3KWBX

Structure of catk covalently bound to a dioxo-triazine inhibitor
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cathepsin K
publication title Dioxo-triazines as a novel series of cathepsin K inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 62
structure length 215
sequence length 215
chains with identical sequence Y
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2009-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3kwbX00
1CVZA 1K3BB 3P5XA 1U9XA 3U8EA 3WXEA 1AU2A 4QRVA 1PBHA 2AIMA 2XU3A 1MHWA 3O0UA 3IOQA 4ZUXU 1PIPA 1YVBA 1GLOA 3IHPA 3F75A 3PDFA 2G8JA 4P6GA 3ERVA 2NQGA 2CIOA 4OEMA 2AYNA 1Y08A 2PBHA 3OISA 1BGOA 1BP4A 2G7YA 3KKUA 3ZUAA 3B79A 1GECE 3MTNA 2YJ8A 4W5BA 3K9MA 2FRQA 4HWYA 1QMYA 3KWBX 2PNSA 2GFOA 3BC3A 4CDEB 3BOWA 2XU4A 1BQIA 1A6RA 3MORA 3IMAA 1ICFA 3I06A 1PPOA 4YYUA 4PI3A 3P5VA 1THEA 1NL6A 1NLJA 1STFE 4YV8A 2HD5A 3KFQA 3F5VA 4Q8GA 1U9WA 2NQDB 3N3GA 3WXGA 1NB5A 1EWLA 4BS6A 2VHSA 5K16A 4OELA 1KFUL 5CHVA 3S3QA 4YYSA 1HUCB 2PREA 2WBFX 1U9QX 1SNKA 4X6JA 3DF0A 3H8CA 1AECA 2P86A 2B1NA 4FIPA 1F29A 3V6EA 2B1MA 1VJVA 1Y4HA 1CJLA 4KLBA 3RVXA 4N79A 1ATKA 2CB5A 3H89A 3LXSA 1PPPA 2E01A 1NQCA 1S4VA 3CH3X 1ME3A 3OF8A 2DZZA 3K24A 9PAPA 4XUIA 1FH0A 2P7UA 1EWOA 3IV2A 4BQVA 3OF9A 1O0EA 2JQFR 2E02A 2JQGR 4P6EA 4PP2E 1PXVA 1MS6A 2IPPB 1MDWA 1MEMA 3H7DA 3RVVA 1AU4A 1IWDA 4K7CA 3BCNA 3K8UA 2DC8A 3HWNA 1SP4B 3IEJA 5F02A 1NB3A 4YYVA 5JA7A 2DCCA 2R9CA 3KX1A 3D6SA 1KFXL 2R9MA 2OP3A 1TL9A 3PBHA 4QBBA 2FT2A 2H7JA 1EWMA 1VSNA 3E1ZB 4PADA 3QJ3A 5EF4A 1AIMA 4QH6A 2AUZA 1AYVA 2G6DA 4I07A 5CVNB 4BSQA 2BDLA 5FPWA 7PCKA 4QRXA 4WA6A 3BPFA 2NQIA 3IUTA 3M99A 2E00A 5EGWA 4RY2A 4CDFB 2R9NA 4PP1A 5PADA 1TU6A 2G8EA 1PPDA 2AYOA 1YALA 4DMXA 3HHAA 1BY8A 2F7DA 2BDZA 1ME4A 4CZWA 1U9VA 1XKGA 2DJGB 1NPZA 4BS5A 3O1GA 1TLOA 2YJ2A 2Y5BA 2XU1A 2YJBA 4MZOA 1M6DA 2C0YA 1CB5A 4G54A 1F2BA 1MEGA 3HD3A 1POPA 2P0RA 2YJ9A 3H6SA 