3MHSA

Structure of the saga ubp8/sgf11/sus1/sgf73 dub module bound to ubiquitin aldehyde
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
472
structure length
455
Chain Sequence
AMSICPHIQQVFQNEKSKDGVLKTCNAARYILNHSVPKEKFLNTMKCGTCHEINSGATFMCLQCGFCGCWNHSHFLSHSKQIGHIFGINSNNGLLFCFKCEDYIGNIDLINDAILAKYWDDVCTKTMVPSMERRDGLSGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNNCKVRSPDKCFSCALDKIVHELYGALNTSTNRQTGFIYLLTCAWKINQNLAGYSQQDAHEFWQFIINQIHQSYVLDLPNNNKQCECIVHTVFEGSLESSIVCPGCQNNSKTTIDPFLDLSLDIKDKKKLYECLDSFHKKEQLKDFNYHCGECNSTQDAIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKNYCSTKEKDKENGKVPDIIYELIGIVSHKGTVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQAYLLFYTIRQVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase 8
publication title Structural insights into the assembly and function of the SAGA deubiquitinating module.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/transcription regulator/protein binding
total genus 134
structure length 455
sequence length 472
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2010-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3mhsA01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3mhsA02
2F6JA 2NQDB 4R2YA 3P5WA 2L43A 5C11A 2FSAA 2JMJA 3EB5A 5CHTA 2ARYA 5H9MA 3ZVYA 2DCDA 3HCTA 5B8DA 2AN6A 3ZNIA 3N9NA 3C5KA 3HTKC 1IWDA 4K7CA 4CDEB 2CSZA 2PBHA 1WEVA 2DCAA 3OF8A 5LCWB 4NN2A 3BWKA 1U6GB 4N4FA 2D8SA 4QH6A 3O34A 4GNFA 1HYIA 2YREA 1VFYA 3LRQA 1AU2A 2YHNA 1KFUL 5J94A 2YJ9A 3B79A 1KHQA 2Y6EA 4PPEA 2NQGA 5C13A 2JQGR 2NQIA 4XI1A 3RPGC 4LADB 5FPWA 2AUXA 1PCIA 5B77A 1WEUA 1XWHA 2LXPC 1ITOA 3RTRB 3M63A 1KHPA 4FO9A 1NL6A 2Y43A 1KFXL 2VPEA 2FUIA 1EF7A 2AIMA 2HXZA 1BP4A 4AXMA 1Q6KA 2VJEB 4OELA 2YYRA 4BQVA 3PDFA 4RY2A 4DMYA 3H7DA 3KQIA 4O64A 4TKPB 1PBHA 2F6NA 4GNDA 3IMAA 2Y1MA 3HCUA 1FBVA 2YQMA 4AVXA 5G04B 4CA1A 5EYAF 1MM2A 1ATKA 4XR7A 3AI8A 4Q6FA 1WEEA 1JOCA 4YYVA 4V3KC 4AXLA 5B75A 4R8PK 1X9YA 3USVA 1VD4A 2VP7A 2XB1A 3M62A 3DF0A 5CVNB 3E1ZB 2IBIA 3N9PA 2XEUA 5EGWA 1ICFA 4BPVA 2QICA 1N87A 3U5PA 2CSYA 4I7CA 1EWLA 2R6NA 2WBFX 2RSDA 2G43A 3H6SA 2GHUA 4PP2E 2E6SA 2PNSA 2NQAA 4YYRA 1K2FA 4YBTA 4P6EA 1WEPA 2L75A 3C6WA 4GNEA 2MA6A 1VJVA 2B1NA 1WIMA 4YYUA 5B76A 1U9WA 1JM7A 3N9OA 2YU4A 5TABA 2M85A 5TDWA 1WEWA 2MUMA 3KNVA 4FIPA 1JQPA 4I7DA 4X6JA 9PAPA 1CJLA 2E6RA 2ATOA 3U5MA 2DC9A 5G05B 2P0RA 3GL6A 4W4UA 2VPDA 3GV4A 4AUQB 2DC6A 2LGVA 2OXQC 4WZ0A 5CHVA 2K17A 5FEYA 2VPGA 1THEA 2G8EA 3KWBX 2ECJA 5FB1A 3I2DA 1CTEA 2DX8A 2K16A 2M3HA 5DINA 2HHNA 4CDFB 2IPPB 4R7EA 1CPJA 5LKXA 3QSDA 4Q8GA 2E02A 1CHCA 5JG6A 3GCBA 4YBMA 2DC8A 2MNZA 1CQDA 4BHWA 2R9OA 3CBJA 3ERVA 1YVBA 3KX1A 4YABA 1M6DA 4MZOA 2AS8A 2YURA 4L7XA 1STFE 2ECWA 2ECVA 4I04A 3U5OA 1WEOA 2JRJA 2I50A 1EWMA 2DC7A 4WZ3B 3ZPV1 1IYMA 4XUIA 1NPZA 2CB5A 4ZDTA 3CH2X 3T6RA 1YK7A 2G6DA 3K8UA 2YJBA 3SOWA 1CB5A 2YJ2A 1A6RA 5FB0A 2H7JA 3KFQA 4BSQA 3T7LA 1PE6A 1AYUA 3HCSA 1U5IA 2FUDA 2KWKA 3MHHA 4WZ2A 2LGGA 2O6XA 3PW3A 2AYNA 4I05A 2KYUA 2LDRA 1PPNA 1DVPA 2ECGA 3RVWA 2EGPA 1GMYA 2FYEA 4B7YC 2ZETC 1G25A 1WE9A 3H89A 3WXFA 2HDPA 3N9QA 4AYCB 2F7DA 2PUYA 1XKGA 2R9MA 4CDCB 2KWJA 2EODA 4C9ZA 1WGMA 2R9FA 3ZYQA 4OEMA 2YQLA 1Z6UA 3CH3X 1PPOA 3DQVR 1BY8A 4YC9A 2ECTA 5JH3A 4IC2A 2AU1A 2FTDA 4QF3A 5AIUA 3EB6A 4LKAA 4P5OB 3VK6A 1POPA 2KR4A 1X4UA 1MDWA 2BDLA 2XU1A 3HWNA 2CKLB 3O36A 3I06A 4KLBA 3SOXA 2VNFA 4MSXA 1HUCB 4UP5A 1U9QX 5G0FA 3OF9A 2YT5A 4ZUXU 4I07A 2KE1A 1PPDA 2BDZA 5KH3A 2LGKA 1LDKC 2G45A 4HWYA 4N4ZA 1ZBDB 3IV2A 4QF2A 5PADA 4N8WA 5TRBA 4LLBA 4AP4A 1BQIA 2CIOA 5F02A 1CS8A 1LDJB 1K3BB 2ECNA 2KWOA 2L0BA 3LQHA 3IUTA 1PADA 2DCBA 4QRXA 3PURA 7PCKA 2LGLA 5KH9A 2KREA 3SOUA 2KWNA 1PXVA 3HHIA 2C2LA 3P5VA 1AU3A 3QT4A 4ZQLA 4QRVA 1NB3A 4F52B 1CV8A 1SP4B 1F2CA 3KW9A 3DPLR 4YYSA 2EA6A 1MS6A 2C2VS 2QJ0A 4PADA 2OZ2A 2E01A 1BGOA 1FP0A 3V6EA 1QOLA 4QBBA 2HD5A 2YHOA 3OVZA 3ZPVE 1AU4A 2IDAA 2MT5A 1VSNA 2HH5A 2KGGA 1TLOA 3BC3A 4V3LC 5FERA 3NHEA 1CVZA 3FL2A 4YV8A 5B78A 2LN0A 5DKAA 1EWPA 1U9VA 2KIZA 2RI7A 5AITA 1KXRA 2R9CA 4AYCA 4S3OB 1GECE 5A24A 3RVXA 4UI9B 1QXPA 2P86A 2B1MA 4P6GA 2VJEA 2MA5A 3QZVA 2NAAA 5D1LB 3N3GA 3MHSA 1DF0A 1ZCMA 2ACTA 3L11A 3MORA 3OVXA 2OULA 3C9EA 2K4DA 2E00A 1QMYA 5LKTA 5CVMA 4YYQA 4X3GA 3O37A 3L1ZB 4YADA 3ZUAA 1WEMA 2Y1NA 1T1HA 2AVWA 2CKLA 4QRGA 1ME3A 2KFTA 1X4JA 3LFYA 2VHSA 1MHWA 5H1TA 1FH0A 3N4CA 4YBSA 4N79A 2F42A 1Y08A 1F29A 2DZYA 4FJCA 2CT2A 1YT7A 2G6QA 2C0YA 5K16A 3RVVA 4CDDB 3MTNA 2VPBA 1F2BA 2HYED 1AYWA 3ZVZB 3U8EA 2LV9A 3L1XA 5D1KB 2DZZA 1AU0A 3V6CA 5EF4A 2M1RA 2PNXA 2FRQA 3BPMA 2YSJA 1MM3A 2R9NA 3KV6A 3N3KA 2H0DB 3QJ3A 1NB5A 1AECA 2ECIA 4MZSA 3D6SA 3KSEA 3H8BA 3PUQA 4YATA 3BOWA 4GB0A 4LJNA 2F1GA 5TBNA 2UZGA 2MNYA 2MIQA 1YALA 3IOQA 4PP1A 2OP3A 4CZWA 1RMDA 2JMIA 1GLOA 4L58A 4PI3A 4G54A 1JM7B 1AYVA 1TL9A 5H1VA 1O0EA 2K1JA 3S3QA 3F75A 2PREA 4A4BA 3O35A 4A4CA 