;  2VPB A;  1GLO A;  3RTR B;  1V87 A;  3L1Z B;  3O70 A;  1M6D A;  4O64 A;  4GNG A;  2CIO A;  2ECJ A;  1AEC A;  4P6G A;  2ECT A;  4AYC B;  5B75 A;  5B77 A;  3WXF A;  3KW9 A;  5FB1 A;  1AU4 A;  2DJG B;  1SNK A;  3EB5 A;  5LCW B;  2XEU A;  4C9Z A;  2JMD A;  1CQD A;  2Y6E A;  1K2F A;  4YC9 A;  4BBQ A;  2UZG A;  1PXV A;  2YW8 A;  1WEM A;  5FB0 A;  1HYJ A;  3OVZ A;  2E03 A;  1BGO A;  3K8U A;  3N9N A;  3PHD A;  2RSD A;  1ZCM A;  4LLB A;  1WEE A;  4B86 C;  5LKT A;  3WXE A;  1MM3 A;  2K16 A;  4A4B A;  4R2Y A;  2AYN A;  2Y1M A;  2HXZ A;  4I7D A;  2P86 A;  3RVW A;  4YBS A;  5JG6 A;  4CDF B;  1QMY A;  2FTD A;  4AXL A;  2JMI A;  2LRI C;  4LJN A;  4W5C A;  4WZ0 A;  1TU6 A;  3WXG A;  4W4U A;  3LRQ A;  2AVW A;  1KFU L;  1FBV A;  4XR7 A;  2AS8 A;  6PAD A;  3ZTG A;  1WEU A;  4A49 A;  3FL2 A;  3L1X A;  5B76 A;  3M99 A;  3O33 A;  4PI3 A;  2FSA A;  1KFX L;  1XKG A;  1PBH A;  2WBF X;  2IBI A;  3O35 A;  3ZNI A;  2MUM A;  4FK5 A;  1CSB B;  3P5U A;  2LGV A;  2VNF A;  1Y08 A;  2KE1 A;  1AYW A;  5FER A;  4I05 A;  1F2A A;  3E1Z B;  2DCC A;  5TDR A;  2M85 A;  2KYU A;  3IUT A;  1ICF A;  2HD5 A;  2YU4 A;  1U9Q X;  2FUU A;  1VJV A;  2VJE B;  4WZ3 B;  1YVB A;  2JMJ A;  3P5V A;  4QRX A;  3MHS A;  2KWK A;  2YJ8 A;  4DMX A;  2ATO A;  2NQI A;  2FUI A;  1Z6U A;  3KQI A;  3M62 A;  1ME3 A;  1DF0 A;  1THE A;  2XU1 A;  2F6N A;  5DIN A;  3CBK A;  4Q6F A;  4I07 A;  3V6E A;  1MHW A;  3N3K A;  4CZW A;  1MIR A;  1Z60 A;  2IDA A;  5DKA A;  3KWZ A;  4MZS A;  4YYQ A;  1F62 A;  2FRQ A;  2P0R A;  1Q6K A;  2VPG A;  2VHS A;  3PUQ A;  3EB6 A;  1X4U A;  2CKL B;  1Z2Q A;  2KWO A;  1A6R A;  4X3G A;  3LXS A;  1VSN A;  3HHA A;  4MVT A;  2E6S A;  3F75 A;  2M1R A;  5G0F A;  2DZZ A;  2R9M A;  4YYR A;  1BOR A;  2EOD A;  8PCH A;  3RPG C;  2RI7 A;  4N4F A;  5G05 B;  1MS6 A;  4Q8H A;  3MHH A;  1AYU A;  1IWD A;  4NN2 A;  5TBN A;  1SP4 B;  4FJC A;  5FPW A;  4N3W A;  2R6N A;  2FYE A;  2AUZ A;  2CB5 A;  1EF7 A;  2KU3 A;  2E01 A;  4CA1 A;  3HTK C;  1CTE A;  3I06 A;  4XI1 A;  3U5N A;  3P5W A;  1KXR A;  5B8D A;  2YRE A;  1STF E;  4P6E A;  2YT5 A;  1DEU A;  2FT2 A;  2KWN A;  2PUY A;  3U5M A;  1T1H A;  2LDR A;  4V3L C;  2ECG A;  1XWH A;  2B1N A;  4YYU A;  4YAB A;  3P5X A;  2QJ0 A;  1ATK A;  1QXP A;  3K24 A;  2DZY A;  3S3R A;  1VFY A;  4X6H A;  3HCT A;  5JH3 A;  1HUC B;  2L75 A;  3N9L A;  2E02 A;  1WIM A;  1WFK A;  5B78 A;  2YYR A;  1F29 A;  3BWK A;  1BQI A;  