3MHSA

Structure of the saga ubp8/sgf11/sus1/sgf73 dub module bound to ubiquitin aldehyde
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
472
structure length
455
Chain Sequence
AMSICPHIQQVFQNEKSKDGVLKTCNAARYILNHSVPKEKFLNTMKCGTCHEINSGATFMCLQCGFCGCWNHSHFLSHSKQIGHIFGINSNNGLLFCFKCEDYIGNIDLINDAILAKYWDDVCTKTMVPSMERRDGLSGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNNCKVRSPDKCFSCALDKIVHELYGALNTSTNRQTGFIYLLTCAWKINQNLAGYSQQDAHEFWQFIINQIHQSYVLDLPNNNKQCECIVHTVFEGSLESSIVCPGCQNNSKTTIDPFLDLSLDIKDKKKLYECLDSFHKKEQLKDFNYHCGECNSTQDAIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKNYCSTKEKDKENGKVPDIIYELIGIVSHKGTVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQAYLLFYTIRQVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/transcription regulator/protein binding
molecule keywords Ubiquitin carboxyl-terminal hydrolase 8
publication title Structural insights into the assembly and function of the SAGA deubiquitinating module.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 134
structure length 455
sequence length 472
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2010-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3mhsA01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3mhsA02
1Y08A 3EB5A 3V43A 2IBIA 2C2LA 1TU6A 2XU4A 3N9MA 2OULA 4PTBA 2KREA 3KV5A 2MT5A 5LKZA 1XKGA 4CDDB 1VFYA 4BPVA 1WFKA 5LCWB 4FO9A 2G8EA 2LN0A 4YYRA 2XU1A 3H89A 2E6SA 3U5OA 3N9QA 2F6JA 3B79A 2L80A 3LQHA 4QH6A 1VD4A 4A49A 1MEMA 5FPWA 3K8UA 1HYJA 1NL6A 4N4ZA 4X3GA 1AIMA 5CHVA 4FJCA 2H0DB 4QRXA 2DC6A 2E01A 2Y1MA 3N3GA 1WEVA 8PCHA 3IOQA 5D1MB 5KH3A 2YJBA 1AYVA 3HCSA 3PDFA 3C5KA 4XR7A 3SOUA 2P7UA 2VJFB 2VHSA 2YU4A 3DQVR 2C0YA 5A24A 1CQDA 2JQGR 3OVXA 1X4UA 1VYXA 2M85A 1HYIA 1X4IA 3USVA 1CS8A 2KR4A 2JMJA 4Q6FA 1AYUA 1THEA 2LQ6A 4YYWA 1ITOA 4Q8GA 2F7DA 1WENA 3HCTA 5LKXA 1AU0A 4F52B 1X9YA 4QRGA 5G04B 1CVZA 1AU3A 2AS8A 1KFXL 1IYMA 1T1HA 3RTRB 1NLJA 5AITA 4IC3A 3GV4A 1IWDA 2LGKA 2F42A 2YQLA 3H8BA 1FP0A 2E00A 1AU2A 1DVPA 1VJVA 4WA6A 2KIZA 4BBQA 4R8PK 1AYWA 1DF0A 3OF8A 2VNFA 3H6SA 2MNYA 2Y1NA 3LXSA 2LGVA 5H1UA 2G7YA 1SNKA 2UZGA 1Z6UA 2ECWA 2VJEB 4YBMA 1FBVA 1GECE 3N3KA 1QDQA 3PNRA 4AUQB 2KFTA 3P5UA 3D6SA 3RVWA 1WGMA 2G8JA 4GB0A 4B7YC 1YK8A 2LV9A 4S3OB 1O0EA 5I3LA 3MHHA 3M63A 2PREA 2L75A 5G0FA 3EB6A 3KQIA 1PCIA 4GNEA 4RY2A 4WZ3B 2ECJA 3N9LA 4TKPB 2HXZA 2YSJA 1ATKA 1F62A 2ECVA 2ECTA 2LRIC 3K24A 4N79A 3KWZA 2KWKA 3I2DA 1QMYA 1F2CA 2G43A 3VK6A 2HHNA 2R6NA 1VSNA 1Y4HA 2NAAA 2AVWA 3HHAA 1EF7A 3C6WA 3HHIA 7PCKA 3DF0A 2KYUA 2YJCA 3NHEA 3QSDA 4BS5A 3BPMA 2MD8C 1JQPA 1MM2A 3MHSA 2EGPA 3V6CA 3MORA 2ECGA 4CDFB 3ZYQA 1CB5A 5H1VA 1YVBA 3BC3A 2FUDA 5DINA 3LQIA 2YUCA 4AXLA 3M99A 2NQDB 3HWNA 4YYSA 4YADA 1EWPA 2EA6A 9PAPA 4PP2E 3N4CA 1ME3A 1BORA 1ME4A 2DCAA 5J94A 1WEEA 1U5IA 2OXQC 3SOXA 3O1GA 2VHFA 1JM7B 4LADB 2E03A 2Y6EA 2M1RA 4A0CD 2FSAA 5JG6A 2KGGA 3KW9A 4AXMA 2VPDA 1PBHA 3NG2A 2Y5BA 3FL2A 4CDEB 5FEYA 4LK9A 3M62A 4YBTA 4MVTA 2DCBA 2FUIA 2L43A 2ARYA 4Q8HA 3CBKA 2O6XA 2DC7A 2P0RA 2PBHA 3C9EA 2ZETC 4I7CA 2CSZA 4CCGX 2AU1A 4P6GA 2WBFX 1AU4A 1DEUA 2F6NA 2JMIA 4AP4A 2RSDA 2ECIA 4FK5A 4MSXA 2K4DA 3PW3A 2MNZA 4MZSA 3KV6A 4YVAA 4YC9A 1EWMA 1POPA 2CT2A 2IPPB 2FRAA 3RPGB 5B75A 2YJ2A 5TRBA 3F75A 4K7CA 3GCBA 4P6EA 2LXPC 4GNDA 5B78A 2NQGA 2L5UA 2KGIA 3T7LA 1CHCA 3KWBX 4QF2A 2CKLA 4BQVA 2H7JA 2FYEA 2K17A 1PIPA 3HTKC 1CPJA 3WXEA 3O36A 3KNVA 1QXPA 1NB3A 4OEMA 4C9ZA 1FH0A 2DZYA 3E1ZB 3PUQA 1F2BA 2XB1A 2ACTA 5DKAA 2KWNA 1ZCMA 4MZOA 4UP0A 3ASLA 1STFE 2G6QA 4X6IA 3PHDA 2DC9A 2MUMA 2B1MA 1Z2QA 5FERA 3RVXA 1KXRA 3DPLR 1U9QX 4N3WA 5PADA 1KHPA 4FIPA 1A6RA 3IV2A 1GLOA 3O35A 2ECNA 4QF3A 1AECA 1V87A 2M3HA 3O70A 2FTDA 1SP4B 1XWHA 3BWKA 1WEOA 3U5PA 2CSYA 4HWYA 1U6GB 2LDRA 3OVZA 5TBNA 5G05B 2JQFR 3O7AA 5TABA 5D1LB 1GCBA 2KWOA 1WEUA 3ZTGA 4ZUXU 1WESA 3LFYA 4N8WA 4XUIA 4YYUA 1BY8A 3O33A 2CIOA 2FO5A 1WILA 4DMYA 3U8EA 4A4CA 3L1ZB 1PPDA 3U5MA 1JOCA 4GNGA 3N9OA 4P5OB 3ZUAA 2YJ9A 1U9VA 5KH7A 3SOWA 4I7DA 2YT5A 5TDWA 3HD3A 5B76A 4I05A 1F2AA 4UI9B 3ZVYA 3N9PA 1NQCA 2K16A 3IHPA 4CZWA 1WEQA 4LLBA 2D8SA 3ZVZB 4UP5A 2AIMA 5CHTA 4BHWA 2C2VS 1KHQA 3QJ3A 5CVOB 5H9MA 2PADA 1F29A 1YALA 2FRQA 1PADA 2NQIA 2VPEA 1EWLA 3IEJA 2DJGB 3OISA 5EGWA 3ZPV1 2CB5A 1U9WA 5JA7A 4QBBA 4CDCB 4YABA 2BAYA 4YYQA 2MA5A 2AN6A 1BGOA 3QT4A 2R9FA 4KLBA 2Y43A 4IC2A 4AYCA 4L7XA 3LQJA 4I04A 2HD5A 3PBHA 2E6RA 2PUYA 1WE9A 3P5WA 2LGLA 4BSQA 1CSBB 1N87A 3L11A 3P5VA 4YYVA 3HCUA 2QICA 5LKTA 1EWOA 1K2FA 2MA6A 1M6DA 4AYCB 5H1TA 2RI7A 5B77A 2KWJA 2LGGA 3QZVA 4OELA 2YREA 1CTEA 5EF4A 2JMDA 3K9MA 5FB1A 2K1JA 5D1KB 2G6DA 2BDZA 2H0DA 1BP4A 2XU5A 1GMYA 3RVVA 3BOWA 4A4BA 1PPPA 2VPGA 2FUUA 4YBSA 1MIRA 1HUCB 4ZDTA 4X6JA 5CVMA 2M6MA 2VJFA 1YK7A 2R9CA 2L0BA 2YHOA 1PXVA 4XI1A 2BDLA 3KKUA 3TNXA 3LRQA 1TL9A 3V6EA 2VP7A 3F5VA 4V3LC 4GNFA 2DX8A 4B86C 3S3RA 1MHWA 3WXGA 4BS6A 1MDWA 