5CVOB 3BPFA 5JA7A 1S4VA 3N9MA 2VJFB 4N3WA 1MEGA 2LXHC 1WESA 3WXGA 3O70A 2XU4A 6PADA 1Z2QA 5B79A 3IHPA 3O7AA 5D1MB 1MEMA 3ZTGA 2LRIC 5I3LA 3IEJA 3BCNA 3I3TA 1VYXA 4W5BA 4DMXA 4BS6A 2LQ6A 4S3OC 1F62A 1F2AA 3V43A 1ME4A 1WENA 4WA6A 5J3XA 4YYWA 3ASLA 3K9MA 3LXSA 1NLJA 2M6MA 2L5UA 3N9LA 3S3RA 3P5XA 2JMDA 2PADA 4CCGX 2G7YA 4BS5A 1GCBA 1CSBB 1HYJA 2Y5BA 3KWZA 1DEUA 3KKUA 2FUUA 4I7BA 3K24A 3LQJA 1NQCA 1PPPA 1E4UA 2AUZA 3O33A 1WEQA 1EWOA 2H0DA 3HD3A 1V87A 3RPGB 1MIRA 2FT2A 2GFOA 1PIPA 8PCHA 1AIMA 2FRAA 4Q8HA 2L80A 4BBQA 1U9XA 3HHAA 3PBHA 2YUCA 3KV5A 4GNGA 1TU6A 2JQFR 3M99A 1WILA 5KH7A 4YAXA 4FK5A 2YJCA 2XU3A 5LKUA 2FQ9A 4MVTA 3P5UA 2P7UA 2KU3A 2MD7B 1WFKA 1SNKA 2G8JA 2DJGB 1YK8A 1X4IA 3F5VA 3OISA 4A0CD 3PNRA 4W5CA 2BAYA 4PTBA 2FO5A 2DCCA 3U5NA 1QDQA 2XU5A 3WXEA 3PHDA 2AYOA 2VHFA 2YJ8A 3CBKA 2YSMA 2VJFA 2MD8C 2KGIA 1Y4HA 5LKZA 1BORA 3TNXA 2QIZA 4A49A 5H1UA 4X6IA 3H8CA 4YVAA 4B86C 3O0UA 4X6HA 2E03A 3LQIA 4UP0A 3O1GA 2YW8A 1ZIVA 3NG2A 5TDRA 3SHBA 1Z60A 4IC3A 2DJFB 4LK9A
chains in the Genus database with same CATH superfamily
2F6JA 2NQDB 4R2YA 3O65A 3P5WA 2L43A 3FAOA 5C11A 2FSAA 2JMJA 4M0WA 3EB5A 3LJUX 5CHTA 2ARYA 5H9MA 3ZVYA 2DCDA 3HCTA 5B8DA 2AN6A 4OW0A 3ZNIA 3N9NA 3C5KA 3HTKC 1IWDA 3LVRE 4K7CA 4CDEB 2CSZA 2PBHA 1WEVA 2DCAA 3OF8A 5LCWB 2HWKA 4NN2A 3BWKA 1U6GB 4N4FA 2D8SA 4QH6A 3O34A 4GNFA 1HYIA 2YREA 1VFYA 3LRQA 1AU2A 2YHNA 1KFUL 3DWDA 5J94A 2YJ9A 3LDYA 3B79A 1KHQA 2JUNA 2Y6EA 4RNAA 4PPEA 2NQGA 5C13A 2JQGR 2NQIA 4XI1A 3RPGC 4LADB 5FPWA 2AUXA 1PCIA 5B77A 1WEUA 1XWHA 2LXPC 1ITOA 3OQCA 4XZXA 3RTRB 3M63A 3H7HA 1KHPA 4FO9A 1NL6A 2Y43A 1KFXL 2VPEA 2FUIA 1EF7A 2AIMA 2HXZA 1BP4A 2CSVA 4AXMA 1Q6KA 2VJEB 4OELA 4D8EA 2YYRA 4BQVA 3PDFA 4RY2A 4DMYA 3H7DA 1UKFA 3KQIA 4O64A 4TKPB 1PBHA 2F6NA 4GNDA 3IMAA 2Y1MA 3HCUA 1FBVA 2YQMA 4AVXA 5G04B 4CA1A 5EYAF 5SVIB 1MM2A 1ATKA 3W31A 4BOSA 3MP2A 4XR7A 3AI8A 4Q6FA 2J7QA 1WEEA 1JOCA 4YYVA 2EXUA 4V3KC 5B75A 4R8PK 4AXLA 1X9YA 3USVA 1VD4A 2VP7A 2XB1A 3M62A 3DF0A 5EZSA 5CVNB 3E1ZB 2IBIA 3N9PA 2Z84A 2XEUA 2JRIA 5EGWA 1ICFA 4BPVA 2QICA 1N87A 3U5PA 2CSYA 4I7CA 1EWLA 2R6NA 2WBFX 2RSDA 2J7QC 2G43A 3H6SA 2GHUA 3PHUA 4PP2E 2E6SA 2PNSA 2NQAA 4YYRA 1K2FA 4YBTA 4P6EA 4P16A 1WEPA 2L75A 2L7PA 1YZBA 2FFWA 3C6WA 4GNEA 4BOQA 2MA6A 1VJVA 2B1NA 1WIMA 4YYUA 3SUBA 5B76A 1U9WA 1JM7A 3N9OA 2YU4A 2M85A 2RR4A 1WEWA 2MUMA 3KNVA 5TABA 4FIPA 5TDWA 1JQPA 4I7DA 3JUEA 2CRWA 3T9KA 4X6JA 2BU3A 1CJLA 2E6RA 2ATOA 9PAPA 3U5MA 2DC9A 5G05B 2P0RA 3GL6A 4W4UA 4REZA 4BOUA 2M13A 2VPDA 4D8BA 3GV4A 4AUQB 2DC6A 2LGVA 2OXQC 4WZ0A 5CHVA 2K17A 5FEYA 2VPGA 1THEA 2G8EA 2UZJA 3KWBX 2ECJA 5FB1A 3I2DA 1CTEA 2DSMA 2DX8A 2K16A 2M3HA 5DINA 2HHNA 4CDFB 2IPPB 2OWAA 5E6JA 4R7EA 3TMPA 1CPJA 5LKXA 3QSDA 4Q8GA 2E02A 1CHCA 5JG6A 3GCBA 4YBMA 2DC8A 2MNZA 1CQDA 4BHWA 3Q1DA 5SVIA 2R9OA 3CBJA 3ERVA 1YVBA 3KX1A 4YABA 2FD4A 3MJ5A 1M6DA 4MZOA 2AS8A 2YURA 4L7XA 1STFE 2ECWA 2ECVA 2JTCA 3U5OA 1WEOA 2JRJA 2I50A 1EWMA 2DC7A 4I04A 4WZ3B 3ZPV1 1IYMA 4XUIA 1NPZA 2CB5A 4ZDTA 4RF0A 3CH2X 2XOYA 3T6RA 1YK7A 2G6DA 4IUMA 3K8UA 2YJBA 3SOWA 3KDEC 1CB5A 2B0OE 2KKYA 2YJ2A 1A6RA 5FB0A 2H7JA 3RNVA 3KFQA 4BSQA 4Z0OA 3T7LA 1PE6A 1AYUA 3HCSA 1U5IA 4OGCA 2FUDA 2KWKA 3MHHA 4WZ2A 2LGGA 2O6XA 3PW3A 2AYNA 4I05A 2KYUA 2LDRA 1PPNA 1DVPA 4ZTBA 2ECGA 3RVWA 2EGPA 2DOSA 2EGMA 1GMYA 2FYEA 3PHWA 4B7YC 2ZETC 1G25A 1WE9A 3H89A 3WXFA 2HDPA 3N9QA 4AYCB 2F7DA 2PUYA 1XKGA 2R9MA 3TRKA 4CDCB 5K3QA 3FEHA 2KWJA 2EODA 4C9ZA 1WGMA 3FANA 2R9FA 3ZYQA 4OEMA 2YQLA 1Z6UA 3CH3X 1PPOA 3PT2A 3DQVR 4Z0RA 2XOCA 1BY8A 4YC9A 2ECTA 5JH3A 4IC2A 2AU1A 2FTDA 4QF3A 5AIUA 3EB6A 4LKAA 4P5OB 3VK6A 1POPA 2KR4A 1X4UA 2YVRA 1MDWA 2BDLA 2XU1A 2CKLB 3O36A 3HWNA 3I06A 4KLBA 4OVZB 3SOXA 2VNFA 4MSXA 1HUCB 4UP5A 1U9QX 5G0FA 3OF9A 2YT5A 4ZUXU 4I07A 2KE1A 1PPDA 2BDZA 5KH3A 2LGKA 1LDKC 2G45A 4HWYA 4N4ZA 1ZBDB 3IV2A 4QF2A 5PADA 4N8WA 5TRBA 4LLBA 4AP4A 1BQIA 2CIOA 5F02A 1CS8A 1LDJB 5SVXA 1K3BB 2ECNA 2KWOA 2L0BA 3LQHA 3IUTA 1DCQA 1PADA 2DCBA 3PURA 4QRXA 2LGLA 5KH9A 2KREA 7PCKA 3SOUA 2KWNA 1PXVA 3HHIA 2C2LA 3P5VA 1AU3A 3QT4A 4ZQLA 4QRVA 1NB3A 4F52B 1CV8A 1SP4B 1F2CA 3KW9A 3DPLR 4YYSA 2EA6A 1MS6A 2C2VS 2QJ0A 4PADA 4F1PA 2OZ2A 2E01A 1BGOA 1FP0A 3V6EA 3MDBC 1QOLA 4MI7A 4QBBA 2HD5A 2YHOA 3OVZA 3ZPVE 1AU4A 2IDAA 2XOZA 5KO3A 2MT5A 1VSNA 2BTWB 2HH5A 2KGGA 2FE8A 1TLOA 3BC3A 4V3LC 5FERA 3O47A 3NHEA 1CVZA 3FL2A 4YV8A 5B78A 2LN0A 5DKAA 1EWPA 1U9VA 2KIZA 2RI7A 5AITA 1KXRA 2R9CA 4AYCA 4S3OB 1GECE 5A24A 3RVXA 4UI9B 1QXPA 4WURA 2P86A 3BBAA 2B1MA 4P6GA 4H9DA 2VJEA 3BY4A 2MA5A 3QZVA 2NAAA 5D1LB 3N3GA 3MHSA 1DF0A 1ZCMA 2ACTA 3L11A 3MORA 3OVXA 3W30A 2CONA 2OULA 3C9EA 2K4DA 1DKIA 1QMYA 2E00A 5LKTA 5CVMA 4YYQA 4X3GA 3O37A 3BB7A 3L1ZB 4YADA 3ZUAA 1WEMA 2Y1NA 1T1HA 2AVWA 4OVZA 2CKLA 4QRGA 1ME3A 2KFTA 1X4JA 3PRMA 3LFYA 4PT5A 2VHSA 1MHWA 5H1TA 1FH0A 3N4CA 4YBSA 4N79A 2AGAA 2F42A 1Y08A 1F29A 2DZYA 4FJCA 1MBMA 