1BP4 A;  3GL6 A;  3C5K A;  3SOU A;  1AYV A;  1LDK C;  1CPJ A;  1E4U A;  4I04 A;  3V6C A;  1U9V A;  4LK9 A;  2GFO A;  4CDC B;  3KV6 A;  1VD4 A;  3IMA A;  2B1M A;  4GB0 A;  2BDL A;  1YK7 A;  1K3B B;  2LGL A;  2YSM A;  1BY8 A;  5TAB A;  5CVO B;  2D8S A;  5EYA F;  3L11 A;  3N9Q A;  3IEJ A;  3NHE A;  5TDW A;  1MDW A;  4QRV A;  2CSZ A;  2BDZ A;  1U9W A;  1N87 A;  1YAL A;  1CB5 A;  3H8B A;  4YAX A;  5D1K B;  2NQA A;  4HWY A;  5K16 A;  2I50 A;  3BPM A;  4BS6 A;  3ZPV E;  4CDE B;  4P5O B;  4S3O B;  2OZ2 A;  2K1J A;  4V3K C;  3QJ3 A;  4QH6 A;  2F1G A;  2G6Q A;  4BPV A;  1WEO A;  1IYM A;  4QRG A;  2M6M A;  5KH7 A;  2F7D A;  4X6J A;  3TNX A;  1ITO A;  2OP3 A;  3RVV A;  4R7E A;  1PE6 A;  4PP1 A;  4DMY A;  2K4D A;  1F2C A;  2DX8 A;  1WGM A;  4PAD A;  3U5P A;  3IHP A;  1WES A;  4S3O C;  2QIZ A;  2Y1N A;  4ZQL A;  3LQH A;  1CS8 A;  2H0D B;  1YT7 A;  3N3G A;  2C0Y A;  2HHN A;  2DCD A;  3H6S A;  2L0B A;  2PRE A;  4MSX A;  4GNF A;  4OEM A;  1WEP A;  5KH9 A;  4PTB A;  3ZVZ B;  4CCG X;  2HH5 A;  2FO5 A;  4PP2 E;  2AIM A;  1FH0 A;  2PBH A;  3HHI A;  3O37 A;  3OF9 A;  1ZIV A;  4RY2 A;  5KH3 A;  3N9P A;  5CHV A;  1AU3 A;  1Y4H A;  5CVM A;  2Y5B A;  2C2V S;  2ARY A;  2KFT A;  3OF8 A;  2E00 A;  5AIU A;  1ZBD B;  1JM7 A;  3USV A;  4IC2 A;  4BQV A;  2C2L A;  5FEY A;  5D1M B;  4LKA A;  2P7U A;  3DQV R;  1QOL A;  1PAD A;  2R9F A;  1DVP A;  2G8E A;  3U5O A;  2PNX A;  3DPL R;  3ZUA A;  4YBT A;  4TKP B;  4YVA A;  1O0E A; 
#chains in the Genus database with same CATH topology
 2KWJ A;  3S3Q A;  1DKI A;  4KLB A;  4AXM A;  1WIL A;  3IV2 A;  1NQC A;  3BOW A;  2YSJ A;  5AIT A;  1X4J A;  4QF3 A;  2RR4 A;  2LN0 A;  2R9C A;  1QDQ A;  2JQF R;  2Z84 A;  4YYV A;  1PPP A;  3PUR A;  2XU3 A;  2NAA A;  4L7X A;  1JOC A;  2KKX A;  2AUX A;  5JZE A;  4IUM A;  2VJE A;  3T7L A;  2VPE A;  2YJ9 A;  2L5U A;  2HYE D;  4A4C A;  4GNE A;  3KWB X;  4UP0 A;  5H9M A;  2XU4 A;  1PPD A;  2R9O A;  2YJ2 A;  3TRK A;  4AVX A;  2CRW A;  1LDJ B;  4ZUX U;  2LXP C;  2YQL A;  3BBA A;  1U6G B;  5H1T A;  2DC6 A;  4WZ2 A;  3PNR A;  4QF2 A;  3LQJ A;  2FRA A;  1EWM A;  2BAY A;  2LQ6 A;  3I2D A;  3QZV A;  2IPP B;  4UI9 B;  2D8U A;  4YBM A;  4MM3 B;  3B79 A;  1WE9 A;  2YHN A;  2YUR A;  3HCS A;  1AIM A;  1CHC A;  2DOS A;  4YV8 A;  4AYC A;  4W5B A;  5D1L B;  2ECN A;  2E6R A;  3I3T A;  4AUQ B;  3ZVY A;  3PDF A;  3ERV A;  3PRP A;  3BC3 A;  5LKU A;  1MEG A;  3C9E A;  