3KWBX

Structure of catk covalently bound to a dioxo-triazine inhibitor
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
215
structure length
215
Chain Sequence
b'APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cathepsin K
publication title Dioxo-triazines as a novel series of cathepsin K inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 62
structure length 215
sequence length 215
chains with identical sequence Y
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2009-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3kwbX00
3RVXA 3KW9A 1STFE 5EF4A 1QOLA 1Y08A 1AU4A 2G8JA 1PPNA 4PI3A 4N8WA 2DJFB 4YYVA 4BS6A 1PPOA 4CDFB 3IEJA 3ZUAA 2FQ9A 2AUXA 3NHEA 2IBIA 2XU3A 3B79A 1NLJA 1F29A 4OELA 3IHPA 3PBHA 1TLOA 3K24A 1CV8A 2IPPB 4X6JA 3U8EA 2FUDA 2E03A 4QRXA 5PADA 4P6GA 4X6HA 4MZSA 1PBHA 4YYSA 4Q8HA 2NQGA 1PADA 2JQGR 3MHSA 3RVVA 3USVA 3P5XA 3F5VA 3BWKA 3K8UA 3LXSA 2C0YA 3V6EA 4MZOA 3MTNA 5J94A 4HWYA 1VSNA 5CVMA 1KHPA 2DCAA 2HD5A 1QMYA 2JQFR 3E1ZB 1EWLA 3I3TA 3N3GA 3IV2A 1CB5A 1ME4A 2R6NA 6PADA 3P5WA 2ATOA 1YK8A 3D6SA 1CSBB 1MIRA 2WBFX 1K3BB 5CHTA 2R9CA 2P86A 1O0EA 1CS8A 3DF0A 1NQCA 5JA7A 3K9MA 2BDLA 2NQDB 1AU3A 4P6EA 1GCBA 4K7CA 5CVNB 4BPVA 4CDEB 1CJLA 1U5IA 4I07A 1MHWA 4PP2E 1THEA 4KLBA 4YYWA 1EF7A 2FRQA 2OP3A 2HH5A 1CTEA 3S3RA 2G7YA 2G6DA 1AYVA 1F2BA 2DCCA 2E02A 5EGWA 3CH2X 2CIOA 2DZZA 3TNXA 2OZ2A 2PBHA 1IWDA 2DZYA 1DF0A 2PREA 3OVZA 3N4CA 1GLOA 4YYUA 4N4ZA 3WXFA 3HHAA 5K16A 1EWPA 1SNKA 3P5VA 1AECA 4N79A 2ACTA 1NPZA 3O1GA 2PADA 2DC6A 1QDQA 5CHVA 3KWZA 4XR7A 4QRVA 3KX1A 3BOWA 3PNRA 1KFUL 2YJ8A 1X9YA 2YJ9A 2NQAA 3IMAA 1PE6A 1AYWA 4I05A 2YJCA 3KFQA 2GHUA 1MDWA 1QXPA 2YJBA 3BCNA 2R9OA 2XU5A 3WXGA 3MHHA 2R9NA 2FRAA 4FJCA 2B1MA 3CBJA 2GFOA 3KKUA 4Q8GA 3CBKA 2FO5A 2HHNA 4YVAA 1VJVA 4WA6A 3OF8A 1MS6A 1ZIVA 3BC3A 3QJ3A 2F7DA 1BQIA 1ATKA 1EWMA 2FYEA 5F02A 3AI8A 3H7DA 5A24A 2XU1A 4YYQA 3PDFA 2DC7A 3O0UA 3S3QA 3CH3X 4BS5A 2Y6EA 3I06A 1YALA 4AXMA 1ME3A 5FPWA 1JQPA 1PCIA 3IUTA 1SP4B 4QH6A 2OULA 2P0RA 2AIMA 2CB5A 3BPFA 1GMYA 1MEMA 1ICFA 3M99A 4BSQA 3ERVA 4PP1A 3OF9A 7PCKA 2AU1A 3WXEA 2H7JA 3KSEA 2R9FA 3H89A 9PAPA 3GCBA 4I04A 1U9WA 1PPPA 4PADA 1U9QX 2E00A 1TU6A 2F1GA 4QRGA 1CVZA 1YK7A 1U9XA 1EWOA 4YV8A 2R9MA 3OVXA 1A6RA 4W5CA 2DJGB 1ZCMA 2Y5BA 1NL6A 1ITOA 2PNSA 3LFYA 1AU2A 1YVBA 2YJ2A 1AYUA 1Y4HA 4FK5A 4RY2A 4FIPA 2O6XA 5CVOB 1PXVA 2DC9A 2B1NA 3HD3A 1PIPA 2VHSA 3BPMA 1AIMA 4ZUXU 3F75A 3V6CA 1KHQA 2P7UA 2G8EA 4W5BA 5JH3A 1CPJA 3PW3A 1NB5A 3KWBX 3QSDA 4X6IA 