2CT2A 1YT7A 2G6QA 2C0YA 5K16A 3RVVA 4CDDB 3MTNA 2VPBA 1F2BA 2HYED 1AYWA 3M7KA 3ZNHA 3ZVZB 3U8EA 2LV9A 3L1XA 5D1KB 2DZZA 1AU0A 3V6CA 5EF4A 2M1RA 2PNXA 2FRQA 3BPMA 1PVJA 2YSJA 1MM3A 3E2DA 3KV6A 2R9NA 2H0DB 3N3KA 3QJ3A 1AECA 1NB5A 2ECIA 4MZSA 3D6SA 3KSEA 2JM3A 3H8BA 4GUAA 3PUQA 4YATA 3BOWA 3MTVA 4RKXA 4GB0A 4LJNA 2F1GA 5TBNA 2UZGA 2MNYA 2MIQA 2XP0A 1YALA 3IOQA 4PP1A 3B21A 2LAUA 2OP3A 4MM3B 1RMDA 4CZWA 2JMIA 4IP3A 1GLOA 4L58A 4PI3A 4G54A 1JM7B 1AYVA 1TL9A 2BTWA 4BOPA 5H1VA 1O0EA 2E61A 2K1JA 3S3QA 4BOZA 4QQ4A 3F75A 2PREA 4A4BA 3O35A 4A4CA 5CVOB 3BPFA 5JA7A 4OGEA 1S4VA 3N9MA 2VJFB 4N3WA 1MEGA 2LXHC 1WESA 3WXGA 3O70A 2XU4A 6PADA 1Z2QA 5B79A 5JZEA 3IHPA 3O7AA 5D1MB 1MEMA 3ZTGA 2DJAA 2LRIC 5I3LA 3IEJA 3BCNA 3I3TA 1VYXA 4W5BA 4DMXA 4BS6A 2LQ6A 4S3OC 1F62A 1F2AA 3V43A 1ME4A 1WENA 4WA6A 5J3XA 4YYWA 3ASLA 3K9MA 3LXSA 1NLJA 2M6MA 2L5UA 3N9LA 3S3RA 3P5XA 2JMDA 2PADA 4D8IA 4CCGX 2G7YA 2IQJA 3E9SA 4BS5A 1GCBA 1CSBB 1HYJA 2Y5BA 3KWZA 1DEUA 3C0RA 3KKUA 2FUUA 4I7BA 3K24A 3LQJA 1NQCA 4HXDB 3IFUA 1PPPA 1E4UA 3PLWA 2AUZA 3O33A 4A5UA 1WEQA 3DDTA 1EWOA 2H0DA 3HD3A 1V87A 3RPGB 1MIRA 2FT2A 2GFOA 1PIPA 4RF1A 8PCHA 2KKXA 1AIMA 2FRAA 4Q8HA 2L80A 4BBQA 1U9XA 3HHAA 3PBHA 2YUCA 3KV5A 4GNGA 4R3DA 1TU6A 2JQFR 3M99A 1WILA 5KH7A 4YAXA 4FK5A 2YJCA 3PSEA 2XU3A 5LKUA 2FQ9A 4MVTA 3P5UA 2P7UA 2KU3A 2MD7B 1WFKA 1SNKA 2G8JA 2DJGB 1YK8A 1X4IA 3F5VA 5SVYA 4A0CD 2CRRA 3OISA 3PNRA 4W5CA 2BAYA 4PTBA 2FO5A 2DCCA 3U5NA 1QDQA 2XU5A 3WXEA 3PHDA 5EZQA 4O62A 2AYOA 2VHFA 3FJUB 2YJ8A 3CBKA 2YSMA 2VJFA 2MD8C 3PHXA 2KGIA 1Y4HA 5LKZA 1BORA 3LVQE 3TNXA 2QIZA 4A49A 5H1UA 4X6IA 3H8CA 4YVAA 4B86C 2D8UA 3O0UA 4X6HA 2E03A 2MKEA 3LQIA 4UP0A 3O1GA 2YW8A 3PRPA 1ZIVA 3FM8C 3NG2A 5TDRA 3SHBA 1Z60A 4IC3A 2P57A 2DJFB 4LK9A
chains in the Genus database with same CATH topology
2F6JA 2NQDB 4R2YA 3P5WA 2L43A 5C11A 2FSAA 2JMJA 3EB5A 5CHTA 2ARYA 5H9MA 3ZVYA 2DCDA 3HCTA 5B8DA 2AN6A 3ZNIA 3N9NA 3C5KA 3HTKC 1IWDA 4K7CA 4CDEB 2CSZA 2PBHA 1WEVA 4GUZA 2DCAA 3OF8A 5LCWB 4NN2A 3BWKA 1U6GB 4N4FA 2D8SA 4QH6A 3O34A 4GNFA 1HYIA 2YREA 1VFYA 3LRQA 1AU2A 2YHNA 1KFUL 5J94A 2YJ9A 3B79A 1KHQA 2Y6EA 4PPEA 2NQGA 5C13A 2JQGR 2NQIA 4XI1A 3RPGC 4LADB 5FPWA 2AUXA 1PCIA 5B77A 1WEUA 1XWHA 2LXPC 1ITOA 3RTRB 2VFCA 3M63A 1KHPA 4FO9A 1NL6A 2Y43A 1KFXL 2VPEA 2FUIA 1EF7A 2AIMA 2HXZA 1BP4A 4AXMA 1Q6KA 2VJEB 4OELA 2YYRA 4BQVA 3PDFA 4RY2A 4DMYA 3H7DA 3KQIA 4O64A 4TKPB 1PBHA 4BGFA 2F6NA 4GNDA 3IMAA 2Y1MA 3HCUA 1FBVA 2YQMA 4AVXA 5G04B 4CA1A 5EYAF 1MM2A 1ATKA 4XR7A 3AI8A 4Q6FA 1WEEA 1JOCA 4YYVA 4V3KC 4AXLA 5B75A 4R8PK 1X9YA 3USVA 1VD4A 2VP7A 2XB1A 3M62A 3DF0A 5CVNB 3E1ZB 2IBIA 3N9PA 2XEUA 5EGWA 1ICFA 4BPVA 2QICA 1N87A 3U5PA 2CSYA 4I7CA 1EWLA 2R6NA 2WBFX 2RSDA 2G43A 3H6SA 2GHUA 4PP2E 2E6SA 2PNSA 2NQAA 4YYRA 1K2FA 4YBTA 4P6EA 1WEPA 2L75A 3C6WA 4GNEA 2MA6A 1VJVA 2B1NA 1WIMA 4YYUA 5B76A 1U9WA 1JM7A 3N9OA 2YU4A 5TABA 2M85A 5TDWA 1WEWA 2MUMA 3KNVA 4FIPA 1JQPA 4I7DA 4X6JA 9PAPA 1CJLA 2E6RA 2ATOA 3U5MA 2DC9A 5G05B 2P0RA 3GL6A 4W4UA 2VPDA 3GV4A 4AUQB 2DC6A 2LGVA 2OXQC 4WZ0A 5CHVA 2K17A 5FEYA 2VPGA 1THEA 2G8EA 3KWBX 2ECJA 5FB1A 3I2DA 1CTEA 2DX8A 2K16A 2M3HA 5DINA 2HHNA 4CDFB 2IPPB 4R7EA 1CPJA 5LKXA 3QSDA 4Q8GA 2E02A 1CHCA 5JG6A 3GCBA 4YBMA 2DC8A 2MNZA 1CQDA 4BHWA 2R9OA 3CBJA 3ERVA 1YVBA 3KX1A 4YABA 1M6DA 4MZOA 2AS8A 2YURA 4L7XA 1STFE 2ECWA 2ECVA 4I04A 3U5OA 1WEOA 2JRJA 2I50A 1EWMA 2DC7A 4WZ3B 3ZPV1 1IYMA 4XUIA 4NV7A 1NPZA 2CB5A 4ZDTA 3CH2X 3T6RA 1YK7A 2G6DA 3K8UA 2YJBA 3SOWA 1CB5A 2VFBA 2YJ2A 1A6RA 5FB0A 2H7JA 3KFQA 4BSQA 3T7LA 1PE6A 1AYUA 3HCSA 1U5IA 2FUDA 2KWKA 3MHHA 4WZ2A 2LGGA 2O6XA 3PW3A 2AYNA 4I05A 2KYUA 2LDRA 1PPNA 1DVPA 2ECGA 3RVWA 2EGPA 1GMYA 2FYEA 4B7YC 2ZETC 1G25A 1WE9A 3H89A 3WXFA 2HDPA 3N9QA 4AYCB 2F7DA 2PUYA 1XKGA 2R9MA 4CDCB 2KWJA 2EODA 4C9ZA 1WGMA 2R9FA 3ZYQA 4OEMA 2YQLA 1Z6UA 3CH3X 1PPOA 3DQVR 1BY8A 4YC9A 2ECTA 5JH3A 4IC2A 2AU1A 2FTDA 4QF3A 5AIUA 3EB6A 4LKAA 4P5OB 3VK6A 1POPA 2KR4A 1X4UA 1MDWA 2BDLA 2XU1A 3HWNA 2CKLB 3O36A 3I06A 4KLBA 3SOXA 2VNFA 4MSXA 1HUCB 4UP5A 1U9QX 5G0FA 3OF9A 2YT5A 4ZUXU 4I07A 1W4TA 2KE1A 1PPDA 2BDZA 5KH3A 2LGKA 1LDKC 2G45A 4HWYA 4N4ZA 1ZBDB 3IV2A 4QF2A 5PADA 4N8WA 5TRBA 4LLBA 4AP4A 1BQIA 2CIOA 5F02A 1CS8A 1LDJB 1K3BB 2ECNA 2KWOA 2L0BA 3LQHA 3IUTA 1PADA 2DCBA 4QRXA 3PURA 7PCKA 2LGLA 5KH9A 2KREA 3SOUA 2KWNA 1PXVA 3HHIA 2C2LA 3P5VA 1AU3A 3QT4A 4ZQLA 4QRVA 1GX3A 1NB3A 4F52B 1CV8A 1SP4B 1F2CA 3KW9A 3DPLR 4YYSA 2EA6A 1MS6A 2C2VS 2QJ0A 4PADA 2OZ2A 2E01A 1BGOA 1FP0A 3V6EA 1QOLA 4QBBA 2HD5A 4C5PA 2YHOA 3OVZA 3ZPVE 1AU4A 2IDAA 2MT5A 1VSNA 2HH5A 2KGGA 1TLOA 3BC3A 4V3LC 5FERA 3NHEA 1CVZA 3FL2A 4YV8A 5B78A 2LN0A 5DKAA 1EWPA 1U9VA 2KIZA 2RI7A 5AITA 1KXRA 2R9CA 4AYCA 4S3OB 1GECE 5A24A 3RVXA 4UI9B 1QXPA 2P86A 2B1MA 4P6GA 2VJEA 2MA5A 3QZVA 2NAAA 5D1LB 3N3GA 3MHSA 1DF0A 1ZCMA 2ACTA 3L11A 3MORA 3OVXA 2OULA 3C9EA 2K4DA 2E00A 1QMYA 5LKTA 5CVMA 4YYQA 