5C13 A;  1ME4 A;  2G45 A;  5G04 B;  4N4Z A;  1CVZ A;  4N8W A;  3AI8 A;  2Y43 A;  2LGK A;  2MIQ A;  1MEM A;  3OVX A;  3PLW A;  1EWO A;  2KGG A;  2CSY A;  4YAT A;  1WEQ A;  4Z0O A;  4K7C A;  3H89 A;  4PT5 A;  3U8E A;  3O1G A;  3K9M A;  2QIC A;  2G8J A;  4LAD B;  1KHP A;  3ZNH A;  1U9X A;  4OEL A;  4YYW A;  1JQP A;  1FP0 A;  3FAN A;  2JTC A;  5A24 A;  4A0C D;  1EWL A;  3MTV A;  3RVX A;  3BPF A;  3SHB A;  2PAD A;  4IP3 A;  1PPN A;  3O34 A;  1YK8 A;  4RF1 A;  2YUC A;  2MD8 C;  2DCA A;  3NG2 A;  4YYS A;  2CT2 A;  4N79 A;  4BSQ A;  1TLO A;  2JQG R;  2YQM A;  3PBH A;  1PCI A;  1TL9 A;  2F42 A;  4R8P K;  3C6W A;  2MA5 A;  2KR4 A;  2ECV A;  2KRE A;  2L43 A;  4BS5 A;  3LFY A;  2AYO A;  2ECW A;  3CH2 X;  2VJF B;  2H7J A;  3TMP A;  3SOX A;  1AU0 A;  5SVI A;  3OQC A;  3QT4 A;  4XZX A;  2L80 A;  4CDD B;  2EXU A;  4I7C A;  4I7B A;  4UP5 A;  3KKU A;  4PPE A;  4YAD A;  4X6I A;  2IQJ A;  7PCK A;  2CRR A;  5JA7 A;  2OXQ C;  4B7Y C;  3KDE C;  3H7H A;  2KIZ A;  3KNV A;  2F6J A;  2LXH C;  3T9K A;  2LV9 A;  1G25 A;  3DF0 A;  2H0D A;  2AN6 A;  4BHW A;  1NB5 A;  3ZYQ A;  2J7Q C;  3V43 A;  4XUI A;  5LKZ A;  1VYX A;  2MNZ A;  4GND A;  5F02 A;  2DJF B;  3M63 A;  1WEN A;  1CJL A;  4L58 A;  1X4I A;  3FEH A;  2XB1 A;  2KGI A;  4MZO A;  2O6X A;  2MT5 A;  3JUE A;  3FAO A;  1U5I A;  3N9O A;  3KSE A;  4ZDT A;  3T6R A;  3B21 A;  3HCU A;  2MD7 B;  5CHT A;  1EWP A;  4G54 A;  4WA6 A;  5SVI B;  2MA6 A;  1HYI A;  2ECI A;  1NL6 A;  2YHO A;  2DC7 A;  4AP4 A;  2XOC A;  2G43 A;  5H1V A;  2EGM A;  3O7A A;  2YJB A;  1DCQ A;  2YJC A;  5C11 A;  2K17 A;  1S4V A;  1F2B A;  1JM7 B;  2AU1 A;  3KV5 A;  2FUD A;  5J94 A;  2OWA A;  2VPD A;  2XOY A;  2VHF A;  2DCB A;  3H7D A;  3BCN A;  3O0U A;  3Q1D A;  2XU5 A;  1X9Y A;  5EZS A;  2CKL A;  3SUB A;  2GHU A;  1NPZ A;  3VK6 A;  4Q8G A;  3LQI A;  1NLJ A;  4IC3 A;  2VJF A;  1WEW A;  2EA6 A;  4FIP A;  3OIS A;  1GCB A;  3QSD A;  4FO9 A;  2NQG A;  5LKX A;  5EF4 A;  3N4C A;  3GV4 A;  2LGG A;  2FQ9 A;  3D6S A;  3PHW A;  2UZJ A;  3H8C A;  2EGP A;  1WEV A;  5TRB A;  2MNY A;  2DC9 A;  4M0W A;  3HWN A;  1KHQ A;  5J3X A;  3CH3 X;  3ASL A;  5I3L A;  1NB3 A;  1RMD A;  2M3H A;  2YVR A;  3SOW A;  1GEC E;  2DC8 A;  2G7Y A;  3GCB A;  3KFQ A;  3MTN A;  3F5V A;  5H1U A;  3CBJ A;  3PW3 A;  3HD3 A;  2G6D A;  3PRM A;  1CV8 A;  2JRI A;  3MJ5 A;  2AGA A;  3MOR A;  3RPG B;  2PNS A;  1POP A;  4D8B A;  2OUL A;  3O36 A;  