4O64A 4PI3A 2JRJA 5FB0A 4AVXA 3WXFA 1WEMA 4S3OC 4ZQLA 3IMAA 5J3XA 3CBJA 2HH5A 4DMXA 2HYED 4W5CA 2I50A 3KSEA 3H8CA 5AIUA 2CKLB 4CA1A 4YV8A 3T6RA 1MS6A 2DCCA 3S3QA 1PPNA 2DZZA 5C13A 2YJ8A 1G25A 4PADA 3BCNA 2AYOA 1YT7A 1S4VA 2R9MA 3PURA 2LXHC 2AUXA 2DC8A 3IUTA 3GL6A 4WZ2A 1CJLA 3I06A 3AI8A 2MIQA 2VPBA 2XEUA 1Q6KA 1U9XA 2KU3A 1WIMA 5TDRA 2VJEA 2P86A 1PE6A 3MTNA 4WZ0A 2EODA 3CH3X 2R9OA 1LDKC 4YAXA 4LJNA 4PP1A 3I3TA 2KE1A 2OP3A 2YW8A 1ICFA 2GHUA 4W5BA 3CH2X 1QOLA 1ZBDB 2F1GA 1BQIA 3ZNIA 5C11A 1NB5A 2YSMA 3H7DA 3O37A 2QIZA 2IDAA 2B1NA 4LKAA 1NPZA 4QRVA 1PPOA 3KFQA 3O0UA 4X6HA 1MM3A 1TLOA 4R7EA 5LKUA 6PADA 4NN2A 2GFOA 1MEGA 1E4UA 5CVNB 2AYNA 4G54A 2FT2A 2QJ0A 1ZIVA 3BPFA 4N4FA 4L58A 3KX1A 3L1XA 4I7BA 2XU3A 4YATA 1WEWA 5B79A 1CV8A 5EYAF 5F02A 2YYRA 2NQAA 2PNXA 5B8DA 2YQMA 3P5XA 3ERVA 2HDPA 1K3BB 1RMDA 4R2YA 2R9NA 1Z60A 1WEPA 3OF9A 2PNSA 1KFUL 2G45A 3RPGC 3O34A 3ZPVE 4W4UA 5KH9A 2ATOA 2AUZA 5K16A 2E02A 2FQ9A 3SHBA 4V3KC 2DCDA 5JH3A 2DJFB 1LDJB 2OZ2A 3U5NA 4I07A 2MD7B 2YHNA 2YURA 3N9NA 4PPEA 1JM7A 1X4JA
chains in the Genus database with same CATH superfamily
1Y08A 3EB5A 5K3QA 2CRWA 3PRMA 3V43A 3MTVA 2IBIA 2C2LA 1TU6A 2XU4A 3N9MA 2OULA 4PTBA 4BOQA 2KREA 3KV5A 2MT5A 5LKZA 1XKGA 4CDDB 1VFYA 3MJ5A 1WFKA 5LCWB 4FO9A 2G8EA 2LN0A 4BPVA 4YYRA 2XU1A 3H89A 2E6SA 3U5OA 3N9QA 2F6JA 3FJUB 2L80A 3B79A 3LQHA 4QH6A 2BU3A 1VD4A 4A49A 1MEMA 5FPWA 3K8UA 1HYJA 1NL6A 4N4ZA 4X3GA 1AIMA 5CHVA 4FJCA 2H0DB 4QRXA 2DC6A 1PVJA 2E01A 2Y1MA 3N3GA 1WEVA 8PCHA 3IOQA 5D1MB 5KH3A 2YJBA 3E9SA 4BOSA 1AYVA 3FAOA 3HCSA 3PDFA 3C5KA 4XR7A 3SOUA 2P7UA 3BBAA 2VJFB 4XZXA 2VHSA 2YU4A 3DQVR 2C0YA 2JRIA 3DWDA 5A24A 4H9DA 1CQDA 2JQGR 3OVXA 1X4UA 1VYXA 2M85A 1HYIA 1X4IA 3USVA 4QQ4A 4A5UA 4OGCA 1CS8A 2KR4A 2JMJA 4Q6FA 1AYUA 1THEA 2LQ6A 4YYWA 1ITOA 4Q8GA 2F7DA 1WENA 3HCTA 5LKXA 1AU0A 4F52B 1X9YA 4QRGA 2L7PA 5G04B 1CVZA 4Z0OA 1AU3A 2AS8A 1KFXL 1IYMA 3PLWA 1T1HA 3RTRB 1NLJA 5AITA 2XOZA 3GV4A 4IC3A 1IWDA 2LGKA 2EGMA 2F42A 2YQLA 1FP0A 2E00A 3H8BA 5EZSA 1AU2A 1DVPA 2DSMA 1VJVA 4WA6A 2KIZA 4BBQA 3B21A 4R8PK 1AYWA 1DF0A 3OF8A 2VNFA 2XP0A 3H6SA 2MNYA 2Y1NA 3LXSA 2LGVA 5H1UA 2G7YA 1SNKA 2UZGA 2AGAA 1Z6UA 3W31A 2ECWA 2VJEB 4YBMA 2YVRA 1FBVA 1GECE 3N3KA 2RR4A 1QDQA 3PNRA 3TRKA 4AUQB 2KFTA 3P5UA 3D6SA 3RVWA 1WGMA 2G8JA 4GB0A 4B7YC 1YK8A 2LV9A 4S3OB 3O47A 1O0EA 5I3LA 1YZBA 3MHHA 3M63A 3FANA 2PREA 2L75A 5G0FA 3EB6A 3KQIA 1PCIA 4GNEA 4RY2A 4WZ3B 4BOZA 2ECJA 3N9LA 4TKPB 2HXZA 2YSJA 3MP2A 1ATKA 1F62A 2ECVA 2D8UA 2ECTA 2LRIC 3K24A 4N79A 3KWZA 2KWKA 3I2DA 1QMYA 1F2CA 2G43A 4PT5A 3VK6A 2HHNA 2R6NA 1VSNA 1Y4HA 2NAAA 2AVWA 3HHAA 1EF7A 3C6WA 3HHIA 7PCKA 3PHUA 3DF0A 3C0RA 3PHXA 2KYUA 2YJCA 2KKXA 3NHEA 3QSDA 4BS5A 5SVYA 3DDTA 3BPMA 2MD8C 4OVZA 1JQPA 1MM2A 3MHSA 2EGPA 3V6CA 3MORA 2ECGA 4CDFB 3LJUX 3ZYQA 1CB5A 5H1VA 1YVBA 3BC3A 2FUDA 5DINA 3LQIA 2YUCA 4AXLA 3M99A 2NQDB 2KKYA 3HWNA 4YYSA 4YADA 1EWPA 2EA6A 9PAPA 4PP2E 3N4CA 1ME3A 1BORA 1ME4A 2DCAA 5J94A 1WEEA 1U5IA 2OXQC 3SOXA 3O1GA 2VHFA 1JM7B 3KDEC 4LADB 2E03A 2Y6EA 3O65A 2M1RA 4A0CD 2FSAA 5JG6A 2KGGA 3KW9A 4AXMA 2VPDA 1PBHA 3NG2A 2Y5BA 3FL2A 4CDEB 5FEYA 4LK9A 2CRRA 3M62A 4MVTA 4YBTA 2DCBA 2FUIA 2L43A 2ARYA 3IFUA 4Q8HA 3CBKA 2O6XA 2DC7A 2P0RA 2PBHA 3C9EA 5EZQA 2ZETC 4I7CA 2CSZA 4CCGX 2AU1A 4P6GA 2WBFX 1AU4A 2OWAA 1DEUA 2F6NA 2JMIA 4AP4A 2HWKA 2RSDA 2ECIA 4FK5A 4MSXA 2K4DA 3PW3A 2MNZA 4MZSA 3KV6A 4YVAA 4YC9A 1EWMA 1POPA 2CT2A 2IPPB 2FRAA 2CSVA 3RPGB 5B75A 2YJ2A 5TRBA 3F75A 4K7CA 3GCBA 4P6EA 2XOYA 2LXPC 4GNDA 5B78A 2NQGA 2L5UA 2KGIA 3T7LA 1CHCA 3KWBX 4QF2A 2CKLA 4BQVA 2EXUA 4F1PA 2H7JA 2FYEA 2K17A 1PIPA 3HTKC 3T9KA 4D8IA 1CPJA 3WXEA 3O36A 3KNVA 4Z0RA 1QXPA 1NB3A 4OEMA 4C9ZA 1FH0A 2DZYA 3FM8C 3E1ZB 3PUQA 1F2BA 2XB1A 2ACTA 5DKAA 2KWNA 1ZCMA 4MZOA 4UP0A 2FD4A 3ASLA 1STFE 2G6QA 4X6IA 3PHDA 2DC9A 2MUMA 2B1MA 1Z2QA 5FERA 3RVXA 1KXRA 3DPLR 4HXDB 1U9QX 4N3WA 5PADA 1KHPA 4FIPA 1A6RA 3IV2A 1GLOA 3O35A 2ECNA 4QF3A 1AECA 1V87A 2M3HA 3O70A 2FTDA 1SP4B 1XWHA 3BWKA 2LAUA 1WEOA 3U5PA 2CSYA 4HWYA 3RNVA 1U6GB 2LDRA 3OVZA 5TBNA 5G05B 2JQFR 3O7AA 5TABA 5D1LB 1GCBA 1MBMA 2KWOA 1WEUA 3ZTGA 4ZUXU 1WESA 3LFYA 4N8WA 4XUIA 4RNAA 4YYUA 1BY8A 3O33A 2B0OE 2CIOA 2FO5A 1WILA 4DMYA 2MKEA 3U8EA 4A4CA 3L1ZB 1PPDA 3U5MA 1JOCA 4GNGA 3N9OA 4P5OB 3ZUAA 2E61A 5SVIA 2YJ9A 1U9VA 5KH7A 3SOWA 4I7DA 2YT5A 2P57A 5TDWA 3HD3A 5B76A 4I05A 1F2AA 4UI9B 2CONA 3ZVYA 3MDBC 3N9PA 2K16A 2DJAA 3IHPA 1NQCA 4CZWA 1WEQA 4LLBA 2Z84A 2D8SA 3ZVZB 4UP5A 2AIMA 5CHTA 4BHWA 2C2VS 1KHQA 5SVIB 3QJ3A 5CVOB 5H9MA 2PADA 1F29A 1YALA 2FRQA 1PADA 2NQIA 2VPEA 1EWLA 3IEJA 2DJGB 3OISA 5EGWA 3ZPV1 2DOSA 2CB5A 1U9WA 5JA7A 4QBBA 4CDCB 4YABA 2BAYA 4YYQA 2MA5A 2AN6A 1BGOA 3QT4A 2R9FA 4M0WA 4KLBA 2Y43A 4IC2A 4AYCA 4L7XA 3W30A 3LQJA 4RKXA 4OVZB 4I04A 2HD5A 3PBHA 2E6RA 2PUYA 1WE9A 3P5WA 2LGLA 4BSQA 1CSBB 1N87A 3L11A 3P5VA 4YYVA 3HCUA 2QICA 3BY4A 5LKTA 1EWOA 1K2FA 2MA6A 