4CDDB 2NQIA 1TL9A 4DMYA 1HUCB 2DC8A 1GECE 2VHFA 3MORA 2AYNA 2E01A 4QBBA 2AVWA 1BY8A 1MEGA 4DMXA 2FTDA 2DCBA 1NB3A 1XKGA 1Q6KA 1AU0A 2DCDA 2FT2A 3C9EA 1YT7A 2HXZA 1KFXL 1FH0A 1KXRA 1U9VA 2AUZA 4G54A 1DEUA 1CQDA 2XU4A 1F2AA 4OEMA 3IOQA 4W4UA 1M6DA 3H8CA 8PCHA 2AS8A 4XUIA 2BDZA 1S4VA 3N3KA 3QT4A 4CZWA 3RVWA 2ARYA 1PPDA 3H6SA 4MSXA 4AXLA 3OISA 4YYRA 3HHIA 1BGOA 1F2CA 3H8BA 3HWNA 1BP4A 3P5UA 4CDCB 1POPA 2AYOA 4BQVA
chains in the Genus database with same CATH superfamily
3RVXA 3KW9A 4IP3A 1STFE 5EF4A 1QOLA 1Y08A 1AU4A 2JTCA 2G8JA 1PPNA 4PI3A 4N8WA 2DJFB 4YYVA 4BS6A 1PPOA 4CDFB 3IEJA 4REZA 3ZUAA 2FQ9A 2AUXA 3NHEA 4RF1A 2IBIA 1YZBA 4OW0A 3PT2A 2XU3A 3B79A 1NLJA 1F29A 4OELA 3MJ5A 3IHPA 3PBHA 1TLOA 3K24A 5E6JA 4MI7A 1CV8A 2IPPB 4X6JA 3U8EA 2FUDA 2E03A 4QRXA 5PADA 4P6GA 4X6HA 4MZSA 1PBHA 4YYSA 4Q8HA 2NQGA 1PADA 2JQGR 3MHSA 3RVVA 5EZSA 3USVA 3P5XA 3F5VA 3BWKA 3K8UA 3LXSA 4D8BA 2C0YA 3V6EA 4MZOA 3MTNA 5J94A 4HWYA 1VSNA 2Z84A 3BY4A 5CVMA 4ZTBA 1KHPA 3C0RA 2DCAA 2HD5A 1QMYA 2JQFR 3E1ZB 1EWLA 3I3TA 3N3GA 3IV2A 1CB5A 1ME4A 2R6NA 6PADA 3P5WA 2ATOA 1YK8A 1DKIA 3D6SA 1CSBB 1MIRA 2WBFX 1K3BB 5CHTA 2R9CA 2P86A 1O0EA 1CS8A 4D8IA 3DF0A 1NQCA 4MM3B 5JA7A 3K9MA 2BDLA 2NQDB 4WURA 1AU3A 4P6EA 1GCBA 4K7CA 2AGAA 5CVNB 4BPVA 4CDEB 1CJLA 1U5IA 2DOSA 4I07A 1MHWA 4PP2E 3PHWA 5EZQA 1THEA 4KLBA 4YYWA 1EF7A 2FRQA 4A5UA 2OP3A 2HH5A 1CTEA 3S3RA 2G7YA 2G6DA 1AYVA 1F2BA 2DCCA 2E02A 5EGWA 3CH2X 2CIOA 2DZZA 3TNXA 2OZ2A 2PBHA 1IWDA 2DZYA 1DF0A 2J7QA 2PREA 3OVZA 3N4CA 1GLOA 4YYUA 4N4ZA 3WXFA 3HHAA 5K16A 1EWPA 4P16A 1SNKA 4BOUA 3P5VA 4PT5A 1AECA 4N79A 2ACTA 5JZEA 1NPZA 3O1GA 2PADA 2DC6A 1QDQA 5CHVA 3KWZA 4XR7A 4QRVA 3KX1A 3BOWA 3PNRA 4IUMA 1KFUL 2YJ8A 3PRMA 4R3DA 1X9YA 2YJ9A 2NQAA 3IMAA 1PE6A 1AYWA 3PRPA 4I05A 2YJCA 3KFQA 3BBAA 2GHUA 1MDWA 1QXPA 2YJBA 3BCNA 2R9OA 2XU5A 3WXGA 3MHHA 2R9NA 2BTWB 1PVJA 2FRAA 4FJCA 2B1MA 3CBJA 2GFOA 3KKUA 4Q8GA 3CBKA 2FO5A 2HHNA 4YVAA 1VJVA 2HWKA 4RNAA 4WA6A 3OF8A 4RF0A 1MS6A 1ZIVA 3BC3A 3QJ3A 2F7DA 1BQIA 1ATKA 1EWMA 4BOPA 2FYEA 5F02A 3AI8A 3H7DA 5A24A 1UKFA 2XU1A 4YYQA 3TRKA 3PDFA 2DC7A 3O0UA 3S3QA 2BTWA 3TMPA 3CH3X 4BS5A 2Y6EA 3I06A 1YALA 4AXMA 1ME3A 5FPWA 1JQPA 1PCIA 3IUTA 1SP4B 4QH6A 4BOSA 2J7QC 2OULA 2P0RA 2AIMA 2CB5A 3BPFA 1GMYA 1MEMA 1ICFA 3M99A 4BSQA 3ERVA 4PP1A 3OF9A 7PCKA 3MTVA 2AU1A 3WXEA 2H7JA 3KSEA 2R9FA 3H89A 9PAPA 3GCBA 4I04A 4XZXA 1U9WA 3PHXA 1PPPA 4PADA 3W31A 1U9QX 2E00A 1TU6A 2F1GA 3O65A 2UZJA 4BOZA 2FE8A 1CVZA 4QRGA 1YK7A 1U9XA 1EWOA 4YV8A 2R9MA 3OVXA 1A6RA 