1QOLA 2E03A 3AI8A 2FRAA 3NHEA 4YYRA 1PPNA 4CDDB 1AYWA 3KW9A 3PW3A 3V6CA 2AU1A 3GCBA 4XR7A 2DCAA 2FUDA 2DC9A 4YYQA 5CHTA 2FYEA 3CH2X 3MHHA 2DC7A 1U5IA 1CSBB 2OULA 2DCBA 1F2CA 2ATOA 3H8BA 5J94A 1CTEA 1KXRA 1MIRA 4BPVA 3TNXA 2AVWA 1YK8A 3S3RA 1CS8A 1PE6A 1ZIVA 4Q8HA 1GMYA 4DMYA 1EF7A 4CDCB 1ITOA 5JH3A 5CVMA 3C9EA 1KHQA 1AU3A 1ZCMA 3OVZA 1X9YA 2DZYA 1CPJA 2NQAA 2FTDA 4I04A 5A24A 1QDQA 2FQ9A 1DF0A 1GCBA 2HHNA 2HXZA 4W5CA 2PADA 1CV8A 3RVWA 1AU0A 2DCDA 3OVXA 2XU5A 2GHUA 4N4ZA 3HHIA 1EWPA 2IBIA 1YT7A 2R6NA 2YJCA 2ACTA 2OZ2A 2O6XA 3I3TA 3QT4A 3P5UA 3QSDA 4QRGA 1F2AA 1YK7A 3KSEA 8PCHA 4X6IA 1Q6KA 4N8WA 2VHFA 4AXLA 2DJFB 2F1GA 2ARYA 3BWKA 1AYUA 2Y6EA 1DEUA 3P5WA 4W4UA 3WXFA 4I05A 2HH5A 3KWZA 1PCIA 3MHSA 2AUXA 4YYWA 5CVOB 3BPMA 2FO5A 4FJCA 2R9OA 1PADA 1QXPA 3USVA 6PADA 2R9FA 2AS8A 4X6HA 3CBKA 3LFYA 3N3KA 1KHPA 1JQPA 4YVAA 4MSXA 3PNRA 4AXMA 1CQDA 4FK5A 2DC6A 3N4CA 4MZSA 3CBJA
chains in the Genus database with same CATH superfamily
1CVZA 1K3BB 3P5XA 1U9XA 3U8EA 3WXEA 1AU2A 4OW0A 4QRVA 1PBHA 2AIMA 2XU3A 1MHWA 3O0UA 3IOQA 3O65A 4ZUXU 1PIPA 1YVBA 1GLOA 3IHPA 3F75A 3PDFA 2G8JA 4P6GA 3ERVA 2NQGA 2CIOA 4OEMA 2AYNA 1Y08A 2PBHA 3OISA 1YZBA 1BGOA 5E6JA 1BP4A 2G7YA 3KKUA 3ZUAA 3B79A 1GECE 1DKIA 3MTNA 2YJ8A 4W5BA 3C0RA 3K9MA 2FRQA 4HWYA 1QMYA 3KWBX 2PNSA 2GFOA 3ZNHA 3BC3A 4CDEB 3BOWA 2XU4A 1BQIA 1A6RA 3MORA 3IMAA 1ICFA 3I06A 1PPOA 4YYUA 4PI3A 3P5VA 1THEA 1NL6A 1NLJA 1STFE 3MJ5A 3W31A 4YV8A 2HD5A 3KFQA 3F5VA 4Q8GA 1U9WA 2NQDB 3N3GA 3WXGA 1NB5A 1EWLA 4BS6A 2FE8A 4XZXA 2VHSA 4IUMA 4OELA 5K16A 1KFUL 5CHVA 3S3QA 4YYSA 3W30A 1HUCB 3PHWA 2PREA 2WBFX 4BOZA 4MI7A 1U9QX 4IP3A 1SNKA 4X6JA 3DF0A 3H8CA 4D8EA 1AECA 2P86A 2B1NA 4FIPA 1F29A 3V6EA 2B1MA 4BOSA 1UKFA 1VJVA 1Y4HA 1CJLA 4HXDB 4KLBA 3RVXA 4BOUA 4N79A 1ATKA 2CB5A 3H89A 1PVJA 3LXSA 1PPPA 2E01A 3PHUA 1NQCA 1S4VA 4ZTBA 3CH3X 1ME3A 3OF8A 4RF0A 2DZZA 3K24A 4RNAA 9PAPA 4XUIA 1FH0A 2P7UA 