1M6DA 4AYCB 5H1TA 2RI7A 5E6JA 5B77A 2KWJA 2LGGA 3QZVA 4OELA 2YREA 1CTEA 3OQCA 5EF4A 5SVXA 2JMDA 3K9MA 5FB1A 2K1JA 5D1KB 3Q1DA 2BDZA 2H0DA 2G6DA 1BP4A 2XU5A 4IP3A 1GMYA 3RVVA 3BOWA 4A4BA 1PPPA 2VPGA 2FUUA 3M7KA 4YBSA 1MIRA 1HUCB 4ZDTA 4X6JA 5CVMA 2M6MA 2VJFA 1YK7A 2R9CA 2L0BA 2YHOA 1PXVA 4XI1A 2BDLA 3KKUA 3TNXA 3LRQA 1TL9A 2XOCA 3V6EA 2VP7A 3LVQE 3F5VA 4GNFA 2DX8A 4V3LC 4B86C 3S3RA 1MHWA 3WXGA 4BS6A 1MDWA 4O64A 2J7QC 4PI3A 2JRJA 5FB0A 4AVXA 3WXFA 1WEMA 4S3OC 4ZQLA 4P16A 3TMPA 3IMAA 5J3XA 3CBJA 2HH5A 4DMXA 2HYED 4W5CA 2I50A 3KSEA 3H8CA 5AIUA 2CKLB 4CA1A 4YV8A 3T6RA 1MS6A 2DCCA 4GUAA 3S3QA 1PPNA 4RF1A 2DZZA 5C13A 3H7HA 2YJ8A 1G25A 1UKFA 4PADA 5JZEA 3BCNA 2AYOA 4RF0A 1YT7A 4MI7A 1S4VA 4D8EA 2R9MA 3PURA 2LXHC 2AUXA 2DC8A 2FFWA 3IUTA 3GL6A 4WZ2A 1CJLA 3I06A 3AI8A 2MIQA 2VPBA 2JM3A 2XEUA 1Q6KA 1U9XA 2FE8A 2KU3A 1WIMA 5TDRA 2VJEA 2P86A 3ZNHA 1PE6A 3MTNA 4WZ0A 2EODA 3CH3X 2R9OA 3PHWA 1LDKC 4YAXA 4LJNA 4PP1A 3I3TA 3SUBA 2KE1A 2BTWA 2J7QA 2YW8A 2OP3A 1ICFA 2GHUA 3LVRE 4W5BA 5KO3A 3CH2X 1QOLA 1ZBDB 2F1GA 1BQIA 3ZNIA 5C11A 1NB5A 2YSMA 3H7DA 3O37A 4R3DA 2QIZA 2IDAA 2B1NA 4IUMA 4LKAA 2M13A 4BOUA 4ZTBA 1NPZA 4QRVA 1PPOA 2BTWB 3KFQA 3O0UA 4OW0A 1DKIA 4X6HA 1MM3A 1TLOA 4R7EA 5LKUA 2JUNA 6PADA 2JTCA 4NN2A 3FEHA 3BB7A 2GFOA 1MEGA 3PT2A 1E4UA 5CVNB 2AYNA 4G54A 2FT2A 2QJ0A 3JUEA 1ZIVA 3BPFA 4N4FA 4L58A 3KX1A 4REZA 3L1XA 4I7BA 3PRPA 2XU3A 4YATA 1WEWA 5B79A 1CV8A 5EYAF 5F02A 2YYRA 2NQAA 2PNXA 5B8DA 2YQMA 3PSEA 3P5XA 3ERVA 2HDPA 1K3BB 1RMDA 4MM3B 4R2YA 1DCQA 4BOPA 2R9NA 1Z60A 1WEPA 3OF9A 2PNSA 1KFUL 2G45A 3E2DA 3RPGC 4D8BA 3O34A 3ZPVE 4WURA 4W4UA 5KH9A 2ATOA 2AUZA 2IQJA 5K16A 2E02A 2FQ9A 3SHBA 4V3KC 2DCDA 5JH3A 2DJFB 1LDJB 2OZ2A 3U5NA 4I07A 4O62A 2UZJA 4OGEA 3LDYA 2MD7B 2YHNA 2YURA 3N9NA 4PPEA 1JM7A 1X4JA
chains in the Genus database with same CATH topology
1Y08A 3EB5A 3V43A 2IBIA 2C2LA 1TU6A 2XU4A 3N9MA 2OULA 4PTBA 2KREA 3KV5A 2MT5A 5LKZA 1XKGA 4CDDB 1VFYA 4BPVA 1WFKA 5LCWB 4FO9A 2G8EA 2LN0A 4YYRA 2XU1A 3H89A 2E6SA 3U5OA 3N9QA 2F6JA 3B79A 2L80A 3LQHA 4QH6A 1VD4A 4A49A 1MEMA 5FPWA 3K8UA 1HYJA 1NL6A 4N4ZA 4X3GA 1AIMA 5CHVA 4FJCA 2H0DB 4QRXA 2DC6A 2E01A 2Y1MA 3N3GA 1WEVA 8PCHA 3IOQA 5D1MB 5KH3A 2YJBA 1AYVA 3HCSA 3PDFA 3C5KA 4XR7A 3SOUA 2P7UA 2VJFB 2VHSA 2YU4A 3DQVR 2C0YA 5A24A 1CQDA 2JQGR 3OVXA 1X4UA 1VYXA 2M85A 1HYIA 1X4IA 3USVA 1CS8A 2KR4A 2JMJA 4Q6FA 1AYUA 1THEA 2LQ6A 4YYWA 1ITOA 2VFCA 2F7DA 1WENA 4Q8GA 3HCTA 5LKXA 1AU0A 4F52B 1X9YA 4QRGA 5G04B 1CVZA 1AU3A 2AS8A 1KFXL 1IYMA 1T1HA 3RTRB 1NLJA 5AITA 4IC3A 3GV4A 1IWDA 2LGKA 2F42A 2YQLA 3H8BA 1FP0A 2E00A 1AU2A 1DVPA 1VJVA 4WA6A 2KIZA 4BBQA 4R8PK 1AYWA 1DF0A 3OF8A 2VNFA 3H6SA 2MNYA 2Y1NA 3LXSA 2LGVA 5H1UA 2G7YA 1SNKA 2UZGA 1Z6UA 2ECWA 2VJEB 4YBMA 1FBVA 1GECE 3N3KA 1QDQA 3PNRA 4AUQB 2KFTA 4BGFA 3P5UA 3D6SA 3RVWA 1WGMA 2G8JA 4GB0A 4B7YC 1YK8A 2LV9A 4S3OB 1O0EA 5I3LA 3MHHA 3M63A 2PREA 2L75A 5G0FA 3EB6A 3KQIA 1PCIA 4GNEA 4RY2A 4WZ3B 4B55A 2ECJA 3N9LA 4TKPB 2HXZA 2YSJA 1ATKA 1F62A 2ECVA 2ECTA 2LRIC 3K24A 4N79A 3KWZA 2KWKA 3I2DA 1QMYA 1F2CA 2G43A 3VK6A 2HHNA 2R6NA 1VSNA 1Y4HA 2NAAA 2AVWA 3HHAA 1EF7A 3C6WA 3HHIA 7PCKA 3DF0A 2KYUA 2YJCA 3NHEA 3QSDA 4NV7A 1W5RA 4BS5A 3BPMA 2MD8C 1JQPA 1MM2A 3MHSA 2EGPA 3V6CA 3MORA 2ECGA 4CDFB 3ZYQA 1CB5A 5H1VA 1YVBA 3BC3A 2FUDA 5DINA 3LQIA 2YUCA 4AXLA 3M99A 2NQDB 3HWNA 4YYSA 4YADA 1EWPA 2EA6A 9PAPA 4PP2E 3N4CA 1ME3A 1W6FA 1BORA 1ME4A 2DCAA 5J94A 1WEEA 1U5IA 2OXQC 3SOXA 3O1GA 2VHFA 1JM7B 4LADB 2E03A 2Y6EA 2M1RA 4A0CD 2FSAA 5JG6A 2KGGA 3KW9A 4AXMA 2VPDA 1PBHA 3NG2A 2Y5BA 3FL2A 4CDEB 5FEYA 4LK9A 3M62A 4YBTA 4MVTA 2DCBA 2FUIA 2L43A 2ARYA 4Q8HA 3CBKA 2O6XA 2DC7A 2P0RA 2PBHA 3C9EA 2ZETC 4I7CA 2CSZA 4CCGX 2AU1A 4P6GA 1E2TA 2WBFX 1AU4A 1DEUA 2F6NA 2JMIA 4AP4A 2RSDA 2ECIA 4FK5A 4MSXA 2K4DA 3PW3A 2MNZA 3LTWA 3KV6A 4MZSA 4YVAA 4YC9A 1EWMA 1POPA 2CT2A 2IPPB 2FRAA 3RPGB 5B75A 2YJ2A 5TRBA 3F75A 4K7CA 3GCBA 4P6EA 1W4TA 2LXPC 4GNDA 5B78A 2NQGA 2L5UA 2KGIA 3T7LA 1CHCA 3KWBX 4QF2A 2CKLA 4BQVA 2H7JA 2FYEA 2K17A 1PIPA 3HTKC 1CPJA 3WXEA 3O36A 3KNVA 1QXPA 1NB3A 4OEMA 4C9ZA 1FH0A 2DZYA 3E1ZB 3PUQA 1F2BA 2XB1A 2ACTA 5DKAA 2KWNA 1ZCMA 4MZOA 4NV8A 4UP0A 3ASLA 1STFE 2G6QA 4X6IA 3PHDA 2DC9A 2MUMA 2B1MA 1Z2QA 5FERA 3RVXA 1KXRA 3DPLR 1U9QX 4N3WA 5PADA 1KHPA 4FIPA 1A6RA 3IV2A 1GLOA 3O35A 2ECNA 4QF3A 1AECA 1V87A 2M3HA 3O70A 2FTDA 1SP4B 1XWHA 3BWKA 1WEOA 3U5PA 2CSYA 4HWYA 1U6GB 2LDRA 3OVZA 5TBNA 5G05B 2JQFR 3O7AA 5TABA 5D1LB 1GCBA 2KWOA 4C5PA 1WEUA 3ZTGA 4ZUXU 1WESA 3LFYA 4N8WA 4XUIA 4YYUA 1BY8A 3O33A 2CIOA 2FO5A 1WILA 4DMYA 3U8EA 4A4CA 3L1ZB 1PPDA 3U5MA 1JOCA 4GNGA 3N9OA 4P5OB 3ZUAA 2YJ9A 1U9VA 5KH7A 3SOWA 4I7DA 2YT5A 5TDWA 3HD3A 5B76A 4I05A 1F2AA 4UI9B 3ZVYA 3N9PA 1NQCA 2K16A 3IHPA 1GX3A 4CZWA 1WEQA 4LLBA 2D8SA 3ZVZB 4UP5A 2AIMA 5CHTA 4BHWA 2C2VS 1KHQA 3QJ3A 5CVOB 5H9MA 2PADA 1F29A 1YALA 2FRQA 1PADA 2NQIA 2VPEA 1EWLA 3IEJA 2DJGB 3OISA 