2HDP A;  3N9M A;  3ZPV 1;  3IFU A;  1PIP A;  2VP7 A;  5CVN B;  4F52 B;  9PAP A;  5B79 A;  4QBB A;  5EGW A;  2JRJ A;  2R9N A;  2ACT A;  1MM2 A;  4Z0R A;  1AU2 A;  3IOQ A;  2ZET C;  5PAD A;  3KX1 A;  1GMY A;  2L7P A;  2NQD B;  1PPO A;  2VPB A;  4OVZ B;  4P16 A;  2JM3 A;  1GLO A;  3O65 A;  3RTR B;  1V87 A;  3L1Z B;  4HXD B;  2XP0 A;  3O70 A;  1M6D A;  4O64 A;  4GNG A;  2CIO A;  2ECJ A;  4OW0 A;  4RKX A;  3MP2 A;  1AEC A;  4P6G A;  2ECT A;  4AYC B;  5B75 A;  5B77 A;  3WXF A;  2M13 A;  3KW9 A;  5FB1 A;  1AU4 A;  5EZQ A;  2DJG B;  2BU3 A;  1SNK A;  3EB5 A;  4O62 A;  5LCW B;  2XEU A;  4C9Z A;  2JMD A;  1CQD A;  3DWD A;  2Y6E A;  1K2F A;  4R3D A;  4YC9 A;  2CSV A;  4BBQ A;  2UZG A;  1PXV A;  2YW8 A;  1WEM A;  5FB0 A;  1HYJ A;  3OVZ A;  2E03 A;  1BGO A;  4REZ A;  3LVQ E;  2LAU A;  3K8U A;  3N9N A;  3PHD A;  2RSD A;  1ZCM A;  4LLB A;  1WEE A;  4B86 C;  5LKT A;  3WXE A;  1MM3 A;  2K16 A;  4A4B A;  4R2Y A;  2AYN A;  2Y1M A;  2HXZ A;  4I7D A;  2P86 A;  3RVW A;  4YBS A;  5JG6 A;  4CDF B;  1QMY A;  2FTD A;  4AXL A;  2JMI A;  2LRI C;  4LJN A;  4W5C A;  4WZ0 A;  1TU6 A;  3WXG A;  4D8E A;  4W4U A;  3LRQ A;  2AVW A;  2B0O E;  2J7Q A;  1KFU L;  1FBV A;  4XR7 A;  2AS8 A;  2DSM A;  6PAD A;  3ZTG A;  1WEU A;  4A49 A;  3FL2 A;  3L1X A;  3E9S A;  5B76 A;  3M99 A;  2JUN A;  4RF0 A;  3O33 A;  2P57 A;  4PI3 A;  2FSA A;  1KFX L;  1XKG A;  1PBH A;  2WBF X;  2IBI A;  3BY4 A;  3O35 A;  3ZNI A;  2MUM A;  4FK5 A;  1CSB B;  2BTW B;  3P5U A;  2LGV A;  2VNF A;  1Y08 A;  2KE1 A;  1AYW A;  3BB7 A;  5FER A;  4I05 A;  1F2A A;  3E1Z B;  2XOZ A;  2DCC A;  5TDR A;  2M85 A;  2KYU A;  2MKE A;  1ICF A;  3IUT A;  2HD5 A;  2YU4 A;  3O47 A;  3FJU B;  1U9Q X;  2FUU A;  1VJV A;  3PSE A;  2VJE B;  4WZ3 B;  1UKF A;  2JMJ A;  1YVB A;  3P5V A;  4QRX A;  3MHS A;  2KWK A;  2YJ8 A;  4DMX A;  2ATO A;  2NQI A;  2FUI A;  1Z6U A;  3KQI A;  3M62 A;  4H9D A;  1ME3 A;  1DF0 A;  1THE A;  2XU1 A;  2F6N A;  5DIN A;  3CBK A;  4Q6F A;  4I07 A;  3V6E A;  1MHW A;  3N3K A;  4CZW A;  1MIR A;  1Z60 A;  2IDA A;  5DKA A;  3KWZ A;  4MZS A;  4YYQ A;  1F62 A;  2FRQ A;  2P0R A;  1Q6K A;  2VPG A;  2VHS A;  3PUQ A;  3EB6 A;  3LDY A;  1X4U A;  2CKL B;  1Z2Q A;  2KWO A;  1A6R A;  4BOP A;  4X3G A;  3LXS A;  4BOS A;  1VSN A;  3HHA A;  4MVT A;  4A5U A;  2E6S A;  3PT2 A;  3F75 A;  4RNA A;  2M1R A;  5G0F A;  2DZZ A;  2R9M A;  4YYR A;  2HWK A;  1BOR A;  2EOD A;  8PCH A;  