1EWOA 3IV2A 4BQVA 3OF9A 1O0EA 2JQFR 2E02A 2JQGR 4P6EA 4PP2E 1PXVA 1MS6A 2IPPB 1MDWA 1MEMA 3H7DA 3RVVA 1AU4A 1IWDA 4K7CA 3BCNA 3K8UA 2DC8A 2BU3A 3IFUA 3HWNA 1SP4B 3IEJA 5F02A 1NB3A 4YYVA 5JA7A 2DCCA 2R9CA 3KX1A 3D6SA 1KFXL 2R9MA 2OP3A 2AGAA 1TL9A 3PBHA 4QBBA 2FT2A 2H7JA 1EWMA 4M0WA 4D8BA 1VSNA 3E1ZB 4MM3B 4PADA 3QJ3A 5EF4A 1AIMA 4QH6A 2AUZA 1AYVA 2G6DA 4I07A 3BY4A 5CVNB 4BSQA 2BDLA 5FPWA 2JTCA 7PCKA 4QRXA 4WA6A 3BPFA 2NQIA 3IUTA 3M99A 2E00A 2UZJA 4P16A 2HWKA 5EGWA 4RY2A 4A5UA 4CDFB 3OQCA 2R9NA 4PP1A 3RNVA 5PADA 1TU6A 2G8EA 1PPDA 2AYOA 1YALA 4DMXA 5EZQA 3HHAA 1BY8A 2F7DA 2BDZA 1ME4A 4CZWA 1U9VA 1XKGA 3MTVA 2DJGB 1NPZA 4WURA 4BS5A 3O1GA 1TLOA 2YJ2A 5JZEA 2Y5BA 2XU1A 3PHXA 3B21A 2YJBA 4MZOA 4OVZA 1M6DA 2C0YA 1CB5A 4G54A 3TRKA 1F2BA 1MEGA 3HD3A 1POPA 2P0RA 2YJ9A 3H6SA 1QOLA 2E03A 3AI8A 2FRAA 3NHEA 4YYRA 1PPNA 4CDDB 1AYWA 3KW9A 3PW3A 3V6CA 2AU1A 3GCBA 4XR7A 2DCAA 2FUDA 2DC9A 3E9SA 4YYQA 5CHTA 2FYEA 3CH2X 3MHHA 2DC7A 1U5IA 4RF1A 1CSBB 2OULA 2DCBA 1F2CA 2ATOA 3H8BA 5J94A 1CTEA 1KXRA 1MIRA 4RKXA 4BPVA 3TNXA 2AVWA 1YK8A 3S3RA 1CS8A 1PE6A 1ZIVA 4Q8HA 1GMYA 4DMYA 1EF7A 4BOQA 4CDCB 1ITOA 2BTWA 5JH3A 5CVMA 3C9EA 1KHQA 1AU3A 1ZCMA 4OVZB 3OVZA 1X9YA 2DZYA 1CPJA 2NQAA 2J7QC 2FTDA 4I04A 5A24A 1QDQA 5EZSA 2FQ9A 1DF0A 5KO3A 1GCBA 2HHNA 2HXZA 4W5CA 3MP2A 2J7QA 2PADA 1CV8A 3RVWA 1AU0A 2DCDA 3OVXA 2XU5A 2GHUA 4N4ZA 3HHIA 1EWPA 2IBIA 1YT7A 2R6NA 2YJCA 2ACTA 2OZ2A 2O6XA 3I3TA 3QT4A 3P5UA 3PSEA 4D8IA 3QSDA 3PT2A 4QRGA 3PRPA 1F2AA 1YK7A 3KSEA 8PCHA 4X6IA 1Q6KA 4N8WA 2VHFA 4AXLA 2DJFB 2F1GA 2ARYA 3BWKA 2BTWB 1AYUA 2Y6EA 1DEUA 3TMPA 3P5WA 4W4UA 3WXFA 4I05A 4REZA 2HH5A 3KWZA 1PCIA 3MHSA 2AUXA 4YYWA 5CVOB 3BPMA 2FO5A 4FJCA 2R9OA 1PADA 1QXPA 3USVA 2JRIA 6PADA 2R9FA 2AS8A 3PRMA 4X6HA 4BOPA 3CBKA 2Z84A 3LFYA 3N3KA 1KHPA 4R3DA 1JQPA 4YVAA 4GUAA 4MSXA 3PNRA 3BB7A 4AXMA 1CQDA 4FK5A 2DC6A 3N4CA 4MZSA 4PT5A 2DOSA 3BBAA 3CBJA