5EGWA 3ZPV1 2CB5A 1U9WA 5JA7A 4QBBA 4CDCB 4YABA 2BAYA 4YYQA 2MA5A 2AN6A 1BGOA 3QT4A 2R9FA 4KLBA 2Y43A 4IC2A 4AYCA 4L7XA 3LQJA 4I04A 2HD5A 3PBHA 2E6RA 2PUYA 1WE9A 3P5WA 2LGLA 4BSQA 1CSBB 1N87A 3L11A 3P5VA 4YYVA 3HCUA 2QICA 5LKTA 1EWOA 1K2FA 2MA6A 1M6DA 4AYCB 5H1TA 2RI7A 5B77A 2KWJA 2LGGA 3QZVA 4OELA 2YREA 1CTEA 5EF4A 2JMDA 3K9MA 5FB1A 2K1JA 5D1KB 2G6DA 2BDZA 2H0DA 1BP4A 2XU5A 1GMYA 3RVVA 3BOWA 4A4BA 1PPPA 2VPGA 2FUUA 4YBSA 1MIRA 1HUCB 4ZDTA 4X6JA 5CVMA 2M6MA 2VJFA 1YK7A 2R9CA 2L0BA 2YHOA 1PXVA 4XI1A 2BDLA 3KKUA 3TNXA 3LRQA 1TL9A 3V6EA 2VP7A 3F5VA 4V3LC 4GNFA 2DX8A 4B86C 3S3RA 1MHWA 3WXGA 4BS6A 1MDWA 4O64A 4PI3A 2JRJA 5FB0A 4AVXA 3WXFA 1WEMA 4S3OC 4ZQLA 3IMAA 5J3XA 3CBJA 2HH5A 4DMXA 2HYED 4W5CA 2I50A 3KSEA 3H8CA 5AIUA 2CKLB 4CA1A 4YV8A 3T6RA 1MS6A 2DCCA 3S3QA 1PPNA 2DZZA 5C13A 2YJ8A 1G25A 4PADA 3BCNA 2AYOA 1YT7A 1S4VA 2R9MA 3PURA 2LXHC 2AUXA 2DC8A 3IUTA 3GL6A 4WZ2A 1CJLA 3I06A 3AI8A 3D9WA 2MIQA 2VPBA 2XEUA 1Q6KA 1U9XA 2KU3A 1WIMA 5TDRA 2VJEA 2P86A 1PE6A 3MTNA 4WZ0A 2EODA 3CH3X 2R9OA 1LDKC 4YAXA 4LJNA 4PP1A 3I3TA 2KE1A 2OP3A 2YW8A 1ICFA 2GHUA 4W5BA 3CH2X 1QOLA 1ZBDB 2F1GA 1BQIA 3ZNIA 5C11A 1NB5A 2YSMA 3H7DA 3O37A 2QIZA 2IDAA 2B1NA 4LKAA 1NPZA 4QRVA 1PPOA 3KFQA 3O0UA 4X6HA 1MM3A 1TLOA 4R7EA 5LKUA 6PADA 4NN2A 2GFOA 1MEGA 1E4UA 5CVNB 2AYNA 4GUZA 4G54A 2FT2A 2QJ0A 1ZIVA 3BPFA 4N4FA 4L58A 3KX1A 3L1XA 4I7BA 2XU3A 4YATA 1WEWA 5B79A 1CV8A 5EYAF 5F02A 2YYRA 2NQAA 2PNXA 5B8DA 2YQMA 3P5XA 3ERVA 2HDPA 1K3BB 1RMDA 2BSZA 4R2YA 2R9NA 1Z60A 1WEPA 3OF9A 2PNSA 1KFUL 2G45A 3RPGC 3O34A 3ZPVE 4W4UA 5KH9A 2ATOA 2AUZA 5K16A 2E02A 2VFBA 2FQ9A 3SHBA 4V3KC 2DCDA 5JH3A 2DJFB 1LDJB 2OZ2A 3U5NA 4I07A 2MD7B 2YHNA 2YURA 3N9NA 4PPEA 1JM7A 1X4JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y08 A;  3EB5 A;  3V43 A;  2IBI A;  2C2L A;  1TU6 A;  2XU4 A;  3N9M A;  2OUL A;  4PTB A;  2KRE A;  3KV5 A;  2MT5 A;  5LKZ A;  1XKG A;  4CDD B;  1VFY A;  4BPV A;  1WFK A;  5LCW B;  4FO9 A;  2G8E A;  2LN0 A;  4YYR A;  2XU1 A;  3H89 A;  2E6S A;  3U5O A;  3N9Q A;  2F6J A;  3B79 A;  2L80 A;  3LQH A;  4QH6 A;  1VD4 A;  4A49 A;  1MEM A;  5FPW A;  3K8U A;  1HYJ A;  1NL6 A;  4N4Z A;  4X3G A;  1AIM A;  5CHV A;  4FJC A;  2H0D B;  4QRX A;  2DC6 A;  2E01 A;  2Y1M A;  3N3G A;  1WEV A;  8PCH A;  3IOQ A;  5D1M B;  5KH3 A;  2YJB A;  1AYV A;  3HCS A;  3PDF A;  3C5K A;  4XR7 A;  3SOU A;  2P7U A;  2VJF B;  2VHS A;  2YU4 A;  3DQV R;  2C0Y A;  5A24 A;  1CQD A;  2JQG R;  3OVX A;  1X4U A;  1VYX A;  2M85 A;  1HYI A;  1X4I A;  3USV A;  1CS8 A;  2KR4 A;  2JMJ A;  4Q6F A;  1AYU A;  1THE A;  2LQ6 A;  4YYW A;  1ITO A;  4Q8G A;  2F7D A;  1WEN A;  3HCT A;  5LKX A;  1AU0 A;  4F52 B;  1X9Y A;  4QRG A;  5G04 B;  1CVZ A;  1AU3 A;  2AS8 A;  1KFX L;  1IYM A;  1T1H A;  3RTR B;  1NLJ A;  5AIT A;  4IC3 A;  3GV4 A;  1IWD A;  2LGK A;  2F42 A;  2YQL A;  3H8B A;  1FP0 A;  2E00 A;  1AU2 A;  1DVP A;  1VJV A;  4WA6 A;  2KIZ A;  4BBQ A;  4R8P K;  1AYW A;  1DF0 A;  3OF8 A;  2VNF A;  3H6S A;  2MNY A;  2Y1N A;  3LXS A;  2LGV A;  5H1U A;  2G7Y A;  1SNK A;  2UZG A;  1Z6U A;  2ECW A;  2VJE B;  4YBM A;  1FBV A;  1GEC E;  3N3K A;  1QDQ A;  3PNR A;  4AUQ B;  2KFT A;  3P5U A;  3D6S A;  3RVW A;  1WGM A;  2G8J A;  4GB0 A;  4B7Y C;  1YK8 A;  2LV9 A;  4S3O B;  1O0E A;  5I3L A;  3MHH A;  3M63 A;  2PRE A;  2L75 A;  5G0F A;  3EB6 A;  3KQI A;  1PCI A;  4GNE A;  4RY2 A;  4WZ3 B;  2ECJ A;  3N9L A;  4TKP B;  2HXZ A;  2YSJ A;  1ATK A;  1F62 A;  2ECV A;  2ECT A;  2LRI C;  3K24 A;  4N79 A;  3KWZ A;  2KWK A;  3I2D A;  1QMY A;  1F2C A;  2G43 A;  3VK6 A;  2HHN A;  2R6N A;  1VSN A;  1Y4H A;  2NAA A;  2AVW A;  3HHA A;  1EF7 A;  3C6W A;  3HHI A;  7PCK A;  3DF0 A;  2KYU A;  2YJC A;  3NHE A;  3QSD A;  4BS5 A;  3BPM A;  2MD8 C;  1JQP A;  1MM2 A;  3MHS A;  2EGP A;  3V6C A;  3MOR A;  2ECG A;  4CDF B;  3ZYQ A;  1CB5 A;  5H1V A;  1YVB A;  3BC3 A;  2FUD A;  5DIN A;  3LQI A;  2YUC A;  4AXL A;  3M99 A;  2NQD B;  3HWN A;  4YYS A;  4YAD A;  1EWP A;  2EA6 A;  9PAP A;  4PP2 E;  3N4C A;  1ME3 A;  1BOR A;  1ME4 A;  2DCA A;  5J94 A;  1WEE A;  1U5I A;  2OXQ C;  3SOX A;  3O1G A;  2VHF A;  1JM7 B;  4LAD B;  2E03 A;  2Y6E A;  2M1R A;  4A0C D;  2FSA A;  5JG6 A;  2KGG A;  3KW9 A;  4AXM A;  2VPD A;  1PBH A;  3NG2 A;  2Y5B A;  3FL2 A;  4CDE B;  5FEY A;  4LK9 A;  3M62 A;  4YBT A;  4MVT A;  2DCB A;  2FUI A;  2L43 A;  2ARY A;  4Q8H A;  3CBK A;  2O6X A;  2DC7 A;  2P0R A;  2PBH A;  3C9E A;  2ZET C;  4I7C A;  2CSZ A;  4CCG X;  2AU1 A;  4P6G A;  2WBF X;  1AU4 A;  1DEU A;  2F6N A;  2JMI A;  4AP4 A;  2RSD A;  2ECI A;  4FK5 A;  4MSX A;  2K4D A;  3PW3 A;  2MNZ A;  4MZS A;  3KV6 A;  4YVA A;  4YC9 A;  1EWM A;  1POP A;  2CT2 A;  2IPP B;  2FRA A;  3RPG B;  5B75 A;  2YJ2 A;  5TRB A;  3F75 A;  4K7C A;  3GCB A;  4P6E A;  2LXP C;  4GND A;  5B78 A;  2NQG A;  2L5U A;  2KGI A;  3T7L A;  1CHC A;  3KWB X;  4QF2 A;  