2KKY A;  3RPG C;  2RI7 A;  4N4F A;  3PHX A;  1YZB A;  5G05 B;  1MS6 A;  4Q8H A;  3MHH A;  1AYU A;  1IWD A;  3C0R A;  4NN2 A;  4BOU A;  5TBN A;  1SP4 B;  4FJC A;  5FPW A;  4N3W A;  2R6N A;  2FYE A;  3RNV A;  2AUZ A;  2CB5 A;  3LJU X;  2KU3 A;  1EF7 A;  2E01 A;  3HTK C;  4CA1 A;  1CTE A;  4GUA A;  3DDT A;  3I06 A;  4XI1 A;  3U5N A;  3P5W A;  1KXR A;  5B8D A;  2YRE A;  5KO3 A;  1STF E;  4P6E A;  2YT5 A;  1DEU A;  3PHU A;  2FT2 A;  2KWN A;  2PUY A;  3U5M A;  1T1H A;  2LDR A;  4V3L C;  2ECG A;  1XWH A;  2B1N A;  4YYU A;  4YAB A;  3P5X A;  2E61 A;  2QJ0 A;  1ATK A;  1QXP A;  3K24 A;  2DZY A;  3S3R A;  1VFY A;  4X6H A;  3HCT A;  1PVJ A;  5JH3 A;  1HUC B;  2L75 A;  3N9L A;  2E02 A;  1WIM A;  1WFK A;  4ZTB A;  5B78 A;  2YYR A;  1F29 A;  3BWK A;  1BQI A;  1BP4 A;  4WUR A;  3GL6 A;  3C5K A;  3SOU A;  1AYV A;  1LDK C;  1CPJ A;  1E4U A;  4I04 A;  3V6C A;  1U9V A;  4LK9 A;  4QQ4 A;  2GFO A;  4CDC B;  3KV6 A;  1VD4 A;  3LVR E;  3IMA A;  2B1M A;  4GB0 A;  5E6J A;  2BDL A;  5SVX A;  1YK7 A;  4OVZ A;  3W31 A;  1K3B B;  2LGL A;  2YSM A;  5K3Q A;  5TAB A;  1BY8 A;  5CVO B;  2D8S A;  5EYA F;  3L11 A;  3N9Q A;  3IEJ A;  3W30 A;  4BOZ A;  3NHE A;  4OGE A;  5TDW A;  1MDW A;  4QRV A;  2CSZ A;  2BDZ A;  1U9W A;  1N87 A;  5SVY A;  1CB5 A;  1YAL A;  3H8B A;  4YAX A;  5D1K B;  2NQA A;  4HWY A;  5K16 A;  2I50 A;  3BPM A;  2CON A;  2DJA A;  4BS6 A;  3ZPV E;  4F1P A;  4CDE B;  4P5O B;  4S3O B;  2OZ2 A;  2K1J A;  4V3K C;  3QJ3 A;  4QH6 A;  2F1G A;  2G6Q A;  4BPV A;  1WEO A;  1IYM A;  4QRG A;  2M6M A;  5KH7 A;  2F7D A;  4X6J A;  3TNX A;  1ITO A;  2OP3 A;  3RVV A;  4R7E A;  1PE6 A;  4PP1 A;  4OGC A;  2K4D A;  1F2C A;  4DMY A;  2DX8 A;  1WGM A;  2FE8 A;  1MBM A;  4PAD A;  3U5P A;  3IHP A;  1WES A;  3MDB C;  4S3O C;  2QIZ A;  2Y1N A;  4ZQL A;  3LQH A;  1CS8 A;  2H0D B;  1YT7 A;  3FM8 C;  3N3G A;  2C0Y A;  2HHN A;  2DCD A;  3H6S A;  2L0B A;  2PRE A;  4MSX A;  4GNF A;  4OEM A;  1WEP A;  5KH9 A;  4PTB A;  3ZVZ B;  4CCG X;  2HH5 A;  4BOQ A;  2FO5 A;  4PP2 E;  2AIM A;  1FH0 A;  2PBH A;  3HHI A;  3O37 A;  3OF9 A;  1ZIV A;  4RY2 A;  5KH3 A;  3N9P A;  5CHV A;  1AU3 A;  1Y4H A;  5CVM A;  2Y5B A;  4D8I A;  2C2V S;  2ARY A;  2KFT A;  2BTW A;  3OF8 A;  2E00 A;  5AIU A;  1ZBD B;  3E2D A;  1JM7 A;  3USV A;  2FD4 A;  4IC2 A;  4BQV A;  2C2L A;  4MI7 A;  5FEY A;  5D1M B;  4LKA A;  2FFW A;  2P7U A;  3DQV R;  1QOL A;  1PAD A;  2R9F A;  1DVP A;  2G8E A;  3U5O A;  2PNX A;  3DPL R;  3ZUA A;  4YBT A;  3M7K A;  4TKP B;  4YVA A;  1O0E A; 