4X3GA 3O37A 3L1ZB 4YADA 3ZUAA 1WEMA 2Y1NA 1T1HA 2AVWA 2CKLA 4QRGA 1ME3A 2KFTA 1X4JA 3LFYA 2VHSA 1MHWA 5H1TA 1FH0A 3N4CA 4YBSA 4N79A 2F42A 1Y08A 1F29A 2DZYA 4FJCA 2CT2A 1YT7A 2G6QA 2C0YA 5K16A 3RVVA 4CDDB 3MTNA 2VPBA 1F2BA 2HYED 1AYWA 4NV8A 3ZVZB 3U8EA 2LV9A 3L1XA 5D1KB 2DZZA 1AU0A 2BSZA 5EF4A 3V6CA 2M1RA 2PNXA 2FRQA 3BPMA 2YSJA 1MM3A 2R9NA 3KV6A 3N3KA 2H0DB 3QJ3A 1NB5A 1AECA 2ECIA 4MZSA 3D6SA 3KSEA 3H8BA 3PUQA 4YATA 3BOWA 4GB0A 4LJNA 2F1GA 5TBNA 2UZGA 2MNYA 2MIQA 1YALA 3IOQA 4PP1A 2OP3A 4CZWA 1RMDA 2JMIA 1GLOA 4L58A 4PI3A 4G54A 1JM7B 1AYVA 1TL9A 1E2TA 5H1VA 1O0EA 2K1JA 3S3QA 3F75A 2PREA 4A4BA 3O35A 4A4CA 5CVOB 3BPFA 5JA7A 1S4VA 3N9MA 2VJFB 4N3WA 1MEGA 4B55A 2LXHC 1WESA 3WXGA 3O70A 2XU4A 6PADA 1Z2QA 5B79A 3D9WA 3IHPA 3O7AA 5D1MB 1MEMA 3ZTGA 2LRIC 5I3LA 3IEJA 3BCNA 3I3TA 1VYXA 4W5BA 4DMXA 4BS6A 2LQ6A 4S3OC 1F62A 1F2AA 1W5RA 1W6FA 3V43A 1ME4A 1WENA 4WA6A 5J3XA 4YYWA 3ASLA 3K9MA 3LXSA 1NLJA 2M6MA 2L5UA 3N9LA 3S3RA 3P5XA 2JMDA 2PADA 4CCGX 2G7YA 4BS5A 1GCBA 1CSBB 1HYJA 2Y5BA 3KWZA 1DEUA 3KKUA 3LTWA 2FUUA 4I7BA 3K24A 3LQJA 1NQCA 1PPPA 1E4UA 2AUZA 3O33A 1WEQA 1EWOA 2H0DA 3HD3A 1V87A 3RPGB 1MIRA 2FT2A 2GFOA 1PIPA 8PCHA 1AIMA 2FRAA 4Q8HA 2L80A 4BBQA 1U9XA 3HHAA 3PBHA 2YUCA 3KV5A 4GNGA 1TU6A 2JQFR 3M99A 1WILA 5KH7A 4YAXA 4FK5A 2YJCA 2XU3A 5LKUA 2FQ9A 4MVTA 3P5UA 2P7UA 2KU3A 2MD7B 1WFKA 1SNKA 2G8JA 2DJGB 1YK8A 1X4IA 3F5VA 3OISA 4A0CD 3PNRA 4W5CA 2BAYA 4PTBA 2FO5A 2DCCA 3U5NA 1QDQA 2XU5A 3WXEA 3PHDA 2AYOA 2VHFA 2YJ8A 3CBKA 2YSMA 2VJFA 2MD8C 2KGIA 1Y4HA 5LKZA 1BORA 3TNXA 2QIZA 4A49A 5H1UA 4X6IA 3H8CA 4YVAA 4B86C 3O0UA 4X6HA 2E03A 3LQIA 4UP0A 3O1GA 2YW8A 1ZIVA 3NG2A 5TDRA 3SHBA 1Z60A 4IC3A 2DJFB 4LK9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F6J A;  2NQD B;  4R2Y A;  3P5W A;  2L43 A;  5C11 A;  2FSA A;  2JMJ A;  3EB5 A;  5CHT A;  2ARY A;  5H9M A;  3ZVY A;  2DCD A;  3HCT A;  5B8D A;  2AN6 A;  3ZNI A;  3N9N A;  3C5K A;  3HTK C;  1IWD A;  4K7C A;  4CDE B;  2CSZ A;  2PBH A;  1WEV A;  2DCA A;  3OF8 A;  5LCW B;  4NN2 A;  3BWK A;  1U6G B;  4N4F A;  2D8S A;  4QH6 A;  3O34 A;  4GNF A;  1HYI A;  2YRE A;  1VFY A;  3LRQ A;  1AU2 A;  2YHN A;  1KFU L;  5J94 A;  2YJ9 A;  3B79 A;  1KHQ A;  2Y6E A;  4PPE A;  2NQG A;  5C13 A;  2JQG R;  2NQI A;  4XI1 A;  3RPG C;  4LAD B;  5FPW A;  2AUX A;  1PCI A;  5B77 A;  1WEU A;  1XWH A;  2LXP C;  1ITO A;  3RTR B;  3M63 A;  1KHP A;  4FO9 A;  1NL6 A;  2Y43 A;  1KFX L;  2VPE A;  2FUI A;  1EF7 A;  2AIM A;  2HXZ A;  1BP4 A;  4AXM A;  1Q6K A;  2VJE B;  4OEL A;  2YYR A;  4BQV A;  3PDF A;  4RY2 A;  4DMY A;  3H7D A;  3KQI A;  4O64 A;  4TKP B;  1PBH A;  2F6N A;  4GND A;  3IMA A;  2Y1M A;  3HCU A;  1FBV A;  2YQM A;  4AVX A;  5G04 B;  4CA1 A;  5EYA F;  1MM2 A;  1ATK A;  4XR7 A;  3AI8 A;  4Q6F A;  1WEE A;  1JOC A;  4YYV A;  4V3K C;  4AXL A;  5B75 A;  4R8P K;  1X9Y A;  3USV A;  1VD4 A;  2VP7 A;  2XB1 A;  3M62 A;  3DF0 A;  5CVN B;  3E1Z B;  2IBI A;  3N9P A;  2XEU A;  5EGW A;  1ICF A;  4BPV A;  2QIC A;  1N87 A;  3U5P A;  2CSY A;  4I7C A;  1EWL A;  2R6N A;  2WBF X;  2RSD A;  2G43 A;  3H6S A;  2GHU A;  4PP2 E;  2E6S A;  2PNS A;  2NQA A;  4YYR A;  1K2F A;  4YBT A;  4P6E A;  1WEP A;  2L75 A;  3C6W A;  4GNE A;  2MA6 A;  1VJV A;  2B1N A;  1WIM A;  4YYU A;  5B76 A;  1U9W A;  1JM7 A;  3N9O A;  2YU4 A;  5TAB A;  2M85 A;  5TDW A;  1WEW A;  2MUM A;  3KNV A;  4FIP A;  1JQP A;  4I7D A;  4X6J A;  9PAP A;  1CJL A;  2E6R A;  2ATO A;  3U5M A;  2DC9 A;  5G05 B;  2P0R A;  3GL6 A;  4W4U A;  2VPD A;  3GV4 A;  4AUQ B;  2DC6 A;  2LGV A;  2OXQ C;  4WZ0 A;  5CHV A;  2K17 A;  5FEY A;  2VPG A;  1THE A;  2G8E A;  3KWB X;  2ECJ A;  5FB1 A;  3I2D A;  1CTE A;  2DX8 A;  2K16 A;  2M3H A;  5DIN A;  2HHN A;  4CDF B;  2IPP B;  4R7E A;  1CPJ A;  5LKX A;  3QSD A;  4Q8G A;  2E02 A;  1CHC A;  5JG6 A;  3GCB A;  4YBM A;  2DC8 A;  2MNZ A;  1CQD A;  4BHW A;  2R9O A;  3CBJ A;  3ERV A;  1YVB A;  3KX1 A;  4YAB A;  1M6D A;  4MZO A;  2AS8 A;  2YUR A;  4L7X A;  1STF E;  2ECW A;  2ECV A;  4I04 A;  3U5O A;  1WEO A;  2JRJ A;  2I50 A;  1EWM A;  2DC7 A;  4WZ3 B;  3ZPV 1;  1IYM A;  4XUI A;  1NPZ A;  2CB5 A;  4ZDT A;  3CH2 X;  3T6R A;  1YK7 A;  2G6D A;  3K8U A;  2YJB A;  3SOW A;  1CB5 A;  2YJ2 A;  1A6R A;  5FB0 A;  2H7J A;  3KFQ A;  4BSQ A;  3T7L A;  1PE6 A;  1AYU A;  3HCS A;  1U5I A;  2FUD A;  2KWK A;  3MHH A;  4WZ2 A;  2LGG A;  2O6X A;  3PW3 A;  2AYN A;  4I05 A;  2KYU A;  2LDR A;  1PPN A;  1DVP A;  2ECG A;  3RVW A;  2EGP A;  1GMY A;  2FYE A;  4B7Y C;  2ZET C;  1G25 A;  1WE9 A;  3H89 A;  3WXF A;  2HDP A;  3N9Q A;  4AYC B;  2F7D A;  2PUY A;  1XKG A;  2R9M A;  4CDC B;  2KWJ A;  2EOD A;  4C9Z A;  1WGM A;  2R9F A;  3ZYQ A;  4OEM A;  2YQL A;  1Z6U A;  3CH3 X;  1PPO A;  3DQV R;  1BY8 A;  4YC9 A;  2ECT A;  5JH3 A;  4IC2 A;  2AU1 A;  2FTD A;  4QF3 A;  5AIU A;  3EB6 A;  4LKA A;  4P5O B;  3VK6 A;  1POP A;  