chains in the Genus database with same CATH topology
1CVZA 1K3BB 3P5XA 1U9XA 3U8EA 3WXEA 1AU2A 4QRVA 1PBHA 2AIMA 2XU3A 1MHWA 3O0UA 2BSZA 3IOQA 4ZUXU 1PIPA 1YVBA 1GLOA 3IHPA 3F75A 3PDFA 2G8JA 4P6GA 3ERVA 2NQGA 2CIOA 4OEMA 2AYNA 1Y08A 2PBHA 3OISA 1BGOA 1BP4A 2G7YA 3KKUA 3ZUAA 3B79A 4C5PA 1GECE 3MTNA 2YJ8A 4W5BA 3K9MA 2FRQA 4HWYA 1QMYA 3KWBX 2PNSA 2GFOA 3BC3A 4CDEB 3BOWA 2XU4A 1BQIA 1A6RA 3MORA 3IMAA 1ICFA 3I06A 1PPOA 1W5RA 4YYUA 4PI3A 3P5VA 1THEA 1NL6A 1NLJA 1STFE 4YV8A 2HD5A 3KFQA 3F5VA 4Q8GA 1U9WA 1GX3A 2NQDB 3N3GA 3WXGA 1NB5A 1EWLA 4BS6A 2VHSA 5K16A 4OELA 1KFUL 5CHVA 3S3QA 4YYSA 1HUCB 2PREA 2WBFX 1U9QX 1SNKA 4X6JA 3DF0A 3H8CA 1AECA 2P86A 2B1NA 4FIPA 1F29A 3V6EA 2B1MA 1VJVA 1Y4HA 1CJLA 4KLBA 3RVXA 4N79A 1ATKA 2CB5A 3H89A 3LXSA 1PPPA 2E01A 1NQCA 1S4VA 3CH3X 1ME3A 3OF8A 2DZZA 3K24A 9PAPA 4XUIA 1FH0A 2P7UA 1EWOA 3IV2A 4BQVA 3OF9A 1O0EA 2JQFR 2E02A 2JQGR 4P6EA 4PP2E 1PXVA 1MS6A 2IPPB 1MDWA 1MEMA 3H7DA 3RVVA 1AU4A 1IWDA 4K7CA 3BCNA 3K8UA 2DC8A 3HWNA 1SP4B 3IEJA 5F02A 1NB3A 4YYVA 5JA7A 2DCCA 2R9CA 3KX1A 3D6SA 1KFXL 2R9MA 2OP3A 1TL9A 3PBHA 4QBBA 2FT2A 2H7JA 1EWMA 1VSNA 3E1ZB 4PADA 3QJ3A 5EF4A 1AIMA 4QH6A 2AUZA 1AYVA 2G6DA 4I07A 5CVNB 4BSQA 3LTWA 2BDLA 5FPWA 7PCKA 4QRXA 4WA6A 3BPFA 2NQIA 3IUTA 3M99A 2E00A 5EGWA 4RY2A 4CDFB 2R9NA 4PP1A 5PADA 1TU6A 2G8EA 1PPDA 2AYOA 1W4TA 1YALA 4DMXA 4B55A 3HHAA 2VFCA 1BY8A 2F7DA 2BDZA 1ME4A 4CZWA 1U9VA 1XKGA 2DJGB 1NPZA 4BS5A 3O1GA 1TLOA 2YJ2A 2Y5BA 2XU1A 2YJBA 4MZOA 1M6DA 2C0YA 1CB5A 4G54A 1F2BA 1MEGA 3HD3A 1POPA 2P0RA 2YJ9A 3H6SA 1QOLA 2E03A 3AI8A 4BGFA 2FRAA 3NHEA 4YYRA 1PPNA 3D9WA 1AYWA 3KW9A 4CDDB 3PW3A 3V6CA 2AU1A 3GCBA 4XR7A 2DCAA 2FUDA 2DC9A 4YYQA 5CHTA 2FYEA 3CH2X 3MHHA 2DC7A 1U5IA 1CSBB 2OULA 2VFBA 4NV7A 2DCBA 1F2CA 2ATOA 3H8BA 5J94A 1CTEA 1KXRA 1MIRA 4BPVA 3TNXA 2AVWA 1YK8A 3S3RA 1CS8A 1PE6A 1ZIVA 4Q8HA 1GMYA 1E2TA 4DMYA 1EF7A 4CDCB 1ITOA 5JH3A 5CVMA 3C9EA 1KHQA 1AU3A 1ZCMA 3OVZA 