4W5CA 2DJGB 1ZCMA 2Y5BA 1NL6A 1ITOA 2PNSA 3LFYA 1AU2A 1YVBA 2YJ2A 1AYUA 1Y4HA 4FK5A 4RY2A 4FIPA 2O6XA 4RKXA 5CVOB 1PXVA 4HXDB 2DC9A 2B1NA 3HD3A 1PIPA 2VHSA 3BPMA 1AIMA 4ZUXU 4BOQA 3PSEA 3F75A 3V6CA 1KHQA 2P7UA 2G8EA 4W5BA 3W30A 3IFUA 5JH3A 1CPJA 3PW3A 1NB5A 3KWBX 3QSDA 4D8EA 4X6IA 4CDDB 2NQIA 1TL9A 4DMYA 1HUCB 2DC8A 1GECE 2JRIA 2VHFA 3ZNHA 3MORA 2AYNA 2E01A 4QBBA 2AVWA 1BY8A 1MEGA 4DMXA 3E9SA 2FTDA 2DCBA 1NB3A 3BB7A 1XKGA 1Q6KA 3B21A 1AU0A 2DCDA 2FT2A 3C9EA 1YT7A 2HXZA 1KFXL 3RNVA 1FH0A 1KXRA 1U9VA 2AUZA 4GUAA 4G54A 1DEUA 1CQDA 2XU4A 1F2AA 4OEMA 3IOQA 4W4UA 1M6DA 3PHUA 4M0WA 3H8CA 4OVZB 8PCHA 2AS8A 4XUIA 2BDZA 1S4VA 3N3KA 3QT4A 4CZWA 3RVWA 2ARYA 3OQCA 1PPDA 2BU3A 3H6SA 4MSXA 4AXLA 3OISA 4YYRA 3HHIA 1BGOA 1F2CA 3H8BA 3HWNA 3MP2A 1BP4A 4OVZA 3P5UA 4CDCB 1POPA 5KO3A 2AYOA 4BQVA
chains in the Genus database with same CATH topology
3RVXA 3KW9A 1STFE 5EF4A 1QOLA 1Y08A 1AU4A 2G8JA 1PPNA 1W4TA 4PI3A 4N8WA 2DJFB 4YYVA 4BS6A 1PPOA 4CDFB 3IEJA 3ZUAA 2FQ9A 2AUXA 3NHEA 2IBIA 2XU3A 3B79A 1NLJA 1F29A 4OELA 1GX3A 2BSZA 3IHPA 3PBHA 1TLOA 3K24A 1CV8A 2IPPB 4X6JA 3U8EA 2FUDA 2E03A 4QRXA 5PADA 4P6GA 4X6HA 4MZSA 1PBHA 4YYSA 4Q8HA 2NQGA 1PADA 2JQGR 3MHSA 3RVVA 3USVA 3P5XA 3F5VA 3BWKA 3K8UA 3LXSA 2C0YA 3V6EA 4MZOA 3MTNA 5J94A 4HWYA 1VSNA 5CVMA 1KHPA 2DCAA 2HD5A 1QMYA 2JQFR 3E1ZB 1EWLA 3I3TA 3N3GA 3IV2A 1CB5A 1ME4A 2R6NA 6PADA 3P5WA 2ATOA 1YK8A 3D6SA 1CSBB 1MIRA 2WBFX 1K3BB 5CHTA 2R9CA 2P86A 1O0EA 1CS8A 3DF0A 1NQCA 2VFBA 5JA7A 3K9MA 2BDLA 2NQDB 1AU3A 4P6EA 1GCBA 4K7CA 5CVNB 4BPVA 4CDEB 1CJLA 1U5IA 4I07A 1MHWA 4PP2E 1THEA 4KLBA 4NV7A 4YYWA 1EF7A 2FRQA 2OP3A 2HH5A 1CTEA 3S3RA 2G7YA 2G6DA 1AYVA 1F2BA 2DCCA 2E02A 5EGWA 3CH2X 2CIOA 2DZZA 3TNXA 2OZ2A 2PBHA 1IWDA 2DZYA 1DF0A 2PREA 3OVZA 3N4CA 1GLOA 4YYUA 4N4ZA 3WXFA 3HHAA 5K16A 1EWPA 1SNKA 3P5VA 1AECA 4N79A 2ACTA 1NPZA 3O1GA 2PADA 2DC6A 1QDQA 5CHVA 3KWZA 4XR7A 4QRVA 3KX1A 3BOWA 3PNRA 1KFUL 1E2TA 2YJ8A 1X9YA 2YJ9A 2NQAA 3IMAA 1PE6A 1AYWA 4I05A 2YJCA 3KFQA 2GHUA 1MDWA 1QXPA 2YJBA 3BCNA 2R9OA 2XU5A 3WXGA 3MHHA 2R9NA 2FRAA 4FJCA 2B1MA 3CBJA 2GFOA 3KKUA 4Q8GA 3CBKA 2FO5A 2HHNA 3LTWA 4YVAA 1VJVA 4WA6A 3OF8A 1MS6A 1ZIVA 3BC3A 3QJ3A 2F7DA 1BQIA 1ATKA 1EWMA 2FYEA 5F02A 3AI8A 3H7DA 5A24A 2XU1A 4YYQA 3PDFA 2DC7A 3O0UA 3S3QA 4C5PA 3CH3X 4BS5A 2Y6EA 3I06A 1YALA 4AXMA 1ME3A 5FPWA 1JQPA 1PCIA 3IUTA 1SP4B 4QH6A 2OULA 2P0RA 2AIMA 2CB5A 3BPFA 1GMYA 1MEMA 1ICFA 3M99A 4BSQA 3ERVA 4PP1A 3OF9A 7PCKA 2AU1A 3WXEA 2H7JA 3KSEA 2R9FA 3H89A 9PAPA 3GCBA 4I04A 1U9WA 