2KR4 A;  1X4U A;  1MDW A;  2BDL A;  2XU1 A;  3HWN A;  2CKL B;  3O36 A;  3I06 A;  4KLB A;  3SOX A;  2VNF A;  4MSX A;  1HUC B;  4UP5 A;  1U9Q X;  5G0F A;  3OF9 A;  2YT5 A;  4ZUX U;  4I07 A;  2KE1 A;  1PPD A;  2BDZ A;  5KH3 A;  2LGK A;  1LDK C;  2G45 A;  4HWY A;  4N4Z A;  1ZBD B;  3IV2 A;  4QF2 A;  5PAD A;  4N8W A;  5TRB A;  4LLB A;  4AP4 A;  1BQI A;  2CIO A;  5F02 A;  1CS8 A;  1LDJ B;  1K3B B;  2ECN A;  2KWO A;  2L0B A;  3LQH A;  3IUT A;  1PAD A;  2DCB A;  4QRX A;  3PUR A;  7PCK A;  2LGL A;  5KH9 A;  2KRE A;  3SOU A;  2KWN A;  1PXV A;  3HHI A;  2C2L A;  3P5V A;  1AU3 A;  3QT4 A;  4ZQL A;  4QRV A;  1NB3 A;  4F52 B;  1CV8 A;  1SP4 B;  1F2C A;  3KW9 A;  3DPL R;  4YYS A;  2EA6 A;  1MS6 A;  2C2V S;  2QJ0 A;  4PAD A;  2OZ2 A;  2E01 A;  1BGO A;  1FP0 A;  3V6E A;  1QOL A;  4QBB A;  2HD5 A;  2YHO A;  3OVZ A;  3ZPV E;  1AU4 A;  2IDA A;  2MT5 A;  1VSN A;  2HH5 A;  2KGG A;  1TLO A;  3BC3 A;  4V3L C;  5FER A;  3NHE A;  1CVZ A;  3FL2 A;  4YV8 A;  5B78 A;  2LN0 A;  5DKA A;  1EWP A;  1U9V A;  2KIZ A;  2RI7 A;  5AIT A;  1KXR A;  2R9C A;  4AYC A;  4S3O B;  1GEC E;  5A24 A;  3RVX A;  4UI9 B;  1QXP A;  2P86 A;  2B1M A;  4P6G A;  2VJE A;  2MA5 A;  3QZV A;  2NAA A;  5D1L B;  3N3G A;  3MHS A;  1DF0 A;  1ZCM A;  2ACT A;  3L11 A;  3MOR A;  3OVX A;  2OUL A;  3C9E A;  2K4D A;  2E00 A;  1QMY A;  5LKT A;  5CVM A;  4YYQ A;  4X3G A;  3O37 A;  3L1Z B;  4YAD A;  3ZUA A;  1WEM A;  2Y1N A;  1T1H A;  2AVW A;  2CKL A;  4QRG A;  1ME3 A;  2KFT A;  1X4J A;  3LFY A;  2VHS A;  1MHW A;  5H1T A;  1FH0 A;  3N4C A;  4YBS A;  4N79 A;  2F42 A;  1Y08 A;  1F29 A;  2DZY A;  4FJC A;  2CT2 A;  1YT7 A;  2G6Q A;  2C0Y A;  5K16 A;  3RVV A;  4CDD B;  3MTN A;  2VPB A;  1F2B A;  2HYE D;  1AYW A;  3ZVZ B;  3U8E A;  2LV9 A;  3L1X A;  5D1K B;  2DZZ A;  1AU0 A;  3V6C A;  5EF4 A;  2M1R A;  2PNX A;  2FRQ A;  3BPM A;  2YSJ A;  1MM3 A;  2R9N A;  3KV6 A;  3N3K A;  2H0D B;  3QJ3 A;  1NB5 A;  1AEC A;  2ECI A;  4MZS A;  3D6S A;  3KSE A;  3H8B A;  3PUQ A;  4YAT A;  3BOW A;  4GB0 A;  4LJN A;  2F1G A;  5TBN A;  2UZG A;  2MNY A;  2MIQ A;  1YAL A;  3IOQ A;  4PP1 A;  2OP3 A;  4CZW A;  1RMD A;  2JMI A;  1GLO A;  4L58 A;  4PI3 A;  4G54 A;  1JM7 B;  1AYV A;  1TL9 A;  5H1V A;  1O0E A;  2K1J A;  3S3Q A;  3F75 A;  2PRE A;  4A4B A;  3O35 A;  4A4C A;  5CVO B;  3BPF A;  5JA7 A;  1S4V A;  3N9M A;  2VJF B;  4N3W A;  1MEG A;  2LXH C;  1WES A;  3WXG A;  3O70 A;  2XU4 A;  6PAD A;  1Z2Q A;  5B79 A;  3IHP A;  3O7A A;  5D1M B;  1MEM A;  3ZTG A;  2LRI C;  5I3L A;  3IEJ A;  3BCN A;  3I3T A;  1VYX A;  4W5B A;  4DMX A;  4BS6 A;  2LQ6 A;  4S3O C;  1F62 A;  1F2A A;  3V43 A;  1ME4 A;  1WEN A;  4WA6 A;  5J3X A;  4YYW A;  3ASL A;  3K9M A;  3LXS A;  1NLJ A;  2M6M A;  2L5U A;  3N9L A;  3S3R A;  3P5X A;  2JMD A;  2PAD A;  4CCG X;  2G7Y A;  4BS5 A;  1GCB A;  1CSB B;  1HYJ A;  2Y5B A;  3KWZ A;  1DEU A;  3KKU A;  2FUU A;  4I7B A;  3K24 A;  3LQJ A;  1NQC A;  1PPP A;  1E4U A;  2AUZ A;  3O33 A;  1WEQ A;  1EWO A;  2H0D A;  3HD3 A;  1V87 A;  3RPG B;  1MIR A;  2FT2 A;  2GFO A;  1PIP A;  8PCH A;  1AIM A;  2FRA A;  4Q8H A;  2L80 A;  4BBQ A;  1U9X A;  3HHA A;  3PBH A;  2YUC A;  3KV5 A;  4GNG A;  1TU6 A;  2JQF R;  3M99 A;  1WIL A;  5KH7 A;  4YAX A;  4FK5 A;  2YJC A;  2XU3 A;  5LKU A;  2FQ9 A;  4MVT A;  3P5U A;  2P7U A;  2KU3 A;  2MD7 B;  1WFK A;  1SNK A;  2G8J A;  2DJG B;  1YK8 A;  1X4I A;  3F5V A;  3OIS A;  4A0C D;  3PNR A;  4W5C A;  2BAY A;  4PTB A;  2FO5 A;  2DCC A;  3U5N A;  1QDQ A;  2XU5 A;  3WXE A;  3PHD A;  2AYO A;  2VHF A;  2YJ8 A;  3CBK A;  2YSM A;  2VJF A;  2MD8 C;  2KGI A;  1Y4H A;  5LKZ A;  1BOR A;  3TNX A;  2QIZ A;  4A49 A;  5H1U A;  4X6I A;  3H8C A;  4YVA A;  4B86 C;  3O0U A;  4X6H A;  2E03 A;  3LQI A;  4UP0 A;  3O1G A;  2YW8 A;  1ZIV A;  3NG2 A;  5TDR A;  3SHB A;  1Z60 A;  4IC3 A;  2DJF B;  4LK9 A; 
#chains in the Genus database with same CATH topology
 2F6J A;  2NQD B;  4R2Y A;  3O65 A;  3P5W A;  2L43 A;  3FAO A;  5C11 A;  2FSA A;  2JMJ A;  4M0W A;  3EB5 A;  3LJU X;  5CHT A;  2ARY A;  5H9M A;  3ZVY A;  2DCD A;  3HCT A;  5B8D A;  2AN6 A;  4OW0 A;  3ZNI A;  3N9N A;  3C5K A;  3HTK C;  1IWD A;  3LVR E;  4K7C A;  4CDE B;  2CSZ A;  2PBH A;  1WEV A;  2DCA A;  3OF8 A;  5LCW B;  2HWK A;  4NN2 A;  3BWK A;  1U6G B;  4N4F A;  2D8S A;  4QH6 A;  3O34 A;  4GNF A;  1HYI A;  2YRE A;  1VFY A;  3LRQ A;  1AU2 A;  2YHN A;  1KFU L;  3DWD A;  5J94 A;  2YJ9 A;  3LDY A;  3B79 A;  1KHQ A;  2JUN A;  2Y6E A;  4RNA A;  4PPE A;  2NQG A;  5C13 A;  2JQG R;  2NQI A;  4XI1 A;  3RPG C;  4LAD B;  5FPW A;  2AUX A;  1PCI A;  5B77 A;  1WEU A;  1XWH A;  2LXP C;  1ITO A;  3OQC A;  4XZX A;  3RTR B;  3M63 A;  3H7H A;  1KHP A;  4FO9 A;  1NL6 A;  2Y43 A;  1KFX L;  2VPE A;  2FUI A;  1EF7 A;  2AIM A;  2HXZ A;  1BP4 A;  2CSV A;  4AXM A;  1Q6K A;  2VJE B;  4OEL A;  4D8E A;  2YYR A;  4BQV A;  