1X9YA 2DZYA 1CPJA 2NQAA 2FTDA 4I04A 5A24A 1QDQA 2FQ9A 1DF0A 1GCBA 2HHNA 2HXZA 4W5CA 2PADA 1CV8A 3RVWA 1AU0A 2DCDA 3OVXA 2XU5A 2GHUA 4N4ZA 3HHIA 1EWPA 2IBIA 1YT7A 2R6NA 2YJCA 2ACTA 2OZ2A 2O6XA 3I3TA 3QT4A 3P5UA 3QSDA 4QRGA 1F2AA 1YK7A 3KSEA 8PCHA 4X6IA 1Q6KA 4N8WA 2VHFA 4AXLA 2DJFB 4GUZA 2F1GA 2ARYA 3BWKA 1AYUA 2Y6EA 1DEUA 3P5WA 4W4UA 3WXFA 4I05A 2HH5A 3KWZA 1PCIA 3MHSA 2AUXA 4YYWA 5CVOB 3BPMA 2FO5A 4FJCA 2R9OA 1PADA 1QXPA 3USVA 6PADA 2R9FA 2AS8A 4NV8A 4X6HA 3CBKA 3LFYA 3N3KA 1KHPA 1JQPA 4YVAA 4MSXA 1W6FA 3PNRA 4AXMA 1CQDA 4FK5A 2DC6A 3N4CA 4MZSA 3CBJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CVZ A;  1K3B B;  3P5X A;  1U9X A;  3U8E A;  3WXE A;  1AU2 A;  4QRV A;  1PBH A;  2AIM A;  2XU3 A;  1MHW A;  3O0U A;  3IOQ A;  4ZUX U;  1PIP A;  1YVB A;  1GLO A;  3IHP A;  3F75 A;  3PDF A;  2G8J A;  4P6G A;  3ERV A;  2NQG A;  2CIO A;  4OEM A;  2AYN A;  1Y08 A;  2PBH A;  3OIS A;  1BGO A;  1BP4 A;  2G7Y A;  3KKU A;  3ZUA A;  3B79 A;  1GEC E;  3MTN A;  2YJ8 A;  4W5B A;  3K9M A;  2FRQ A;  4HWY A;  1QMY A;  3KWB X;  2PNS A;  2GFO A;  3BC3 A;  4CDE B;  3BOW A;  2XU4 A;  1BQI A;  1A6R A;  3MOR A;  3IMA A;  1ICF A;  3I06 A;  1PPO A;  4YYU A;  4PI3 A;  3P5V A;  1THE A;  1NL6 A;  1NLJ A;  1STF E;  4YV8 A;  2HD5 A;  3KFQ A;  3F5V A;  4Q8G A;  1U9W A;  2NQD B;  3N3G A;  3WXG A;  1NB5 A;  1EWL A;  4BS6 A;  2VHS A;  5K16 A;  4OEL A;  1KFU L;  5CHV A;  3S3Q A;  4YYS A;  1HUC B;  2PRE A;  2WBF X;  1U9Q X;  1SNK A;  4X6J A;  3DF0 A;  3H8C A;  1AEC A;  2P86 A;  2B1N A;  4FIP A;  1F29 A;  3V6E A;  2B1M A;  1VJV A;  1Y4H A;  1CJL A;  4KLB A;  3RVX A;  4N79 A;  1ATK A;  2CB5 A;  3H89 A;  3LXS A;  1PPP A;  2E01 A;  1NQC A;  1S4V A;  3CH3 X;  1ME3 A;  3OF8 A;  2DZZ A;  3K24 A;  9PAP A;  4XUI A;  1FH0 A;  2P7U A;  1EWO A;  3IV2 A;  4BQV A;  3OF9 A;  1O0E A;  2JQF R;  2E02 A;  2JQG R;  4P6E A;  4PP2 E;  1PXV A;  1MS6 A;  2IPP B;  