1PPPA 4PADA 1U9QX 2E00A 1TU6A 2F1GA 4GUZA 1CVZA 4QRGA 1YK7A 1U9XA 1EWOA 4YV8A 2R9MA 3OVXA 1A6RA 4W5CA 2DJGB 1ZCMA 2Y5BA 4NV8A 1NL6A 1ITOA 2PNSA 3LFYA 1AU2A 1YVBA 2YJ2A 1AYUA 1Y4HA 1W6FA 4FK5A 4RY2A 4FIPA 2O6XA 5CVOB 1PXVA 2DC9A 2B1NA 3HD3A 1PIPA 2VHSA 3BPMA 1AIMA 4ZUXU 1W5RA 3F75A 3V6CA 1KHQA 2P7UA 2G8EA 4W5BA 5JH3A 1CPJA 3PW3A 1NB5A 3KWBX 3QSDA 4X6IA 4CDDB 2NQIA 1TL9A 4DMYA 1HUCB 2DC8A 1GECE 2VHFA 3MORA 2AYNA 2E01A 4QBBA 2AVWA 1BY8A 1MEGA 4DMXA 2FTDA 2DCBA 1NB3A 1XKGA 1Q6KA 1AU0A 2DCDA 4BGFA 2FT2A 3C9EA 1YT7A 2HXZA 1KFXL 1FH0A 1KXRA 1U9VA 2AUZA 4G54A 1DEUA 1CQDA 2XU4A 1F2AA 4OEMA 3D9WA 3IOQA 1M6DA 4W4UA 3H8CA 8PCHA 2AS8A 4XUIA 2BDZA 1S4VA 3N3KA 3QT4A 4CZWA 3RVWA 2ARYA 1PPDA 2VFCA 3H6SA 4MSXA 4AXLA 3OISA 4YYRA 3HHIA 1BGOA 1F2CA 3H8BA 3HWNA 1BP4A 4B55A 3P5UA 4CDCB 1POPA 2AYOA 4BQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RVX A;  3KW9 A;  1STF E;  5EF4 A;  1QOL A;  1Y08 A;  1AU4 A;  2G8J A;  1PPN A;  4PI3 A;  4N8W A;  2DJF B;  4YYV A;  4BS6 A;  1PPO A;  4CDF B;  3IEJ A;  3ZUA A;  2FQ9 A;  2AUX A;  3NHE A;  2IBI A;  2XU3 A;  3B79 A;  1NLJ A;  1F29 A;  4OEL A;  3IHP A;  3PBH A;  1TLO A;  3K24 A;  1CV8 A;  2IPP B;  4X6J A;  3U8E A;  2FUD A;  2E03 A;  4QRX A;  5PAD A;  4P6G A;  4X6H A;  4MZS A;  1PBH A;  4YYS A;  4Q8H A;  2NQG A;  1PAD A;  2JQG R;  3MHS A;  3RVV A;  3USV A;  3P5X A;  3F5V A;  3BWK A;  3K8U A;  3LXS A;  2C0Y A;  3V6E A;  4MZO A;  3MTN A;  5J94 A;  4HWY A;  1VSN A;  5CVM A;  1KHP A;  2DCA A;  2HD5 A;  1QMY A;  2JQF R;  3E1Z B;  1EWL A;  3I3T A;  3N3G A;  3IV2 A;  1CB5 A;  1ME4 A;  2R6N A;  6PAD A;  3P5W A;  2ATO A;  1YK8 A;  3D6S A;  1CSB B;  1MIR A;  2WBF X;  1K3B B;  5CHT A;  2R9C A;  2P86 A;  1O0E A;  1CS8 A;  3DF0 A;  1NQC A;  5JA7 A;  3K9M A;  2BDL A;  2NQD B;  1AU3 A;  4P6E A;  1GCB A;  4K7C A;  5CVN B;  4BPV A;  4CDE B;  1CJL A;  1U5I A;  4I07 A;  1MHW A;  4PP2 E;  1THE A;  4KLB A;  4YYW A;  1EF7 A;  2FRQ A;  2OP3 A;  2HH5 A;  1CTE A;  3S3R A;  2G7Y A;  2G6D A;  1AYV A;  1F2B A;  2DCC A;  2E02 A;  5EGW A;  3CH2 X;  2CIO A;  2DZZ A;  3TNX A;  2OZ2 A;  2PBH A;  1IWD A;  2DZY A;  1DF0 A;  2PRE A;  3OVZ A;  3N4C A;  1GLO A;  4YYU A;  4N4Z A;  3WXF A;  3HHA A;  5K16 A;  1EWP A;  1SNK A;  3P5V A;  1AEC A;  4N79 A;  2ACT A;  1NPZ A;  3O1G A;  2PAD A;  2DC6 A;  1QDQ A;  5CHV A;  3KWZ A;  4XR7 A;  4QRV A;  3KX1 A;  3BOW A;  3PNR A;  1KFU L;  2YJ8 A;  1X9Y A;  2YJ9 A;  2NQA A;  3IMA A;  1PE6 A;  1AYW A;  4I05 A;  2YJC A;  3KFQ A;  2GHU A;  