3PDF A;  4RY2 A;  4DMY A;  3H7D A;  1UKF A;  3KQI A;  4O64 A;  4TKP B;  1PBH A;  2F6N A;  4GND A;  3IMA A;  2Y1M A;  3HCU A;  1FBV A;  2YQM A;  4AVX A;  5G04 B;  4CA1 A;  5EYA F;  5SVI B;  1MM2 A;  1ATK A;  3W31 A;  4BOS A;  3MP2 A;  4XR7 A;  3AI8 A;  4Q6F A;  2J7Q A;  1WEE A;  1JOC A;  4YYV A;  2EXU A;  4V3K C;  5B75 A;  4R8P K;  4AXL A;  1X9Y A;  3USV A;  1VD4 A;  2VP7 A;  2XB1 A;  3M62 A;  3DF0 A;  5EZS A;  5CVN B;  3E1Z B;  2IBI A;  3N9P A;  2Z84 A;  2XEU A;  2JRI A;  5EGW A;  1ICF A;  4BPV A;  2QIC A;  1N87 A;  3U5P A;  2CSY A;  4I7C A;  1EWL A;  2R6N A;  2WBF X;  2RSD A;  2J7Q C;  2G43 A;  3H6S A;  2GHU A;  3PHU A;  4PP2 E;  2E6S A;  2PNS A;  2NQA A;  4YYR A;  1K2F A;  4YBT A;  4P6E A;  4P16 A;  1WEP A;  2L75 A;  2L7P A;  1YZB A;  2FFW A;  3C6W A;  4GNE A;  4BOQ A;  2MA6 A;  1VJV A;  2B1N A;  1WIM A;  4YYU A;  3SUB A;  5B76 A;  1U9W A;  1JM7 A;  3N9O A;  2YU4 A;  2M85 A;  2RR4 A;  1WEW A;  2MUM A;  3KNV A;  5TAB A;  4FIP A;  5TDW A;  1JQP A;  4I7D A;  3JUE A;  2CRW A;  3T9K A;  4X6J A;  2BU3 A;  1CJL A;  2E6R A;  2ATO A;  9PAP A;  3U5M A;  2DC9 A;  5G05 B;  2P0R A;  3GL6 A;  4W4U A;  4REZ A;  4BOU A;  2M13 A;  2VPD A;  4D8B A;  3GV4 A;  4AUQ B;  2DC6 A;  2LGV A;  2OXQ C;  4WZ0 A;  5CHV A;  2K17 A;  5FEY A;  2VPG A;  1THE A;  2G8E A;  2UZJ A;  3KWB X;  2ECJ A;  5FB1 A;  3I2D A;  1CTE A;  2DSM A;  2DX8 A;  2K16 A;  2M3H A;  5DIN A;  2HHN A;  4CDF B;  2IPP B;  2OWA A;  5E6J A;  4R7E A;  3TMP A;  1CPJ A;  5LKX A;  3QSD A;  4Q8G A;  2E02 A;  1CHC A;  5JG6 A;  3GCB A;  4YBM A;  2DC8 A;  2MNZ A;  1CQD A;  4BHW A;  3Q1D A;  5SVI A;  2R9O A;  3CBJ A;  3ERV A;  1YVB A;  3KX1 A;  4YAB A;  2FD4 A;  3MJ5 A;  1M6D A;  4MZO A;  2AS8 A;  2YUR A;  4L7X A;  1STF E;  2ECW A;  2ECV A;  2JTC A;  3U5O A;  1WEO A;  2JRJ A;  2I50 A;  1EWM A;  2DC7 A;  4I04 A;  4WZ3 B;  3ZPV 1;  1IYM A;  4XUI A;  1NPZ A;  2CB5 A;  4ZDT A;  4RF0 A;  3CH2 X;  2XOY A;  3T6R A;  1YK7 A;  2G6D A;  4IUM A;  3K8U A;  2YJB A;  3SOW A;  3KDE C;  1CB5 A;  2B0O E;  2KKY A;  2YJ2 A;  1A6R A;  5FB0 A;  2H7J A;  3RNV A;  3KFQ A;  4BSQ A;  4Z0O A;  3T7L A;  1PE6 A;  1AYU A;  3HCS A;  1U5I A;  4OGC A;  2FUD A;  2KWK A;  3MHH A;  4WZ2 A;  2LGG A;  2O6X A;  3PW3 A;  2AYN A;  4I05 A;  2KYU A;  2LDR A;  1PPN A;  1DVP A;  4ZTB A;  2ECG A;  3RVW A;  2EGP A;  2DOS A;  2EGM A;  1GMY A;  2FYE A;  3PHW A;  4B7Y C;  2ZET C;  1G25 A;  1WE9 A;  3H89 A;  3WXF A;  2HDP A;  3N9Q A;  4AYC B;  2F7D A;  2PUY A;  1XKG A;  2R9M A;  3TRK A;  4CDC B;  5K3Q A;  3FEH A;  2KWJ A;  2EOD A;  4C9Z A;  1WGM A;  3FAN A;  2R9F A;  3ZYQ A;  4OEM A;  2YQL A;  1Z6U A;  3CH3 X;  1PPO A;  3PT2 A;  3DQV R;  4Z0R A;  2XOC A;  1BY8 A;  4YC9 A;  2ECT A;  5JH3 A;  4IC2 A;  2AU1 A;  2FTD A;  4QF3 A;  5AIU A;  3EB6 A;  4LKA A;  4P5O B;  3VK6 A;  1POP A;  2KR4 A;  1X4U A;  2YVR A;  1MDW A;  2BDL A;  2XU1 A;  2CKL B;  3O36 A;  3HWN A;  3I06 A;  4KLB A;  4OVZ B;  3SOX A;  2VNF A;  4MSX A;  1HUC B;  4UP5 A;  1U9Q X;  5G0F A;  3OF9 A;  2YT5 A;  4ZUX U;  4I07 A;  2KE1 A;  1PPD A;  2BDZ A;  5KH3 A;  2LGK A;  1LDK C;  2G45 A;  4HWY A;  4N4Z A;  1ZBD B;  3IV2 A;  4QF2 A;  5PAD A;  4N8W A;  5TRB A;  4LLB A;  4AP4 A;  1BQI A;  2CIO A;  5F02 A;  1CS8 A;  1LDJ B;  5SVX A;  1K3B B;  2ECN A;  2KWO A;  2L0B A;  3LQH A;  3IUT A;  1DCQ A;  1PAD A;  2DCB A;  3PUR A;  4QRX A;  2LGL A;  5KH9 A;  2KRE A;  7PCK A;  3SOU A;  2KWN A;  1PXV A;  3HHI A;  2C2L A;  3P5V A;  1AU3 A;  3QT4 A;  4ZQL A;  4QRV A;  1NB3 A;  4F52 B;  1CV8 A;  1SP4 B;  1F2C A;  3KW9 A;  3DPL R;  4YYS A;  2EA6 A;  1MS6 A;  2C2V S;  2QJ0 A;  4PAD A;  4F1P A;  2OZ2 A;  2E01 A;  1BGO A;  1FP0 A;  3V6E A;  3MDB C;  1QOL A;  4MI7 A;  4QBB A;  2HD5 A;  2YHO A;  3OVZ A;  3ZPV E;  1AU4 A;  2IDA A;  2XOZ A;  5KO3 A;  2MT5 A;  1VSN A;  2BTW B;  2HH5 A;  2KGG A;  2FE8 A;  1TLO A;  3BC3 A;  4V3L C;  5FER A;  3O47 A;  3NHE A;  1CVZ A;  3FL2 A;  4YV8 A;  5B78 A;  2LN0 A;  5DKA A;  1EWP A;  1U9V A;  2KIZ A;  2RI7 A;  5AIT A;  1KXR A;  2R9C A;  4AYC A;  4S3O B;  1GEC E;  5A24 A;  3RVX A;  4UI9 B;  1QXP A;  4WUR A;  2P86 A;  3BBA A;  2B1M A;  4P6G A;  4H9D A;  2VJE A;  3BY4 A;  2MA5 A;  3QZV A;  2NAA A;  5D1L B;  3N3G A;  3MHS A;  1DF0 A;  1ZCM A;  2ACT A;  3L11 A;  3MOR A;  3OVX A;  3W30 A;  2CON A;  2OUL A;  3C9E A;  2K4D A;  1DKI A;  1QMY A;  2E00 A;  5LKT A;  5CVM A;  4YYQ A;  4X3G A;  3O37 A;  3BB7 A;  3L1Z B;  4YAD A;  3ZUA A;  1WEM A;  2Y1N A;  1T1H A;  2AVW A;  4OVZ A;  2CKL A;  4QRG A;  1ME3 A;  2KFT A;  1X4J A;  3PRM A;  3LFY A;  4PT5 A;  2VHS A;  1MHW A;  5H1T A;  1FH0 A;  3N4C A;  4YBS A;  4N79 A;  2AGA A;  2F42 A;  1Y08 A;  1F29 A;  2DZY A;  4FJC A;  1MBM A;  2CT2 A;  1YT7 A;  2G6Q A;  2C0Y A;  5K16 A;  3RVV A;  4CDD B;  3MTN A;  2VPB A;  1F2B A;  2HYE D;  1AYW A;  3M7K A;  3ZNH A;  3ZVZ B;  3U8E