#chains in the Genus database with same CATH homology
 2KWJ A;  3S3Q A;  2BSZ A;  4KLB A;  4AXM A;  1WIL A;  3IV2 A;  1NQC A;  3BOW A;  2YSJ A;  5AIT A;  1X4J A;  4QF3 A;  2R9C A;  2LN0 A;  1QDQ A;  1E2T A;  2JQF R;  4YYV A;  1PPP A;  3PUR A;  2XU3 A;  2NAA A;  4L7X A;  1JOC A;  2AUX A;  2VJE A;  3T7L A;  2VPE A;  2YJ9 A;  2L5U A;  2HYE D;  4A4C A;  4GNE A;  3KWB X;  4UP0 A;  5H9M A;  2XU4 A;  1PPD A;  2R9O A;  2YJ2 A;  4AVX A;  1LDJ B;  4ZUX U;  2LXP C;  2YQL A;  3PNR A;  1U6G B;  5H1T A;  2DC6 A;  4WZ2 A;  4QF2 A;  2VFB A;  3LQJ A;  2FRA A;  1EWM A;  2BAY A;  2LQ6 A;  3I2D A;  3QZV A;  2IPP B;  4UI9 B;  4YBM A;  3B79 A;  1WE9 A;  2YHN A;  2YUR A;  3HCS A;  1AIM A;  1CHC A;  4YV8 A;  4AYC A;  4W5B A;  5D1L B;  2ECN A;  2E6R A;  3I3T A;  4AUQ B;  3ZVY A;  3PDF A;  3ERV A;  3BC3 A;  5LKU A;  1MEG A;  3C9E A;  5C13 A;  1ME4 A;  2G45 A;  5G04 B;  4N4Z A;  1CVZ A;  4N8W A;  3AI8 A;  2Y43 A;  2LGK A;  2MIQ A;  1MEM A;  3OVX A;  1EWO A;  2KGG A;  2CSY A;  4YAT A;  1WEQ A;  4K7C A;  3H89 A;  3U8E A;  3O1G A;  3K9M A;  2QIC A;  2G8J A;  4LAD B;  1KHP A;  1U9X A;  4OEL A;  4YYW A;  1JQP A;  1FP0 A;  5A24 A;  4A0C D;  1EWL A;  3RVX A;  3BPF A;  3SHB A;  2PAD A;  1PPN A;  3O34 A;  1YK8 A;  2YUC A;  2MD8 C;  2DCA A;  3NG2 A;  4YYS A;  2CT2 A;  4N79 A;  4BSQ A;  1TLO A;  2JQG R;  2YQM A;  3PBH A;  1PCI A;  1TL9 A;  2F42 A;  4R8P K;  3C6W A;  2MA5 A;  2KR4 A;  2ECV A;  2KRE A;  2L43 A;  4BS5 A;  3LFY A;  2AYO A;  2ECW A;  3CH2 X;  2VJF B;  2H7J A;  3SOX A;  1AU0 A;  3QT4 A;  4CDD B;  2L80 A;  4I7C A;  4UP5 A;  4I7B A;  3KKU A;  4PPE A;  4YAD A;  4X6I A;  7PCK A;  5JA7 A;  2OXQ C;  4B7Y C;  2KIZ A;  3KNV A;  4BGF A;  2F6J A;  2LXH C;  2LV9 A;  1G25 A;  3DF0 A;  2H0D A;  2AN6 A;  4BHW A;  1NB5 A;  3ZYQ A;  3V43 A;  4XUI A;  5LKZ A;  1VYX A;  2MNZ A;  4C5P A;  4GND A;  1W4T A;  5F02 A;  2DJF B;  3M63 A;  1WEN A;  1CJL A;  4L58 A;  1X4I A;  2XB1 A;  2KGI A;  4MZO A;  2O6X A;  2MT5 A;  1U5I A;  3N9O A;  3KSE A;  4ZDT A;  3T6R A;  3HCU A;  2MD7 B;  5CHT A;  1EWP A;  4G54 A;  4WA6 A;  2MA6 A;  1HYI A;  2ECI A;  1NL6 A;  2YHO A;  2DC7 A;  4AP4 A;  2G43 A;  5H1V A;  3O7A A;  2YJB A;  2YJC A;  5C11 A;  2K17 A;  1S4V A;  1F2B A;  1JM7 B;  2AU1 A;  3KV5 A;  2FUD A;  5J94 A;  2VPD A;  2VHF A;  2DCB A;  3H7D A;  3BCN