1MDW A;  1QXP A;  2YJB A;  3BCN A;  2R9O A;  2XU5 A;  3WXG A;  3MHH A;  2R9N A;  2FRA A;  4FJC A;  2B1M A;  3CBJ A;  2GFO A;  3KKU A;  4Q8G A;  3CBK A;  2FO5 A;  2HHN A;  4YVA A;  1VJV A;  4WA6 A;  3OF8 A;  1MS6 A;  1ZIV A;  3BC3 A;  3QJ3 A;  2F7D A;  1BQI A;  1ATK A;  1EWM A;  2FYE A;  5F02 A;  3AI8 A;  3H7D A;  5A24 A;  2XU1 A;  4YYQ A;  3PDF A;  2DC7 A;  3O0U A;  3S3Q A;  3CH3 X;  4BS5 A;  2Y6E A;  3I06 A;  1YAL A;  4AXM A;  1ME3 A;  5FPW A;  1JQP A;  1PCI A;  3IUT A;  1SP4 B;  4QH6 A;  2OUL A;  2P0R A;  2AIM A;  2CB5 A;  3BPF A;  1GMY A;  1MEM A;  1ICF A;  3M99 A;  4BSQ A;  3ERV A;  4PP1 A;  3OF9 A;  7PCK A;  2AU1 A;  3WXE A;  2H7J A;  3KSE A;  2R9F A;  3H89 A;  9PAP A;  3GCB A;  4I04 A;  1U9W A;  1PPP A;  4PAD A;  1U9Q X;  2E00 A;  1TU6 A;  2F1G A;  4QRG A;  1CVZ A;  1YK7 A;  1U9X A;  1EWO A;  4YV8 A;  2R9M A;  3OVX A;  1A6R A;  4W5C A;  2DJG B;  1ZCM A;  2Y5B A;  1NL6 A;  1ITO A;  2PNS A;  3LFY A;  1AU2 A;  1YVB A;  2YJ2 A;  1AYU A;  1Y4H A;  4FK5 A;  4RY2 A;  4FIP A;  2O6X A;  5CVO B;  1PXV A;  2DC9 A;  2B1N A;  3HD3 A;  1PIP A;  2VHS A;  3BPM A;  1AIM A;  4ZUX U;  3F75 A;  3V6C A;  1KHQ A;  2P7U A;  2G8E A;  4W5B A;  5JH3 A;  1CPJ A;  3PW3 A;  1NB5 A;  3KWB X;  3QSD A;  4X6I A;  4CDD B;  2NQI A;  1TL9 A;  4DMY A;  1HUC B;  2DC8 A;  1GEC E;  2VHF A;  3MOR A;  2AYN A;  2E01 A;  4QBB A;  2AVW A;  1BY8 A;  1MEG A;  4DMX A;  2FTD A;  2DCB A;  1NB3 A;  1XKG A;  1Q6K A;  1AU0 A;  2DCD A;  2FT2 A;  3C9E A;  1YT7 A;  2HXZ A;  1KFX L;  1FH0 A;  1KXR A;  1U9V A;  2AUZ A;  4G54 A;  1DEU A;  1CQD A;  2XU4 A;  1F2A A;  4OEM A;  3IOQ A;  4W4U A;  1M6D A;  3H8C A;  8PCH A;  2AS8 A;  4XUI A;  2BDZ A;  1S4V A;  3N3K A;  3QT4 A;  4CZW A;  3RVW A;  2ARY A;  1PPD A;  3H6S A;  4MSX A;  4AXL A;  3OIS A;  4YYR A;  3HHI A;  1BGO A;  1F2C A;  3H8B A;  3HWN A;  1BP4 A;  3P5U A;  4CDC B;  1POP A;  2AYO A;  4BQV A; 
#chains in the Genus database with same CATH topology
 3RVX A;  3KW9 A;  4IP3 A;  1STF E;  5EF4 A;  1QOL A;  1Y08 A;  1AU4 A;  2JTC A;  2G8J A;  1PPN A;  4PI3 A;  4N8W A;  2DJF B;  4YYV A;  4BS6 A;  1PPO A;  4CDF B;  3IEJ A;  4REZ A;  3ZUA A;  2FQ9 A;  2AUX A;  3NHE A;  4RF1 A;  2IBI A;  1YZB A;  4OW0 A;  3PT2 A;  2XU3 A;  3B79 A;  1NLJ A;  1F29 A;  4OEL A;  3MJ5 A;  3IHP A;  3PBH A;  1TLO A;  3K24 A;  5E6J A;  4MI7 A;  1CV8 A;  2IPP B;  4X6J A;  3U8E A;  2FUD A;  2E03 A;  4QRX A;  5PAD A;  4P6G A;  4X6H A;  4MZS A;  1PBH A;  4YYS A;  4Q8H A;  2NQG A;  1PAD A;  