A;  2LV9 A;  3L1X A;  5D1K B;  2DZZ A;  1AU0 A;  3V6C A;  5EF4 A;  2M1R A;  2PNX A;  2FRQ A;  3BPM A;  1PVJ A;  2YSJ A;  1MM3 A;  3E2D A;  3KV6 A;  2R9N A;  2H0D B;  3N3K A;  3QJ3 A;  1AEC A;  1NB5 A;  2ECI A;  4MZS A;  3D6S A;  3KSE A;  2JM3 A;  3H8B A;  4GUA A;  3PUQ A;  4YAT A;  3BOW A;  3MTV A;  4RKX A;  4GB0 A;  4LJN A;  2F1G A;  5TBN A;  2UZG A;  2MNY A;  2MIQ A;  2XP0 A;  1YAL A;  3IOQ A;  4PP1 A;  3B21 A;  2LAU A;  2OP3 A;  4MM3 B;  1RMD A;  4CZW A;  2JMI A;  4IP3 A;  1GLO A;  4L58 A;  4PI3 A;  4G54 A;  1JM7 B;  1AYV A;  1TL9 A;  2BTW A;  4BOP A;  5H1V A;  1O0E A;  2E61 A;  2K1J A;  3S3Q A;  4BOZ A;  4QQ4 A;  3F75 A;  2PRE A;  4A4B A;  3O35 A;  4A4C A;  5CVO B;  3BPF A;  5JA7 A;  4OGE A;  1S4V A;  3N9M A;  2VJF B;  4N3W A;  1MEG A;  2LXH C;  1WES A;  3WXG A;  3O70 A;  2XU4 A;  6PAD A;  1Z2Q A;  5B79 A;  5JZE A;  3IHP A;  3O7A A;  5D1M B;  1MEM A;  3ZTG A;  2DJA A;  2LRI C;  5I3L A;  3IEJ A;  3BCN A;  3I3T A;  1VYX A;  4W5B A;  4DMX A;  4BS6 A;  2LQ6 A;  4S3O C;  1F62 A;  1F2A A;  3V43 A;  1ME4 A;  1WEN A;  4WA6 A;  5J3X A;  4YYW A;  3ASL A;  3K9M A;  3LXS A;  1NLJ A;  2M6M A;  2L5U A;  3N9L A;  3S3R A;  3P5X A;  2JMD A;  2PAD A;  4D8I A;  4CCG X;  2G7Y A;  2IQJ A;  3E9S A;  4BS5 A;  1GCB A;  1CSB B;  1HYJ A;  2Y5B A;  3KWZ A;  1DEU A;  3C0R A;  3KKU A;  2FUU A;  4I7B A;  3K24 A;  3LQJ A;  1NQC A;  4HXD B;  3IFU A;  1PPP A;  1E4U A;  3PLW A;  2AUZ A;  3O33 A;  4A5U A;  1WEQ A;  3DDT A;  1EWO A;  2H0D A;  3HD3 A;  1V87 A;  3RPG B;  1MIR A;  2FT2 A;  2GFO A;  1PIP A;  4RF1 A;  8PCH A;  2KKX A;  1AIM A;  2FRA A;  4Q8H A;  2L80 A;  4BBQ A;  1U9X A;  3HHA A;  3PBH A;  2YUC A;  3KV5 A;  4GNG A;  4R3D A;  1TU6 A;  2JQF R;  3M99 A;  1WIL A;  5KH7 A;  4YAX A;  4FK5 A;  2YJC A;  3PSE A;  2XU3 A;  5LKU A;  2FQ9 A;  4MVT A;  3P5U A;  2P7U A;  2KU3 A;  2MD7 B;  1WFK A;  1SNK A;  2G8J A;  2DJG B;  1YK8 A;  1X4I A;  3F5V A;  5SVY A;  4A0C D;  2CRR A;  3OIS A;  3PNR A;  4W5C A;  2BAY A;  4PTB A;  2FO5 A;  2DCC A;  3U5N A;  1QDQ A;  2XU5 A;  3WXE A;  3PHD A;  5EZQ A;  4O62 A;  2AYO A;  2VHF A;  3FJU B;  2YJ8 A;  3CBK A;  2YSM A;  2VJF A;  2MD8 C;  3PHX A;  2KGI A;  1Y4H A;  5LKZ A;  1BOR A;  3LVQ E;  3TNX A;  2QIZ A;  4A49 A;  5H1U A;  4X6I A;  3H8C A;  4YVA A;  4B86 C;  2D8U A;  3O0U A;  4X6H A;  2E03 A;  2MKE A;  3LQI A;  4UP0 A;  3O1G A;  2YW8 A;  3PRP A;  1ZIV A;  3FM8 C;  3NG2 A;  5TDR A;  3SHB A;  1Z60 A;  4IC3 A;  2P57 A;  2DJF B;  4LK9 A; 
#chains in the Genus database with same CATH homology
 2F6J A;  2NQD B;  4R2Y A;  3P5W A;  2L43 A;  5C11 A;  2FSA A;  2JMJ A;  3EB5 A;  5CHT A;  2ARY A;  5H9M A;  3ZVY A;  2DCD A;  3HCT A;  5B8D A;  2AN6 A;  3ZNI A;  3N9N A;  3C5K A;  3HTK C;  1IWD A;  4K7C A;  4CDE B;  2CSZ A;  2PBH A;  1WEV A;  4GUZ A;  2DCA A;  3OF8 A;  5LCW B;  4NN2 A;  3BWK A;  1U6G B;  4N4F A;  2D8S A;  4QH6 A;  3O34 A;  4GNF A;  1HYI A;  2YRE A;  1VFY A;  3LRQ A;  1AU2 A;  2YHN A;  1KFU L;  5J94 A;  2YJ9 A;  3B79 A;  1KHQ A;  2Y6E A;  4PPE A;  2NQG A;  5C13 A;  2JQG R;  2NQI A;  4XI1 A;  3RPG C;  4LAD B;  5FPW A;  2AUX A;  1PCI A;  5B77 A;  1WEU A;  1XWH A;  2LXP C;  1ITO A;  3RTR B;  2VFC A;  3M63 A;  1KHP A;  4FO9 A;  1NL6 A;  2Y43 A;  1KFX L;  2VPE A;  2FUI A;  1EF7 A;  2AIM A;  2HXZ A;  1BP4 A;  4AXM A;  1Q6K A;  2VJE B;  4OEL A;  2YYR A;  4BQV A;  3PDF A;  4RY2 A;  4DMY A;  3H7D A;  3KQI A;  4O64 A;  4TKP B;  1PBH A;  4BGF A;  2F6N A;  4GND A;  3IMA A;  2Y1M A;  3HCU A;  1FBV A;  2YQM A;  4AVX A;  5G04 B;  4CA1 A;  5EYA F;  1MM2 A;  1ATK A;  4XR7 A;  3AI8 A;  4Q6F A;  1WEE A;  1JOC A;  4YYV A;  4V3K C;  4AXL A;  5B75 A;  4R8P K;  1X9Y A;  3USV A;  1VD4 A;  2VP7 A;  2XB1 A;  3M62 A;  3DF0 A;  5CVN B;  3E1Z B;  2IBI A;  3N9P A;  2XEU A;  5EGW A;  1ICF A;  4BPV A;  2QIC A;  1N87 A;  3U5P A;  2CSY A;  4I7C A;  1EWL A;  2R6N A;  2WBF X;  2RSD A;  2G43 A;  3H6S A;  2GHU A;  4PP2 E;  2E6S A;  2PNS A;  2NQA A;  4YYR A;  1K2F A;  4YBT A;  4P6E A;  1WEP A;  2L75 A;  3C6W A;  4GNE A;  2MA6 A;  1VJV A;  2B1N A;  1WIM A;  4YYU A;  5B76 A;  1U9W A;  1JM7 A;  3N9O A;  2YU4 A;  5TAB A;  2M85 A;  5TDW A;  1WEW A;  2MUM A;  3KNV A;  4FIP A;  1JQP A;  4I7D A;  4X6J A;  9PAP A;  1CJL A;  2E6R A;  2ATO A;  3U5M A;  2DC9 A;  5G05 B;  2P0R A;  3GL6 A;  4W4U A;  2VPD A;  3GV4 A;  4AUQ B;  2DC6 A;  2LGV A;  2OXQ C;  4WZ0 A;  5CHV A;  2K17 A;  5FEY A;  2VPG A;  1THE A;  2G8E A;  3KWB X;  2ECJ A;  5FB1 A;  3I2D A;  1CTE A;  2DX8 A;  2K16 A;  2M3H A;  5DIN A;  2HHN A;  4CDF B;  2IPP B;  4R7E A;  1CPJ A;  5LKX A;  3QSD A;  4Q8G A;  2E02 A;  1CHC A;  5JG6 A;  3GCB A;  4YBM A;  2DC8 A;  2MNZ A;  1CQD A;  4BHW A;  2R9O A;  3CBJ A;  3ERV A;  1YVB A;  3KX1 A;  4YAB A;  1M6D A;  4MZO A;  2AS8 A;  2YUR A;  4L7X A;  1STF E;  2ECW A;  2ECV A;  4I04 A;  3U5O A;  1WEO