2CKL A;  4BQV A;  2H7J A;  2FYE A;  2K17 A;  1PIP A;  3HTK C;  1CPJ A;  3WXE A;  3O36 A;  3KNV A;  1QXP A;  1NB3 A;  4OEM A;  4C9Z A;  1FH0 A;  2DZY A;  3E1Z B;  3PUQ A;  1F2B A;  2XB1 A;  2ACT A;  5DKA A;  2KWN A;  1ZCM A;  4MZO A;  4UP0 A;  3ASL A;  1STF E;  2G6Q A;  4X6I A;  3PHD A;  2DC9 A;  2MUM A;  2B1M A;  1Z2Q A;  5FER A;  3RVX A;  1KXR A;  3DPL R;  1U9Q X;  4N3W A;  5PAD A;  1KHP A;  4FIP A;  1A6R A;  3IV2 A;  1GLO A;  3O35 A;  2ECN A;  4QF3 A;  1AEC A;  1V87 A;  2M3H A;  3O70 A;  2FTD A;  1SP4 B;  1XWH A;  3BWK A;  1WEO A;  3U5P A;  2CSY A;  4HWY A;  1U6G B;  2LDR A;  3OVZ A;  5TBN A;  5G05 B;  2JQF R;  3O7A A;  5TAB A;  5D1L B;  1GCB A;  2KWO A;  1WEU A;  3ZTG A;  4ZUX U;  1WES A;  3LFY A;  4N8W A;  4XUI A;  4YYU A;  1BY8 A;  3O33 A;  2CIO A;  2FO5 A;  1WIL A;  4DMY A;  3U8E A;  4A4C A;  3L1Z B;  1PPD A;  3U5M A;  1JOC A;  4GNG A;  3N9O A;  4P5O B;  3ZUA A;  2YJ9 A;  1U9V A;  5KH7 A;  3SOW A;  4I7D A;  2YT5 A;  5TDW A;  3HD3 A;  5B76 A;  4I05 A;  1F2A A;  4UI9 B;  3ZVY A;  3N9P A;  1NQC A;  2K16 A;  3IHP A;  4CZW A;  1WEQ A;  4LLB A;  2D8S A;  3ZVZ B;  4UP5 A;  2AIM A;  5CHT A;  4BHW A;  2C2V S;  1KHQ A;  3QJ3 A;  5CVO B;  5H9M A;  2PAD A;  1F29 A;  1YAL A;  2FRQ A;  1PAD A;  2NQI A;  2VPE A;  1EWL A;  3IEJ A;  2DJG B;  3OIS A;  5EGW A;  3ZPV 1;  2CB5 A;  1U9W A;  5JA7 A;  4QBB A;  4CDC B;  4YAB A;  2BAY A;  4YYQ A;  2MA5 A;  2AN6 A;  1BGO A;  3QT4 A;  2R9F A;  4KLB A;  2Y43 A;  4IC2 A;  4AYC A;  4L7X A;  3LQJ A;  4I04 A;  2HD5 A;  3PBH A;  2E6R A;  2PUY A;  1WE9 A;  3P5W A;  2LGL A;  4BSQ A;  1CSB B;  1N87 A;  3L11 A;  3P5V A;  4YYV A;  3HCU A;  2QIC A;  5LKT A;  1EWO A;  1K2F A;  2MA6 A;  1M6D A;  4AYC B;  5H1T A;  2RI7 A;  5B77 A;  2KWJ A;  2LGG A;  3QZV A;  4OEL A;  2YRE A;  1CTE A;  5EF4 A;  2JMD A;  3K9M A;  5FB1 A;  2K1J A;  5D1K B;  2G6D A;  2BDZ A;  2H0D A;  1BP4 A;  2XU5 A;  1GMY A;  3RVV A;  3BOW A;  4A4B A;  1PPP A;  2VPG A;  2FUU A;  4YBS A;  1MIR A;  1HUC B;  4ZDT A;  4X6J A;  5CVM A;  2M6M A;  2VJF A;  1YK7 A;  2R9C A;  2L0B A;  2YHO A;  1PXV A;  4XI1 A;  2BDL A;  3KKU A;  3TNX A;  3LRQ A;  1TL9 A;  3V6E A;  2VP7 A;  3F5V A;  4V3L C;  4GNF A;  2DX8 A;  4B86 C;  3S3R A;  1MHW A;  3WXG A;  4BS6 A;  1MDW A;  4O64 A;  4PI3 A;  2JRJ A;  5FB0 A;  4AVX A;  3WXF A;  1WEM A;  4S3O C;  4ZQL A;  3IMA A;  5J3X A;  3CBJ A;  2HH5 A;  4DMX A;  2HYE D;  4W5C A;  2I50 A;  3KSE A;  3H8C A;  5AIU A;  2CKL B;  4CA1 A;  4YV8 A;  3T6R A;  1MS6 A;  2DCC A;  3S3Q A;  1PPN A;  2DZZ A;  5C13 A;  2YJ8 A;  1G25 A;  4PAD A;  3BCN A;  2AYO A;  1YT7 A;  1S4V A;  2R9M A;  3PUR A;  2LXH C;  2AUX A;  2DC8 A;  3IUT A;  3GL6 A;  4WZ2 A;  1CJL A;  3I06 A;  3AI8 A;  2MIQ A;  2VPB A;  2XEU A;  1Q6K A;  1U9X A;  2KU3 A;  1WIM A;  5TDR A;  2VJE A;  2P86 A;  1PE6 A;  3MTN A;  4WZ0 A;  2EOD A;  3CH3 X;  2R9O A;  1LDK C;  4YAX A;  4LJN A;  4PP1 A;  3I3T A;  2KE1 A;  2OP3 A;  2YW8 A;  1ICF A;  2GHU A;  4W5B A;  3CH2 X;  1QOL A;  1ZBD B;  2F1G A;  1BQI A;  3ZNI A;  5C11 A;  1NB5 A;  2YSM A;  3H7D A;  3O37 A;  2QIZ A;  2IDA A;  2B1N A;  4LKA A;  1NPZ A;  4QRV A;  1PPO A;  3KFQ A;  3O0U A;  4X6H A;  1MM3 A;  1TLO A;  4R7E A;  5LKU A;  6PAD A;  4NN2 A;  2GFO A;  1MEG A;  1E4U A;  5CVN B;  2AYN A;  4G54 A;  2FT2 A;  2QJ0 A;  1ZIV A;  3BPF A;  4N4F A;  4L58 A;  3KX1 A;  3L1X A;  4I7B A;  2XU3 A;  4YAT A;  1WEW A;  5B79 A;  1CV8 A;  5EYA F;  5F02 A;  2YYR A;  2NQA A;  2PNX A;  5B8D A;  2YQM A;  3P5X A;  3ERV A;  2HDP A;  1K3B B;  1RMD A;  4R2Y A;  2R9N A;  1Z60 A;  1WEP A;  3OF9 A;  2PNS A;  1KFU L;  2G45 A;  3RPG C;  3O34 A;  3ZPV E;  4W4U A;  5KH9 A;  2ATO A;  2AUZ A;  5K16 A;  2E02 A;  2FQ9 A;  3SHB A;  4V3K C;  2DCD A;  5JH3 A;  2DJF B;  1LDJ B;  2OZ2 A;  3U5N A;  4I07 A;  2MD7 B;  2YHN A;  2YUR A;  3N9N A;  4PPE A;  1JM7 A;  1X4J A; 
#chains in the Genus database with same CATH topology
 1Y08 A;  3EB5 A;  5K3Q A;  2CRW A;  3PRM A;  3V43 A;  3MTV A;  2IBI A;  2C2L A;  1TU6 A;  2XU4 A;  3N9M A;  2OUL A;  4PTB A;  4BOQ A;  2KRE A;  3KV5 A;  2MT5 A;  5LKZ A;  1XKG A;  4CDD B;  1VFY A;  3MJ5 A;  1WFK A;  5LCW B;  4FO9 A;  2G8E A;  2LN0 A;  4BPV A;  4YYR A;  2XU1 A;  3H89 A;  2E6S A;  3U5O A;  3N9Q A;  2F6J A;  3FJU B;  2L80 A;  3B79 A;  3LQH A;  4QH6 A;  2BU3 A;  1VD4 A;  4A49 A;  1MEM A;  5FPW A;  3K8U A;  1HYJ A;  1NL6 A;  4N4Z A;  4X3G A;  1AIM A;  5CHV A;  4FJC A;  2H0D B;  4QRX A;  2DC6 A;  1PVJ A;  2E01 A;  2Y1M A;  3N3G A;  1WEV A;  8PCH A;  3IOQ A;  5D1M B;  5KH3 A;  2YJB A;  3E9S A;  4BOS A;  1AYV A;  3FAO A;  3HCS A;  3PDF A;  3C5K A;  4XR7 A;  3SOU A;  2P7U A;  3BBA A;  2VJF B;  4XZX A;  2VHS A;  2YU4 A;  3DQV R;  2C0Y A;  2JRI A;  3DWD A;  5A24 A;  4H9D A;  1CQD A;  2JQG R;  3OVX A;  1X4U A;  1VYX A;  2M85 A;  1HYI A;  1X4I A;  3USV A;  4QQ4 A;  4A5U A;  4OGC