2JQG R;  3MHS A;  3RVV A;  5EZS A;  3USV A;  3P5X A;  3F5V A;  3BWK A;  3K8U A;  3LXS A;  4D8B A;  2C0Y A;  3V6E A;  4MZO A;  3MTN A;  5J94 A;  4HWY A;  1VSN A;  2Z84 A;  3BY4 A;  5CVM A;  4ZTB A;  1KHP A;  3C0R A;  2DCA A;  2HD5 A;  1QMY A;  2JQF R;  3E1Z B;  1EWL A;  3I3T A;  3N3G A;  3IV2 A;  1CB5 A;  1ME4 A;  2R6N A;  6PAD A;  3P5W A;  2ATO A;  1YK8 A;  1DKI A;  3D6S A;  1CSB B;  1MIR A;  2WBF X;  1K3B B;  5CHT A;  2R9C A;  2P86 A;  1O0E A;  1CS8 A;  4D8I A;  3DF0 A;  1NQC A;  4MM3 B;  5JA7 A;  3K9M A;  2BDL A;  2NQD B;  4WUR A;  1AU3 A;  4P6E A;  1GCB A;  4K7C A;  2AGA A;  5CVN B;  4BPV A;  4CDE B;  1CJL A;  1U5I A;  2DOS A;  4I07 A;  1MHW A;  4PP2 E;  3PHW A;  5EZQ A;  1THE A;  4KLB A;  4YYW A;  1EF7 A;  2FRQ A;  4A5U A;  2OP3 A;  2HH5 A;  1CTE A;  3S3R A;  2G7Y A;  2G6D A;  1AYV A;  1F2B A;  2DCC A;  2E02 A;  5EGW A;  3CH2 X;  2CIO A;  2DZZ A;  3TNX A;  2OZ2 A;  2PBH A;  1IWD A;  2DZY A;  1DF0 A;  2J7Q A;  2PRE A;  3OVZ A;  3N4C A;  1GLO A;  4YYU A;  4N4Z A;  3WXF A;  3HHA A;  5K16 A;  1EWP A;  4P16 A;  1SNK A;  4BOU A;  3P5V A;  4PT5 A;  1AEC A;  4N79 A;  2ACT A;  5JZE A;  1NPZ A;  3O1G A;  2PAD A;  2DC6 A;  1QDQ A;  5CHV A;  3KWZ A;  4XR7 A;  4QRV A;  3KX1 A;  3BOW A;  3PNR A;  4IUM A;  1KFU L;  2YJ8 A;  3PRM A;  4R3D A;  1X9Y A;  2YJ9 A;  2NQA A;  3IMA A;  1PE6 A;  1AYW A;  3PRP A;  4I05 A;  2YJC A;  3KFQ A;  3BBA A;  2GHU A;  1MDW A;  1QXP A;  2YJB A;  3BCN A;  2R9O A;  2XU5 A;  3WXG A;  3MHH A;  2R9N A;  2BTW B;  1PVJ A;  2FRA A;  4FJC A;  2B1M A;  3CBJ A;  2GFO A;  3KKU A;  4Q8G A;  3CBK A;  2FO5 A;  2HHN A;  4YVA A;  1VJV A;  2HWK A;  4RNA A;  4WA6 A;  3OF8 A;  4RF0 A;  1MS6 A;  1ZIV A;  3BC3 A;  3QJ3 A;  2F7D A;  1BQI A;  1ATK A;  1EWM A;  4BOP A;  2FYE A;  5F02 A;  3AI8 A;  3H7D A;  5A24 A;  1UKF A;  2XU1 A;  4YYQ A;  3TRK A;  3PDF A;  2DC7 A;  3O0U A;  3S3Q A;  2BTW A;  3TMP A;  3CH3 X;  4BS5 A;  2Y6E A;  3I06 A;  1YAL A;  4AXM A;  1ME3 A;  5FPW A;  1JQP A;  1PCI A;  3IUT A;  1SP4 B;  4QH6 A;  4BOS A;  2J7Q C;  2OUL A;  2P0R A;  2AIM A;  2CB5 A;  3BPF A;  1GMY A;  1MEM A;  1ICF A;  3M99 A;  4BSQ A;  3ERV A;  4PP1 A;  3OF9 A;  7PCK A;  3MTV A;  2AU1 A;  3WXE A;  2H7J A;  3KSE A;  2R9F A;  3H89 A;  9PAP A;  3GCB A;  4I04 A;  4XZX A;  1U9W A;  3PHX A;  1PPP A;  4PAD A;  3W31 A;  1U9Q X;  2E00 A;  1TU6 A;  2F1G A;  3O65 A;  2UZJ A;  4BOZ A;  2FE8 A;  1CVZ A;  4QRG A;  1YK7 A;  1U9X A;  1EWO A;  4YV8 A;  2R9M A;  3OVX A;  1A6R A;  4W5C A;  2DJG