A;  2JRJ A;  2I50 A;  1EWM A;  2DC7 A;  4WZ3 B;  3ZPV 1;  1IYM A;  4XUI A;  4NV7 A;  1NPZ A;  2CB5 A;  4ZDT A;  3CH2 X;  3T6R A;  1YK7 A;  2G6D A;  3K8U A;  2YJB A;  3SOW A;  1CB5 A;  2VFB A;  2YJ2 A;  1A6R A;  5FB0 A;  2H7J A;  3KFQ A;  4BSQ A;  3T7L A;  1PE6 A;  1AYU A;  3HCS A;  1U5I A;  2FUD A;  2KWK A;  3MHH A;  4WZ2 A;  2LGG A;  2O6X A;  3PW3 A;  2AYN A;  4I05 A;  2KYU A;  2LDR A;  1PPN A;  1DVP A;  2ECG A;  3RVW A;  2EGP A;  1GMY A;  2FYE A;  4B7Y C;  2ZET C;  1G25 A;  1WE9 A;  3H89 A;  3WXF A;  2HDP A;  3N9Q A;  4AYC B;  2F7D A;  2PUY A;  1XKG A;  2R9M A;  4CDC B;  2KWJ A;  2EOD A;  4C9Z A;  1WGM A;  2R9F A;  3ZYQ A;  4OEM A;  2YQL A;  1Z6U A;  3CH3 X;  1PPO A;  3DQV R;  1BY8 A;  4YC9 A;  2ECT A;  5JH3 A;  4IC2 A;  2AU1 A;  2FTD A;  4QF3 A;  5AIU A;  3EB6 A;  4LKA A;  4P5O B;  3VK6 A;  1POP A;  2KR4 A;  1X4U A;  1MDW A;  2BDL A;  2XU1 A;  3HWN A;  2CKL B;  3O36 A;  3I06 A;  4KLB A;  3SOX A;  2VNF A;  4MSX A;  1HUC B;  4UP5 A;  1U9Q X;  5G0F A;  3OF9 A;  2YT5 A;  4ZUX U;  4I07 A;  1W4T A;  2KE1 A;  1PPD A;  2BDZ A;  5KH3 A;  2LGK A;  1LDK C;  2G45 A;  4HWY A;  4N4Z A;  1ZBD B;  3IV2 A;  4QF2 A;  5PAD A;  4N8W A;  5TRB A;  4LLB A;  4AP4 A;  1BQI A;  2CIO A;  5F02 A;  1CS8 A;  1LDJ B;  1K3B B;  2ECN A;  2KWO A;  2L0B A;  3LQH A;  3IUT A;  1PAD A;  2DCB A;  4QRX A;  3PUR A;  7PCK A;  2LGL A;  5KH9 A;  2KRE A;  3SOU A;  2KWN A;  1PXV A;  3HHI A;  2C2L A;  3P5V A;  1AU3 A;  3QT4 A;  4ZQL A;  4QRV A;  1GX3 A;  1NB3 A;  4F52 B;  1CV8 A;  1SP4 B;  1F2C A;  3KW9 A;  3DPL R;  4YYS A;  2EA6 A;  1MS6 A;  2C2V S;  2QJ0 A;  4PAD A;  2OZ2 A;  2E01 A;  1BGO A;  1FP0 A;  3V6E A;  1QOL A;  4QBB A;  2HD5 A;  4C5P A;  2YHO A;  3OVZ A;  3ZPV E;  1AU4 A;  2IDA A;  2MT5 A;  1VSN A;  2HH5 A;  2KGG A;  1TLO A;  3BC3 A;  4V3L C;  5FER A;  3NHE A;  1CVZ A;  3FL2 A;  4YV8 A;  5B78 A;  2LN0 A;  5DKA A;  1EWP A;  1U9V A;  2KIZ A;  2RI7 A;  5AIT A;  1KXR A;  2R9C A;  4AYC A;  4S3O B;  1GEC E;  5A24 A;  3RVX A;  4UI9 B;  1QXP A;  2P86 A;  2B1M A;  4P6G A;  2VJE A;  2MA5 A;  3QZV A;  2NAA A;  5D1L B;  3N3G A;  3MHS A;  1DF0 A;  1ZCM A;  2ACT A;  3L11 A;  3MOR A;  3OVX A;  2OUL A;  3C9E A;  2K4D A;  2E00 A;  1QMY A;  5LKT A;  5CVM A;  4YYQ A;  4X3G A;  3O37 A;  3L1Z B;  4YAD A;  3ZUA A;  1WEM A;  2Y1N A;  1T1H A;  2AVW A;  2CKL A;  4QRG A;  1ME3 A;  2KFT A;  1X4J A;  3LFY A;  2VHS A;  1MHW A;  5H1T A;  1FH0 A;  3N4C A;  4YBS A;  4N79 A;  2F42 A;  1Y08 A;  1F29 A;  2DZY A;  4FJC A;  2CT2 A;  1YT7 A;  2G6Q A;  2C0Y A;  5K16 A;  3RVV A;  4CDD B;  3MTN A;  2VPB A;  1F2B A;  2HYE D;  1AYW A;  4NV8 A;  3ZVZ B;  3U8E A;  2LV9 A;  3L1X A;  5D1K B;  2DZZ A;  1AU0 A;  2BSZ A;  5EF4 A;  3V6C A;  2M1R A;  2PNX A;  2FRQ A;  3BPM A;  2YSJ A;  1MM3 A;  2R9N A;  3KV6 A;  3N3K A;  2H0D B;  3QJ3 A;  1NB5 A;  1AEC A;  2ECI A;  4MZS A;  3D6S A;  3KSE A;  3H8B A;  3PUQ A;  4YAT A;  3BOW A;  4GB0 A;  4LJN A;  2F1G A;  5TBN A;  2UZG A;  2MNY A;  2MIQ A;  1YAL A;  3IOQ A;  4PP1 A;  2OP3 A;  4CZW A;  1RMD A;  2JMI A;  1GLO A;  4L58 A;  4PI3 A;  4G54 A;  1JM7 B;  1AYV A;  1TL9 A;  1E2T A;  5H1V A;  1O0E A;  2K1J A;  3S3Q A;  3F75 A;  2PRE A;  4A4B A;  3O35 A;  4A4C A;  5CVO B;  3BPF A;  5JA7 A;  1S4V A;  3N9M A;  2VJF B;  4N3W A;  1MEG A;  4B55 A;  2LXH C;  1WES A;  3WXG A;  3O70 A;  2XU4 A;  6PAD A;  1Z2Q A;  5B79 A;  3D9W A;  3IHP A;  3O7A A;  5D1M B;  1MEM A;  3ZTG A;  2LRI C;  5I3L A;  3IEJ A;  3BCN A;  3I3T A;  1VYX A;  4W5B A;  4DMX A;  4BS6 A;  2LQ6 A;  4S3O C;  1F62 A;  1F2A A;  1W5R A;  1W6F A;  3V43 A;  1ME4 A;  1WEN A;  4WA6 A;  5J3X A;  4YYW A;  3ASL A;  3K9M A;  3LXS A;  1NLJ A;  2M6M A;  2L5U A;  3N9L A;  3S3R A;  3P5X A;  2JMD A;  2PAD A;  4CCG X;  2G7Y A;  4BS5 A;  1GCB A;  1CSB B;  1HYJ A;  2Y5B A;  3KWZ A;  1DEU A;  3KKU A;  3LTW A;  2FUU A;  4I7B A;  3K24 A;  3LQJ A;  1NQC A;  1PPP A;  1E4U A;  2AUZ A;  3O33 A;  1WEQ A;  1EWO A;  2H0D A;  3HD3 A;  1V87 A;  3RPG B;  1MIR A;  2FT2 A;  2GFO A;  1PIP A;  8PCH A;  1AIM A;  2FRA A;  4Q8H A;  2L80 A;  4BBQ A;  1U9X A;  3HHA A;  3PBH A;  2YUC A;  3KV5 A;  4GNG A;  1TU6 A;  2JQF R;  3M99 A;  1WIL A;  5KH7 A;  4YAX A;  4FK5 A;  2YJC A;  2XU3 A;  5LKU A;  2FQ9 A;  4MVT A;  3P5U A;  2P7U A;  2KU3 A;  2MD7 B;  1WFK A;  1SNK A;  2G8J A;  2DJG B;  1YK8 A;  1X4I A;  3F5V A;  3OIS A;  4A0C D;  3PNR A;  4W5C A;  2BAY A;  4PTB A;  2FO5 A;  2DCC A;  3U5N A;  1QDQ A;  2XU5 A;  3WXE A;  3PHD A;  2AYO A;  2VHF A;  2YJ8 A;  3CBK A;  2YSM A;  2VJF A;  2MD8 C;  2KGI A;  1Y4H A;  5LKZ A;  1BOR A;  3TNX A;  2QIZ A;  4A49 A;  5H1U A;  4X6I A;  3H8C A;  4YVA A;  4B86 C;  3O0U A;  4X6H A;  2E03 A;  3LQI A;  4UP0 A;  3O1G A;  2YW8 A;  1ZIV A;  3NG2 A;  5TDR A;  3SHB A;  1Z60 A;  4IC3 A;  2DJF B;  4LK9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...