A;  1CS8 A;  2KR4 A;  2JMJ A;  4Q6F A;  1AYU A;  1THE A;  2LQ6 A;  4YYW A;  1ITO A;  4Q8G A;  2F7D A;  1WEN A;  3HCT A;  5LKX A;  1AU0 A;  4F52 B;  1X9Y A;  4QRG A;  2L7P A;  5G04 B;  1CVZ A;  4Z0O A;  1AU3 A;  2AS8 A;  1KFX L;  1IYM A;  3PLW A;  1T1H A;  3RTR B;  1NLJ A;  5AIT A;  2XOZ A;  3GV4 A;  4IC3 A;  1IWD A;  2LGK A;  2EGM A;  2F42 A;  2YQL A;  1FP0 A;  2E00 A;  3H8B A;  5EZS A;  1AU2 A;  1DVP A;  2DSM A;  1VJV A;  4WA6 A;  2KIZ A;  4BBQ A;  3B21 A;  4R8P K;  1AYW A;  1DF0 A;  3OF8 A;  2VNF A;  2XP0 A;  3H6S A;  2MNY A;  2Y1N A;  3LXS A;  2LGV A;  5H1U A;  2G7Y A;  1SNK A;  2UZG A;  2AGA A;  1Z6U A;  3W31 A;  2ECW A;  2VJE B;  4YBM A;  2YVR A;  1FBV A;  1GEC E;  3N3K A;  2RR4 A;  1QDQ A;  3PNR A;  3TRK A;  4AUQ B;  2KFT A;  3P5U A;  3D6S A;  3RVW A;  1WGM A;  2G8J A;  4GB0 A;  4B7Y C;  1YK8 A;  2LV9 A;  4S3O B;  3O47 A;  1O0E A;  5I3L A;  1YZB A;  3MHH A;  3M63 A;  3FAN A;  2PRE A;  2L75 A;  5G0F A;  3EB6 A;  3KQI A;  1PCI A;  4GNE A;  4RY2 A;  4WZ3 B;  4BOZ A;  2ECJ A;  3N9L A;  4TKP B;  2HXZ A;  2YSJ A;  3MP2 A;  1ATK A;  1F62 A;  2ECV A;  2D8U A;  2ECT A;  2LRI C;  3K24 A;  4N79 A;  3KWZ A;  2KWK A;  3I2D A;  1QMY A;  1F2C A;  2G43 A;  4PT5 A;  3VK6 A;  2HHN A;  2R6N A;  1VSN A;  1Y4H A;  2NAA A;  2AVW A;  3HHA A;  1EF7 A;  3C6W A;  3HHI A;  7PCK A;  3PHU A;  3DF0 A;  3C0R A;  3PHX A;  2KYU A;  2YJC A;  2KKX A;  3NHE A;  3QSD A;  4BS5 A;  5SVY A;  3DDT A;  3BPM A;  2MD8 C;  4OVZ A;  1JQP A;  1MM2 A;  3MHS A;  2EGP A;  3V6C A;  3MOR A;  2ECG A;  4CDF B;  3LJU X;  3ZYQ A;  1CB5 A;  5H1V A;  1YVB A;  3BC3 A;  2FUD A;  5DIN A;  3LQI A;  2YUC A;  4AXL A;  3M99 A;  2NQD B;  2KKY A;  3HWN A;  4YYS A;  4YAD A;  1EWP A;  2EA6 A;  9PAP A;  4PP2 E;  3N4C A;  1ME3 A;  1BOR A;  1ME4 A;  2DCA A;  5J94 A;  1WEE A;  1U5I A;  2OXQ C;  3SOX A;  3O1G A;  2VHF A;  1JM7 B;  3KDE C;  4LAD B;  2E03 A;  2Y6E A;  3O65 A;  2M1R A;  4A0C D;  2FSA A;  5JG6 A;  2KGG A;  3KW9 A;  4AXM A;  2VPD A;  1PBH A;  3NG2 A;  2Y5B A;  3FL2 A;  4CDE B;  5FEY A;  4LK9 A;  2CRR A;  3M62 A;  4MVT A;  4YBT A;  2DCB A;  2FUI A;  2L43 A;  2ARY A;  3IFU A;  4Q8H A;  3CBK A;  2O6X A;  2DC7 A;  2P0R A;  2PBH A;  3C9E A;  5EZQ A;  2ZET C;  4I7C A;  2CSZ A;  4CCG X;  2AU1 A;  4P6G A;  2WBF X;  1AU4 A;  2OWA A;  1DEU A;  2F6N A;  2JMI A;  4AP4 A;  2HWK A;  2RSD A;  2ECI A;  4FK5 A;  4MSX A;  2K4D A;  3PW3 A;  2MNZ A;  4MZS A;  3KV6 A;  4YVA A;  4YC9 A;  1EWM A;  1POP A;  2CT2 A;  2IPP B;  2FRA A;  2CSV A;  3RPG B;  5B75 A;  2YJ2 A;  5TRB A;  3F75 A;  4K7C A;  3GCB A;  4P6E A;  2XOY A;  2LXP C;  4GND A;  5B78 A;  2NQG A;  2L5U A;  2KGI A;  3T7L A;  1CHC A;  3KWB X;  4QF2 A;  2CKL A;  4BQV A;  2EXU A;  4F1P A;  2H7J A;  2FYE A;  2K17 A;  1PIP A;  3HTK C;  3T9K A;  4D8I A;  1CPJ A;  3WXE A;  3O36 A;  3KNV A;  4Z0R A;  1QXP A;  1NB3 A;  4OEM A;  4C9Z A;  1FH0 A;  2DZY A;  3FM8 C;  3E1Z B;  3PUQ A;  1F2B A;  2XB1 A;  2ACT A;  5DKA A;  2KWN A;  1ZCM A;  4MZO A;  4UP0 A;  2FD4 A;  3ASL A;  1STF E;  2G6Q A;  4X6I A;  3PHD A;  2DC9 A;  2MUM A;  2B1M A;  1Z2Q A;  5FER A;  3RVX A;  1KXR A;  3DPL R;  4HXD B;  1U9Q X;  4N3W A;  5PAD A;  1KHP A;  4FIP A;  1A6R A;  3IV2 A;  1GLO A;  3O35 A;  2ECN A;  4QF3 A;  1AEC A;  1V87 A;  2M3H A;  3O70 A;  2FTD A;  1SP4 B;  1XWH A;  3BWK A;  2LAU A;  1WEO A;  3U5P A;  2CSY A;  4HWY A;  3RNV A;  1U6G B;  2LDR A;  3OVZ A;  5TBN A;  5G05 B;  2JQF R;  3O7A A;  5TAB A;  5D1L B;  1GCB A;  1MBM A;  2KWO A;  1WEU A;  3ZTG A;  4ZUX U;  1WES A;  3LFY A;  4N8W A;  4XUI A;  4RNA A;  4YYU A;  1BY8 A;  3O33 A;  2B0O E;  2CIO A;  2FO5 A;  1WIL A;  4DMY A;  2MKE A;  3U8E A;  4A4C A;  3L1Z B;  1PPD A;  3U5M A;  1JOC A;  4GNG A;  3N9O A;  4P5O B;  3ZUA A;  2E61 A;  5SVI A;  2YJ9 A;  1U9V A;  5KH7 A;  3SOW A;  4I7D A;  2YT5 A;  2P57 A;  5TDW A;  3HD3 A;  5B76 A;  4I05 A;  1F2A A;  4UI9 B;  2CON A;  3ZVY A;  3MDB C;  3N9P A;  2K16 A;  2DJA A;  3IHP A;  1NQC A;  4CZW A;  1WEQ A;  4LLB A;  2Z84 A;  2D8S A;  3ZVZ B;  4UP5 A;  2AIM A;  5CHT A;  4BHW A;  2C2V S;  1KHQ A;  5SVI B;  3QJ3 A;  5CVO B;  5H9M A;  2PAD A;  1F29 A;  1YAL A;  2FRQ A;  1PAD A;  2NQI A;  2VPE A;  1EWL A;  3IEJ A;  2DJG B;  3OIS A;  5EGW A;  3ZPV 1;  2DOS A;  2CB5 A;  1U9W A;  5JA7 A;  4QBB A;  4CDC B;  4YAB A;  2BAY A;  4YYQ A;  2MA5 A;  2AN6 A;  1BGO A;  3QT4 A;  2R9F A;  4M0W A;  4KLB A;  2Y43 A;  4IC2 A;  4AYC A;  4L7X A;  3W30 A;  3LQJ A;  4RKX A;  4OVZ B;  4I04 A;  2HD5 A;  3PBH A;  2E6R A;  2PUY A;  1WE9 A;  3P5W A;  2LGL A;  4BSQ A;  1CSB B;  1N87 A;  3L11 A;  3P5V A;  4YYV A;  3HCU A;  2QIC A;  3BY4 A;  5LKT A;  1EWO A;  1K2F A;  2MA6 A;  1M6D A;  4AYC B;  5H1T A;  2RI7 A;  5E6J A;  5B77 A;  2KWJ A;  2LGG A;  3QZV A;  4OEL A;  2YRE A;  1CTE A;  3OQC A;  5EF4 A;  5SVX A;  2JMD A;  3K9M A;  5FB1 A;  2K1J A;  