B;  1ZCM A;  2Y5B A;  1NL6 A;  1ITO A;  2PNS A;  3LFY A;  1AU2 A;  1YVB A;  2YJ2 A;  1AYU A;  1Y4H A;  4FK5 A;  4RY2 A;  4FIP A;  2O6X A;  4RKX A;  5CVO B;  1PXV A;  4HXD B;  2DC9 A;  2B1N A;  3HD3 A;  1PIP A;  2VHS A;  3BPM A;  1AIM A;  4ZUX U;  4BOQ A;  3PSE A;  3F75 A;  3V6C A;  1KHQ A;  2P7U A;  2G8E A;  4W5B A;  3W30 A;  3IFU A;  5JH3 A;  1CPJ A;  3PW3 A;  1NB5 A;  3KWB X;  3QSD A;  4D8E A;  4X6I A;  4CDD B;  2NQI A;  1TL9 A;  4DMY A;  1HUC B;  2DC8 A;  1GEC E;  2JRI A;  2VHF A;  3ZNH A;  3MOR A;  2AYN A;  2E01 A;  4QBB A;  2AVW A;  1BY8 A;  1MEG A;  4DMX A;  3E9S A;  2FTD A;  2DCB A;  1NB3 A;  3BB7 A;  1XKG A;  1Q6K A;  3B21 A;  1AU0 A;  2DCD A;  2FT2 A;  3C9E A;  1YT7 A;  2HXZ A;  1KFX L;  3RNV A;  1FH0 A;  1KXR A;  1U9V A;  2AUZ A;  4GUA A;  4G54 A;  1DEU A;  1CQD A;  2XU4 A;  1F2A A;  4OEM A;  3IOQ A;  4W4U A;  1M6D A;  3PHU A;  4M0W A;  3H8C A;  4OVZ B;  8PCH A;  2AS8 A;  4XUI A;  2BDZ A;  1S4V A;  3N3K A;  3QT4 A;  4CZW A;  3RVW A;  2ARY A;  3OQC A;  1PPD A;  2BU3 A;  3H6S A;  4MSX A;  4AXL A;  3OIS A;  4YYR A;  3HHI A;  1BGO A;  1F2C A;  3H8B A;  3HWN A;  3MP2 A;  1BP4 A;  4OVZ A;  3P5U A;  4CDC B;  1POP A;  5KO3 A;  2AYO A;  4BQV A; 
#chains in the Genus database with same CATH homology
 3RVX A;  3KW9 A;  1STF E;  5EF4 A;  1QOL A;  1Y08 A;  1AU4 A;  2G8J A;  1PPN A;  1W4T A;  4PI3 A;  4N8W A;  2DJF B;  4YYV A;  4BS6 A;  1PPO A;  4CDF B;  3IEJ A;  3ZUA A;  2FQ9 A;  2AUX A;  3NHE A;  2IBI A;  2XU3 A;  3B79 A;  1NLJ A;  1F29 A;  4OEL A;  1GX3 A;  2BSZ A;  3IHP A;  3PBH A;  1TLO A;  3K24 A;  1CV8 A;  2IPP B;  4X6J A;  3U8E A;  2FUD A;  2E03 A;  4QRX A;  5PAD A;  4P6G A;  4X6H A;  4MZS A;  1PBH A;  4YYS A;  4Q8H A;  2NQG A;  1PAD A;  2JQG R;  3MHS A;  3RVV A;  3USV A;  3P5X A;  3F5V A;  3BWK A;  3K8U A;  3LXS A;  2C0Y A;  3V6E A;  4MZO A;  3MTN A;  5J94 A;  4HWY A;  1VSN A;  5CVM A;  1KHP A;  2DCA A;  2HD5 A;  1QMY A;  2JQF R;  3E1Z B;  1EWL A;  3I3T A;  3N3G A;  3IV2 A;  1CB5 A;  1ME4 A;  2R6N A;  6PAD A;  3P5W A;  2ATO A;  1YK8 A;  3D6S A;  1CSB B;  1MIR A;  2WBF X;  1K3B B;  5CHT A;  2R9C A;  2P86 A;  1O0E A;  1CS8 A;  3DF0 A;  1NQC A;  2VFB A;  5JA7 A;  3K9M A;  2BDL A;  2NQD B;  1AU3 A;  4P6E A;  1GCB A;  4K7C A;  5CVN B;  4BPV A;  4CDE B;  1CJL A;  1U5I A;  4I07 A;  1MHW A;  4PP2 E;  1THE A;  4KLB A;  4NV7 A;  4YYW A;  1EF7 A;  2FRQ A;  2OP3 A;  2HH5 A;  1CTE A;  3S3R A;  2G7Y A;  2G6D A;  1AYV A;  1F2B A;  2DCC A;  2E02 A;  5EGW A;  3CH2 X;  