1MDW A;  1MEM A;  3H7D A;  3RVV A;  1AU4 A;  1IWD A;  4K7C A;  3BCN A;  3K8U A;  2DC8 A;  3HWN A;  1SP4 B;  3IEJ A;  5F02 A;  1NB3 A;  4YYV A;  5JA7 A;  2DCC A;  2R9C A;  3KX1 A;  3D6S A;  1KFX L;  2R9M A;  2OP3 A;  1TL9 A;  3PBH A;  4QBB A;  2FT2 A;  2H7J A;  1EWM A;  1VSN A;  3E1Z B;  4PAD A;  3QJ3 A;  5EF4 A;  1AIM A;  4QH6 A;  2AUZ A;  1AYV A;  2G6D A;  4I07 A;  5CVN B;  4BSQ A;  2BDL A;  5FPW A;  7PCK A;  4QRX A;  4WA6 A;  3BPF A;  2NQI A;  3IUT A;  3M99 A;  2E00 A;  5EGW A;  4RY2 A;  4CDF B;  2R9N A;  4PP1 A;  5PAD A;  1TU6 A;  2G8E A;  1PPD A;  2AYO A;  1YAL A;  4DMX A;  3HHA A;  1BY8 A;  2F7D A;  2BDZ A;  1ME4 A;  4CZW A;  1U9V A;  1XKG A;  2DJG B;  1NPZ A;  4BS5 A;  3O1G A;  1TLO A;  2YJ2 A;  2Y5B A;  2XU1 A;  2YJB A;  4MZO A;  1M6D A;  2C0Y A;  1CB5 A;  4G54 A;  1F2B A;  1MEG A;  3HD3 A;  1POP A;  2P0R A;  2YJ9 A;  3H6S A;  1QOL A;  2E03 A;  3AI8 A;  2FRA A;  3NHE A;  4YYR A;  1PPN A;  4CDD B;  1AYW A;  3KW9 A;  3PW3 A;  3V6C A;  2AU1 A;  3GCB A;  4XR7 A;  2DCA A;  2FUD A;  2DC9 A;  4YYQ A;  5CHT A;  2FYE A;  3CH2 X;  3MHH A;  2DC7 A;  1U5I A;  1CSB B;  2OUL A;  2DCB A;  1F2C A;  2ATO A;  3H8B A;  5J94 A;  1CTE A;  1KXR A;  1MIR A;  4BPV A;  3TNX A;  2AVW A;  1YK8 A;  3S3R A;  1CS8 A;  1PE6 A;  1ZIV A;  4Q8H A;  1GMY A;  4DMY A;  1EF7 A;  4CDC B;  1ITO A;  5JH3 A;  5CVM A;  3C9E A;  1KHQ A;  1AU3 A;  1ZCM A;  3OVZ A;  1X9Y A;  2DZY A;  1CPJ A;  2NQA A;  2FTD A;  4I04 A;  5A24 A;  1QDQ A;  2FQ9 A;  1DF0 A;  1GCB A;  2HHN A;  2HXZ A;  4W5C A;  2PAD A;  1CV8 A;  3RVW A;  1AU0 A;  2DCD A;  3OVX A;  2XU5 A;  2GHU A;  4N4Z A;  3HHI A;  1EWP A;  2IBI A;  1YT7 A;  2R6N A;  2YJC A;  2ACT A;  2OZ2 A;  2O6X A;  3I3T A;  3QT4 A;  3P5U A;  3QSD A;  4QRG A;  1F2A A;  1YK7 A;  3KSE A;  8PCH A;  4X6I A;  1Q6K A;  4N8W A;  2VHF A;  4AXL A;  2DJF B;  2F1G A;  2ARY A;  3BWK A;  1AYU A;  2Y6E A;  1DEU A;  3P5W A;  