5D1K B;  3Q1D A;  2BDZ A;  2H0D A;  2G6D A;  1BP4 A;  2XU5 A;  4IP3 A;  1GMY A;  3RVV A;  3BOW A;  4A4B A;  1PPP A;  2VPG A;  2FUU A;  3M7K A;  4YBS A;  1MIR A;  1HUC B;  4ZDT A;  4X6J A;  5CVM A;  2M6M A;  2VJF A;  1YK7 A;  2R9C A;  2L0B A;  2YHO A;  1PXV A;  4XI1 A;  2BDL A;  3KKU A;  3TNX A;  3LRQ A;  1TL9 A;  2XOC A;  3V6E A;  2VP7 A;  3LVQ E;  3F5V A;  4GNF A;  2DX8 A;  4V3L C;  4B86 C;  3S3R A;  1MHW A;  3WXG A;  4BS6 A;  1MDW A;  4O64 A;  2J7Q C;  4PI3 A;  2JRJ A;  5FB0 A;  4AVX A;  3WXF A;  1WEM A;  4S3O C;  4ZQL A;  4P16 A;  3TMP A;  3IMA A;  5J3X A;  3CBJ A;  2HH5 A;  4DMX A;  2HYE D;  4W5C A;  2I50 A;  3KSE A;  3H8C A;  5AIU A;  2CKL B;  4CA1 A;  4YV8 A;  3T6R A;  1MS6 A;  2DCC A;  4GUA A;  3S3Q A;  1PPN A;  4RF1 A;  2DZZ A;  5C13 A;  3H7H A;  2YJ8 A;  1G25 A;  1UKF A;  4PAD A;  5JZE A;  3BCN A;  2AYO A;  4RF0 A;  1YT7 A;  4MI7 A;  1S4V A;  4D8E A;  2R9M A;  3PUR A;  2LXH C;  2AUX A;  2DC8 A;  2FFW A;  3IUT A;  3GL6 A;  4WZ2 A;  1CJL A;  3I06 A;  3AI8 A;  2MIQ A;  2VPB A;  2JM3 A;  2XEU A;  1Q6K A;  1U9X A;  2FE8 A;  2KU3 A;  1WIM A;  5TDR A;  2VJE A;  2P86 A;  3ZNH A;  1PE6 A;  3MTN A;  4WZ0 A;  2EOD A;  3CH3 X;  2R9O A;  3PHW A;  1LDK C;  4YAX A;  4LJN A;  4PP1 A;  3I3T A;  3SUB A;  2KE1 A;  2BTW A;  2J7Q A;  2YW8 A;  2OP3 A;  1ICF A;  2GHU A;  3LVR E;  4W5B A;  5KO3 A;  3CH2 X;  1QOL A;  1ZBD B;  2F1G A;  1BQI A;  3ZNI A;  5C11 A;  1NB5 A;  2YSM A;  3H7D A;  3O37 A;  4R3D A;  2QIZ A;  2IDA A;  2B1N A;  4IUM A;  4LKA A;  2M13 A;  4BOU A;  4ZTB A;  1NPZ A;  4QRV A;  1PPO A;  2BTW B;  3KFQ A;  3O0U A;  4OW0 A;  1DKI A;  4X6H A;  1MM3 A;  1TLO A;  4R7E A;  5LKU A;  2JUN A;  6PAD A;  2JTC A;  4NN2 A;  3FEH A;  3BB7 A;  2GFO A;  1MEG A;  3PT2 A;  1E4U A;  5CVN B;  2AYN A;  4G54 A;  2FT2 A;  2QJ0 A;  3JUE A;  1ZIV A;  3BPF A;  4N4F A;  4L58 A;  3KX1 A;  4REZ A;  3L1X A;  4I7B A;  3PRP A;  2XU3 A;  4YAT A;  1WEW A;  5B79 A;  1CV8 A;  5EYA F;  5F02 A;  2YYR A;  2NQA A;  2PNX A;  5B8D A;  2YQM A;  3PSE A;  3P5X A;  3ERV A;  2HDP A;  1K3B B;  1RMD A;  4MM3 B;  4R2Y A;  1DCQ A;  4BOP A;  2R9N A;  1Z60 A;  1WEP A;  3OF9 A;  2PNS A;  1KFU L;  2G45 A;  3E2D A;  3RPG C;  4D8B A;  3O34 A;  3ZPV E;  4WUR A;  4W4U A;  5KH9 A;  2ATO A;  2AUZ A;  2IQJ A;  5K16 A;  2E02 A;  2FQ9 A;  3SHB A;  4V3K C;  2DCD A;  5JH3 A;  2DJF B;  1LDJ B;  2OZ2 A;  3U5N A;  4I07 A;  4O62 A;  2UZJ A;  4OGE A;  3LDY A;  2MD7 B;  2YHN A;  2YUR A;  3N9N A;  4PPE A;  1JM7 A;  1X4J A; 
#chains in the Genus database with same CATH homology
 1Y08 A;  3EB5 A;  3V43 A;  2IBI A;  2C2L A;  1TU6 A;  2XU4 A;  3N9M A;  2OUL A;  4PTB A;  2KRE A;  3KV5 A;  2MT5 A;  5LKZ A;  1XKG A;  4CDD B;  1VFY A;  4BPV A;  1WFK A;  5LCW B;  4FO9 A;  2G8E A;  2LN0 A;  4YYR A;  2XU1 A;  3H89 A;  2E6S A;  3U5O A;  3N9Q A;  2F6J A;  3B79 A;  2L80 A;  3LQH A;  4QH6 A;  1VD4 A;  4A49 A;  1MEM A;  5FPW A;  3K8U A;  1HYJ A;  1NL6 A;  4N4Z A;  4X3G A;  1AIM A;  5CHV A;  4FJC A;  2H0D B;  4QRX A;  2DC6 A;  2E01 A;  2Y1M A;  3N3G A;  1WEV A;  8PCH A;  3IOQ A;  5D1M B;  5KH3 A;  2YJB A;  1AYV A;  3HCS A;  3PDF A;  3C5K A;  4XR7 A;  3SOU A;  2P7U A;  2VJF B;  2VHS A;  2YU4 A;  3DQV R;  2C0Y A;  5A24 A;  1CQD A;  2JQG R;  3OVX A;  1X4U A;  1VYX A;  2M85 A;  1HYI A;  1X4I A;  3USV A;  1CS8 A;  2KR4 A;  2JMJ A;  4Q6F A;  1AYU A;  1THE A;  2LQ6 A;  4YYW A;  1ITO A;  2VFC A;  2F7D A;  1WEN A;  4Q8G A;  3HCT A;  5LKX A;  1AU0 A;  4F52 B;  1X9Y A;  4QRG A;  5G04 B;  1CVZ A;  1AU3 A;  2AS8 A;  1KFX L;  1IYM A;  1T1H A;  3RTR B;  1NLJ A;  5AIT A;  4IC3 A;  3GV4 A;  1IWD A;  2LGK A;  2F42 A;  2YQL A;  3H8B A;  1FP0 A;  2E00 A;  1AU2 A;  1DVP A;  1VJV A;  4WA6 A;  2KIZ A;  4BBQ A;  4R8P K;  1AYW A;  1DF0 A;  3OF8 A;  2VNF A;  3H6S A;  2MNY A;  2Y1N A;  3LXS A;  2LGV A;  5H1U A;  2G7Y A;  1SNK A;  2UZG A;  1Z6U A;  2ECW A;  2VJE B;  4YBM A;  1FBV A;  1GEC E;  3N3K A;  1QDQ A;  3PNR A;  4AUQ B;  2KFT A;  4BGF A;  3P5U A;  3D6S A;  3RVW A;  1WGM A;  2G8J A;  4GB0 A;  4B7Y C;  1YK8 A;  2LV9 A;  4S3O B;  1O0E A;  5I3L A;  3MHH A;  3M63 A;  2PRE A;  2L75 A;  5G0F A;  3EB6 A;  3KQI A;  1PCI A;  4GNE A;  4RY2 A;  4WZ3 B;  4B55 A;  2ECJ A;  3N9L A;  4TKP B;  2HXZ A;  2YSJ A;  1ATK A;  1F62 A;  2ECV A;  2ECT A;  2LRI C;  3K24 A;  4N79 A;  3KWZ A;  2KWK A;  3I2D A;  1QMY A;  1F2C A;  2G43 A;  3VK6 A;  2HHN A;  2R6N A;  1VSN A;  1Y4H A;  2NAA A;  2AVW A;  3HHA A;  1EF7 A;  3C6W A;  3HHI A;  7PCK A;  3DF0 A;  2KYU A;  2YJC A;  3NHE A;  3QSD A;  4NV7 A;  1W5R A;  4BS5 A;  3BPM A;  2MD8 C;  1JQP A;  1MM2 A;  3MHS A;  2EGP A;  3V6C A;  3MOR A;  2ECG A;  4CDF B;  3ZYQ A;  1CB5 A;  5H1V A;  1YVB A;  3BC3 A;  2FUD A;  5DIN A;  3LQI A;  2YUC A;  4AXL A;  3M99 A;  2NQD B;  3HWN A;  4YYS A;  4YAD A;  1EWP A;  2EA6 A;  9PAP A;  4PP2 E;  3N4C A;  1ME3 A;  