2CIO A;  2DZZ A;  3TNX A;  2OZ2 A;  2PBH A;  1IWD A;  2DZY A;  1DF0 A;  2PRE A;  3OVZ A;  3N4C A;  1GLO A;  4YYU A;  4N4Z A;  3WXF A;  3HHA A;  5K16 A;  1EWP A;  1SNK A;  3P5V A;  1AEC A;  4N79 A;  2ACT A;  1NPZ A;  3O1G A;  2PAD A;  2DC6 A;  1QDQ A;  5CHV A;  3KWZ A;  4XR7 A;  4QRV A;  3KX1 A;  3BOW A;  3PNR A;  1KFU L;  1E2T A;  2YJ8 A;  1X9Y A;  2YJ9 A;  2NQA A;  3IMA A;  1PE6 A;  1AYW A;  4I05 A;  2YJC A;  3KFQ A;  2GHU A;  1MDW A;  1QXP A;  2YJB A;  3BCN A;  2R9O A;  2XU5 A;  3WXG A;  3MHH A;  2R9N A;  2FRA A;  4FJC A;  2B1M A;  3CBJ A;  2GFO A;  3KKU A;  4Q8G A;  3CBK A;  2FO5 A;  2HHN A;  3LTW A;  4YVA A;  1VJV A;  4WA6 A;  3OF8 A;  1MS6 A;  1ZIV A;  3BC3 A;  3QJ3 A;  2F7D A;  1BQI A;  1ATK A;  1EWM A;  2FYE A;  5F02 A;  3AI8 A;  3H7D A;  5A24 A;  2XU1 A;  4YYQ A;  3PDF A;  2DC7 A;  3O0U A;  3S3Q A;  4C5P A;  3CH3 X;  4BS5 A;  2Y6E A;  3I06 A;  1YAL A;  4AXM A;  1ME3 A;  5FPW A;  1JQP A;  1PCI A;  3IUT A;  1SP4 B;  4QH6 A;  2OUL A;  2P0R A;  2AIM A;  2CB5 A;  3BPF A;  1GMY A;  1MEM A;  1ICF A;  3M99 A;  4BSQ A;  3ERV A;  4PP1 A;  3OF9 A;  7PCK A;  2AU1 A;  3WXE A;  2H7J A;  3KSE A;  2R9F A;  3H89 A;  9PAP A;  3GCB A;  4I04 A;  1U9W A;  1PPP A;  4PAD A;  1U9Q X;  2E00 A;  1TU6 A;  2F1G A;  4GUZ A;  1CVZ A;  4QRG A;  1YK7 A;  1U9X A;  1EWO A;  4YV8 A;  2R9M A;  3OVX A;  1A6R A;  4W5C A;  2DJG B;  1ZCM A;  2Y5B A;  4NV8 A;  1NL6 A;  1ITO A;  2PNS A;  3LFY A;  1AU2 A;  1YVB A;  2YJ2 A;  1AYU A;  1Y4H A;  1W6F A;  4FK5 A;  4RY2 A;  4FIP A;  2O6X A;  5CVO B;  1PXV A;  2DC9 A;  2B1N A;  3HD3 A;  1PIP A;  2VHS A;  3BPM A;  1AIM A;  4ZUX U;  1W5R A;  3F75 A;  3V6C A;  1KHQ A;  2P7U A;  2G8E A;  4W5B A;  5JH3 A;  1CPJ A;  3PW3 A;  1NB5 A;  3KWB X;  3QSD A;  4X6I A;  4CDD B;  2NQI A;  1TL9 A;  4DMY A;  1HUC B;  2DC8 A;  1GEC E;  2VHF A;  3MOR A;  2AYN A;  2E01 A;  4QBB A;  2AVW A;  1BY8 A;  1MEG A;  4DMX A;  2FTD A;  2DCB A;  1NB3 A;  1XKG A;  1Q6K A;  1AU0 A;  2DCD A;  4BGF A;  2FT2 A;  3C9E A;  1YT7 A;  2HXZ A;  1KFX L;  1FH0 A;  1KXR A;  1U9V A;  2AUZ A;  4G54 A;  1DEU A;  1CQD A;  2XU4 A;  1F2A A;  4OEM A;  3D9W A;  3IOQ A;  1M6D A;  4W4U A;  3H8C A;  8PCH A;  2AS8 A;  4XUI A;  2BDZ A;  1S4V A;  3N3K A;  3QT4 A;  4CZW A;  3RVW A;  2ARY A;  1PPD A;  2VFC A;  3H6S A;  4MSX A;  4AXL A;  3OIS A;  4YYR A;  3HHI A;  1BGO A;  1F2C A;  3H8B A;  3HWN A;  1BP4 A;  4B55 A;  3P5U A;  4CDC B;  1POP A;  2AYO A;  4BQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...