A;  3O0U A;  2XU5 A;  1X9Y A;  2CKL A;  2GHU A;  1NPZ A;  3VK6 A;  4Q8G A;  3LQI A;  1NLJ A;  4IC3 A;  2VJF A;  1WEW A;  2EA6 A;  4FIP A;  1GX3 A;  3OIS A;  1GCB A;  3QSD A;  4FO9 A;  2NQG A;  5LKX A;  5EF4 A;  3N4C A;  3GV4 A;  2LGG A;  2FQ9 A;  3D6S A;  3H8C A;  2EGP A;  1WEV A;  5TRB A;  2MNY A;  2DC9 A;  3HWN A;  1KHQ A;  5J3X A;  3CH3 X;  3ASL A;  5I3L A;  1NB3 A;  1RMD A;  2M3H A;  3SOW A;  1GEC E;  2DC8 A;  2G7Y A;  3GCB A;  3KFQ A;  3MTN A;  3F5V A;  5H1U A;  3CBJ A;  3PW3 A;  3HD3 A;  2G6D A;  1CV8 A;  3MOR A;  3RPG B;  2PNS A;  1POP A;  2OUL A;  3O36 A;  2HDP A;  3N9M A;  3ZPV 1;  1PIP A;  2VP7 A;  5CVN B;  4F52 B;  9PAP A;  5B79 A;  4QBB A;  5EGW A;  2JRJ A;  2R9N A;  2ACT A;  1MM2 A;  1AU2 A;  3IOQ A;  2ZET C;  4B55 A;  5PAD A;  3KX1 A;  1GMY A;  2NQD B;  1PPO A;  2VPB A;  1GLO A;  3RTR B;  2VFC A;  1V87 A;  3L1Z B;  3O70 A;  1M6D A;  4O64 A;  4GNG A;  2CIO A;  2ECJ A;  1AEC A;  4P6G A;  2ECT A;  4AYC B;  5B75 A;  5B77 A;  3WXF A;  3KW9 A;  5FB1 A;  1AU4 A;  2DJG B;  1SNK A;  3EB5 A;  5LCW B;  2XEU A;  4C9Z A;  2JMD A;  1CQD A;  2Y6E A;  1K2F A;  4YC9 A;  4BBQ A;  2UZG A;  1PXV A;  2YW8 A;  1WEM A;  5FB0 A;  1HYJ A;  3OVZ A;  2E03 A;  1BGO A;  3K8U A;  3N9N A;  3PHD A;  2RSD A;  1ZCM A;  4LLB A;  1WEE A;  4B86 C;  5LKT A;  3WXE A;  1MM3 A;  2K16 A;  4A4B A;  4R2Y A;  2AYN A;  2Y1M A;  2HXZ A;  4I7D A;  2P86 A;  3RVW A;  4YBS A;  5JG6 A;  4CDF B;  1QMY A;  2FTD A;  4AXL A;  2JMI A;  2LRI C;  4LJN A;  4W5C A;  4WZ0 A;  1TU6 A;  3WXG A;  4W4U A;  3LRQ A;  2AVW A;  1KFU L;  1FBV A;  4XR7 A;  2AS8 A;  6PAD A;  3ZTG A;  1WEU A;  4A49 A;  3FL2 A;  3L1X A;  5B76 A;  3M99 A;  3O33 A;  4PI3 A;  2FSA A;  1KFX L;  1XKG A;  1PBH A;  2WBF X;  2IBI A;  3O35 A;  3ZNI A;  2MUM A;  4FK5 A;  1CSB B;  3P5U A;  2LGV A;  2VNF A;  1Y08 A;  2KE1 A;  1AYW A;  4GUZ A;  5FER A;  4I05 A;  1F2A A;  3E1Z B;  2DCC A;  5TDR A;  2M85 A;  2KYU A;  3IUT A;  1ICF A;  2HD5 A;  2YU4 A;  1U9Q X;  2FUU A;  1VJV A;  2VJE B;  4WZ3 B;  1YVB A;  2JMJ A;  3P5V A;  4QRX A;  3MHS A;  2KWK A;  2YJ8 A;  4DMX A;  2ATO A;  2NQI A;  2FUI A;  1Z6U A;  3KQI A;  3M62 A;  1ME3 A;  1DF0 A;  1THE A;  2XU1 A;  2F6N A;  5DIN A;  3CBK A;  4Q6F A;  4I07 A;  3V6E A;  1MHW A;  3N3K A;  4CZW A;  1MIR A;  1Z60 A;  2IDA A;  5DKA A;  3KWZ A;  4MZS A;  4YYQ A;  1F62 A;  2FRQ A;  2P0R A;  1Q6K A;  2VPG A;  2VHS A;  3PUQ A;  3EB6 A;  1X4U