1W6F A;  1BOR A;  1ME4 A;  2DCA A;  5J94 A;  1WEE A;  1U5I A;  2OXQ C;  3SOX A;  3O1G A;  2VHF A;  1JM7 B;  4LAD B;  2E03 A;  2Y6E A;  2M1R A;  4A0C D;  2FSA A;  5JG6 A;  2KGG A;  3KW9 A;  4AXM A;  2VPD A;  1PBH A;  3NG2 A;  2Y5B A;  3FL2 A;  4CDE B;  5FEY A;  4LK9 A;  3M62 A;  4YBT A;  4MVT A;  2DCB A;  2FUI A;  2L43 A;  2ARY A;  4Q8H A;  3CBK A;  2O6X A;  2DC7 A;  2P0R A;  2PBH A;  3C9E A;  2ZET C;  4I7C A;  2CSZ A;  4CCG X;  2AU1 A;  4P6G A;  1E2T A;  2WBF X;  1AU4 A;  1DEU A;  2F6N A;  2JMI A;  4AP4 A;  2RSD A;  2ECI A;  4FK5 A;  4MSX A;  2K4D A;  3PW3 A;  2MNZ A;  3LTW A;  3KV6 A;  4MZS A;  4YVA A;  4YC9 A;  1EWM A;  1POP A;  2CT2 A;  2IPP B;  2FRA A;  3RPG B;  5B75 A;  2YJ2 A;  5TRB A;  3F75 A;  4K7C A;  3GCB A;  4P6E A;  1W4T A;  2LXP C;  4GND A;  5B78 A;  2NQG A;  2L5U A;  2KGI A;  3T7L A;  1CHC A;  3KWB X;  4QF2 A;  2CKL A;  4BQV A;  2H7J A;  2FYE A;  2K17 A;  1PIP A;  3HTK C;  1CPJ A;  3WXE A;  3O36 A;  3KNV A;  1QXP A;  1NB3 A;  4OEM A;  4C9Z A;  1FH0 A;  2DZY A;  3E1Z B;  3PUQ A;  1F2B A;  2XB1 A;  2ACT A;  5DKA A;  2KWN A;  1ZCM A;  4MZO A;  4NV8 A;  4UP0 A;  3ASL A;  1STF E;  2G6Q A;  4X6I A;  3PHD A;  2DC9 A;  2MUM A;  2B1M A;  1Z2Q A;  5FER A;  3RVX A;  1KXR A;  3DPL R;  1U9Q X;  4N3W A;  5PAD A;  1KHP A;  4FIP A;  1A6R A;  3IV2 A;  1GLO A;  3O35 A;  2ECN A;  4QF3 A;  1AEC A;  1V87 A;  2M3H A;  3O70 A;  2FTD A;  1SP4 B;  1XWH A;  3BWK A;  1WEO A;  3U5P A;  2CSY A;  4HWY A;  1U6G B;  2LDR A;  3OVZ A;  5TBN A;  5G05 B;  2JQF R;  3O7A A;  5TAB A;  5D1L B;  1GCB A;  2KWO A;  4C5P A;  1WEU A;  3ZTG A;  4ZUX U;  1WES A;  3LFY A;  4N8W A;  4XUI A;  4YYU A;  1BY8 A;  3O33 A;  2CIO A;  2FO5 A;  1WIL A;  4DMY A;  3U8E A;  4A4C A;  3L1Z B;  1PPD A;  3U5M A;  1JOC A;  4GNG A;  3N9O A;  4P5O B;  3ZUA A;  2YJ9 A;  1U9V A;  5KH7 A;  3SOW A;  4I7D A;  2YT5 A;  5TDW A;  3HD3 A;  5B76 A;  4I05 A;  1F2A A;  4UI9 B;  3ZVY A;  3N9P A;  1NQC A;  2K16 A;  3IHP A;  1GX3 A;  4CZW A;  1WEQ A;  4LLB A;  2D8S A;  3ZVZ B;  4UP5 A;  2AIM A;  5CHT A;  4BHW A;  2C2V S;  1KHQ A;  3QJ3 A;  5CVO B;  5H9M A;  2PAD A;  1F29 A;  1YAL A;  2FRQ A;  1PAD A;  2NQI A;  2VPE A;  1EWL A;  3IEJ A;  2DJG B;  3OIS A;  5EGW A;  3ZPV 1;  2CB5 A;  1U9W A;  5JA7 A;  4QBB A;  4CDC B;  4YAB A;  2BAY A;  4YYQ A;  2MA5 A;  2AN6 A;  1BGO A;  3QT4 A;  2R9F A;  4KLB A;  2Y43 A;  4IC2 A;  4AYC A;  4L7X A;  3LQJ A;  4I04 A;  2HD5 A;  3PBH A;  2E6R A;  2PUY A;  1WE9 A;  3P5W A;  2LGL A;  4BSQ A;  1CSB B;  1N87 A;  3L11 A;  3P5V A;  4YYV A;  3HCU A;  2QIC A;  5LKT A;  1EWO A;  1K2F A;  2MA6 A;  1M6D A;  4AYC B;  5H1T A;  2RI7 A;  5B77 A;  2KWJ A;  2LGG A;  3QZV A;  4OEL A;  2YRE A;  1CTE A;  5EF4 A;  2JMD A;  3K9M A;  5FB1 A;  2K1J A;  5D1K B;  2G6D A;  2BDZ A;  2H0D A;  1BP4 A;  2XU5 A;  1GMY A;  3RVV A;  3BOW A;  4A4B A;  1PPP A;  2VPG A;  2FUU A;  4YBS A;  1MIR A;  1HUC B;  4ZDT A;  4X6J A;  5CVM A;  2M6M A;  2VJF A;  1YK7 A;  2R9C A;  2L0B A;  2YHO A;  1PXV A;  4XI1 A;  2BDL A;  3KKU A;  3TNX A;  3LRQ A;  1TL9 A;  3V6E A;  2VP7 A;  3F5V A;  4V3L C;  4GNF A;  2DX8 A;  4B86 C;  3S3R A;  1MHW A;  3WXG A;  4BS6 A;  1MDW A;  4O64 A;  4PI3 A;  2JRJ A;  5FB0 A;  4AVX A;  3WXF A;  1WEM A;  4S3O C;  4ZQL A;  3IMA A;  5J3X A;  3CBJ A;  2HH5 A;  4DMX A;  2HYE D;  4W5C A;  2I50 A;  3KSE A;  3H8C A;  5AIU A;  2CKL B;  4CA1 A;  4YV8 A;  3T6R A;  1MS6 A;  2DCC A;  3S3Q A;  1PPN A;  2DZZ A;  5C13 A;  2YJ8 A;  1G25 A;  4PAD A;  3BCN A;  2AYO A;  1YT7 A;  1S4V A;  2R9M A;  3PUR A;  2LXH C;  2AUX A;  2DC8 A;  3IUT A;  3GL6 A;  4WZ2 A;  1CJL A;  3I06 A;  3AI8 A;  3D9W A;  2MIQ A;  2VPB A;  2XEU A;  1Q6K A;  1U9X A;  2KU3 A;  1WIM A;  5TDR A;  2VJE A;  2P86 A;  1PE6 A;  3MTN A;  4WZ0 A;  2EOD A;  3CH3 X;  2R9O A;  1LDK C;  4YAX A;  4LJN A;  4PP1 A;  3I3T A;  2KE1 A;  2OP3 A;  2YW8 A;  1ICF A;  2GHU A;  4W5B A;  3CH2 X;  1QOL A;  1ZBD B;  2F1G A;  1BQI A;  3ZNI A;  5C11 A;  1NB5 A;  2YSM A;  3H7D A;  3O37 A;  2QIZ A;  2IDA A;  2B1N A;  4LKA A;  1NPZ A;  4QRV A;  1PPO A;  3KFQ A;  3O0U A;  4X6H A;  1MM3 A;  1TLO A;  4R7E A;  5LKU A;  6PAD A;  4NN2 A;  2GFO A;  1MEG A;  1E4U A;  5CVN B;  2AYN A;  4GUZ A;  4G54 A;  2FT2 A;  2QJ0 A;  1ZIV A;  3BPF A;  4N4F A;  4L58 A;  3KX1 A;  3L1X A;  4I7B A;  2XU3 A;  4YAT A;  1WEW A;  5B79 A;  1CV8 A;  5EYA F;  5F02 A;  2YYR A;  2NQA A;  2PNX A;  5B8D A;  2YQM A;  3P5X A;  3ERV A;  2HDP A;  1K3B B;  1RMD A;  2BSZ A;  4R2Y A;  2R9N A;  1Z60 A;  1WEP A;  3OF9 A;  2PNS A;  1KFU L;  2G45 A;  3RPG C;  3O34 A;  3ZPV E;  4W4U A;  5KH9 A;  2ATO A;  2AUZ A;  5K16 A;  2E02 A;  2VFB A;  2FQ9 A;  3SHB A;  4V3K C;  2DCD A;  5JH3 A;  2DJF B;  1LDJ B;  2OZ2 A;  3U5N A;  4I07 A;  2MD7 B;  2YHN A;  2YUR A;  3N9N A;  4PPE A;  1JM7 A;  1X4J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...