A;  2CKL B;  1Z2Q A;  2KWO A;  1A6R A;  4X3G A;  3LXS A;  1VSN A;  3HHA A;  4MVT A;  2E6S A;  3F75 A;  2M1R A;  5G0F A;  2DZZ A;  2R9M A;  4YYR A;  1BOR A;  2EOD A;  8PCH A;  3RPG C;  2RI7 A;  4N4F A;  5G05 B;  1MS6 A;  4Q8H A;  3MHH A;  1AYU A;  1IWD A;  4NN2 A;  5TBN A;  1SP4 B;  4FJC A;  5FPW A;  4N3W A;  2R6N A;  2FYE A;  3D9W A;  2AUZ A;  2CB5 A;  1EF7 A;  2KU3 A;  2E01 A;  4CA1 A;  3HTK C;  1CTE A;  3I06 A;  4XI1 A;  3U5N A;  3P5W A;  1KXR A;  5B8D A;  2YRE A;  1STF E;  4P6E A;  2YT5 A;  1DEU A;  2FT2 A;  2KWN A;  2PUY A;  3U5M A;  1T1H A;  2LDR A;  4V3L C;  2ECG A;  1XWH A;  2B1N A;  4YYU A;  4YAB A;  3P5X A;  2QJ0 A;  1ATK A;  1QXP A;  3K24 A;  2DZY A;  3S3R A;  1VFY A;  4X6H A;  3HCT A;  5JH3 A;  1HUC B;  2L75 A;  3N9L A;  2E02 A;  1WIM A;  1WFK A;  5B78 A;  2YYR A;  1F29 A;  3BWK A;  1BQI A;  1BP4 A;  3GL6 A;  3C5K A;  3SOU A;  1AYV A;  1LDK C;  1CPJ A;  1E4U A;  4I04 A;  3V6C A;  1U9V A;  4LK9 A;  2GFO A;  4CDC B;  3KV6 A;  1VD4 A;  3IMA A;  2B1M A;  4GB0 A;  2BDL A;  1YK7 A;  1K3B B;  2LGL A;  2YSM A;  1BY8 A;  5TAB A;  5CVO B;  2D8S A;  5EYA F;  3L11 A;  3N9Q A;  3IEJ A;  3NHE A;  5TDW A;  1MDW A;  4QRV A;  2CSZ A;  2BDZ A;  1U9W A;  1N87 A;  1YAL A;  1CB5 A;  3H8B A;  1W5R A;  4YAX A;  5D1K B;  2NQA A;  4HWY A;  5K16 A;  2I50 A;  3BPM A;  4BS6 A;  3LTW A;  3ZPV E;  4NV8 A;  4CDE B;  4P5O B;  4S3O B;  2OZ2 A;  2K1J A;  4V3K C;  3QJ3 A;  4QH6 A;  2F1G A;  2G6Q A;  4BPV A;  1WEO A;  1IYM A;  4QRG A;  2M6M A;  5KH7 A;  2F7D A;  4X6J A;  3TNX A;  1ITO A;  2OP3 A;  3RVV A;  4R7E A;  1PE6 A;  4PP1 A;  4DMY A;  2K4D A;  1F2C A;  2DX8 A;  1WGM A;  4PAD A;  3U5P A;  3IHP A;  1WES A;  4S3O C;  2QIZ A;  2Y1N A;  4ZQL A;  3LQH A;  1CS8 A;  2H0D B;  1YT7 A;  3N3G A;  2C0Y A;  2HHN A;  2DCD A;  3H6S A;  2L0B A;  2PRE A;  4MSX A;  4GNF A;  4OEM A;  1WEP A;  5KH9 A;  4PTB A;  3ZVZ B;  4CCG X;  2HH5 A;  2FO5 A;  4PP2 E;  2AIM A;  1FH0 A;  2PBH A;  3HHI A;  3O37 A;  3OF9 A;  1ZIV A;  4RY2 A;  5KH3 A;  3N9P A;  5CHV A;  1AU3 A;  1Y4H A;  5CVM A;  2Y5B A;  2C2V S;  2ARY A;  2KFT A;  3OF8 A;  2E00 A;  5AIU A;  1ZBD B;  4NV7 A;  1W6F A;  1JM7 A;  3USV A;  4IC2 A;  4BQV A;  2C2L A;  5FEY A;  5D1M B;  4LKA A;  2P7U A;  3DQV R;  1QOL A;  1PAD A;  2R9F A;  1DVP A;  2G8E A;  3U5O A;  2PNX A;  3DPL R;  3ZUA A;  4YBT A;  4TKP B;  4YVA A;  1O0E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...