4W4U A;  3WXF A;  4I05 A;  2HH5 A;  3KWZ A;  1PCI A;  3MHS A;  2AUX A;  4YYW A;  5CVO B;  3BPM A;  2FO5 A;  4FJC A;  2R9O A;  1PAD A;  1QXP A;  3USV A;  6PAD A;  2R9F A;  2AS8 A;  4X6H A;  3CBK A;  3LFY A;  3N3K A;  1KHP A;  1JQP A;  4YVA A;  4MSX A;  3PNR A;  4AXM A;  1CQD A;  4FK5 A;  2DC6 A;  3N4C A;  4MZS A;  3CBJ A; 
#chains in the Genus database with same CATH topology
 1CVZ A;  1K3B B;  3P5X A;  1U9X A;  3U8E A;  3WXE A;  1AU2 A;  4OW0 A;  4QRV A;  1PBH A;  2AIM A;  2XU3 A;  1MHW A;  3O0U A;  3IOQ A;  3O65 A;  4ZUX U;  1PIP A;  1YVB A;  1GLO A;  3IHP A;  3F75 A;  3PDF A;  2G8J A;  4P6G A;  3ERV A;  2NQG A;  2CIO A;  4OEM A;  2AYN A;  1Y08 A;  2PBH A;  3OIS A;  1YZB A;  1BGO A;  5E6J A;  1BP4 A;  2G7Y A;  3KKU A;  3ZUA A;  3B79 A;  1GEC E;  1DKI A;  3MTN A;  2YJ8 A;  4W5B A;  3C0R A;  3K9M A;  2FRQ A;  4HWY A;  1QMY A;  3KWB X;  2PNS A;  2GFO A;  3ZNH A;  3BC3 A;  4CDE B;  3BOW A;  2XU4 A;  1BQI A;  1A6R A;  3MOR A;  3IMA A;  1ICF A;  3I06 A;  1PPO A;  4YYU A;  4PI3 A;  3P5V A;  1THE A;  1NL6 A;  1NLJ A;  1STF E;  3MJ5 A;  3W31 A;  4YV8 A;  2HD5 A;  3KFQ A;  3F5V A;  4Q8G A;  1U9W A;  2NQD B;  3N3G A;  3WXG A;  1NB5 A;  1EWL A;  4BS6 A;  2FE8 A;  4XZX A;  2VHS A;  4IUM A;  4OEL A;  5K16 A;  1KFU L;  5CHV A;  3S3Q A;  4YYS A;  3W30 A;  1HUC B;  3PHW A;  2PRE A;  2WBF X;  4BOZ A;  4MI7 A;  1U9Q X;  4IP3 A;  1SNK A;  4X6J A;  3DF0 A;  3H8C A;  4D8E A;  1AEC A;  2P86 A;  2B1N A;  4FIP A;  1F29 A;  3V6E A;  2B1M A;  4BOS A;  1UKF A;  1VJV A;  1Y4H A;  1CJL A;  4HXD B;  4KLB A;  3RVX A;  4BOU A;  4N79 A;  1ATK A;  2CB5 A;  3H89 A;  1PVJ A;  3LXS A;  1PPP A;  2E01 A;  3PHU A;  1NQC A;  1S4V A;  4ZTB A;  3CH3 X;  1ME3 A;  3OF8 A;  4RF0 A;  2DZZ A;  3K24 A;  4RNA A;  9PAP A;  4XUI A;  1FH0 A;  2P7U A;  1EWO A;  3IV2 A;  4BQV A;  3OF9 A;  1O0E A;  2JQF R;  2E02 A;  2JQG R;  4P6E A;  4PP2 E;  1PXV A;  1MS6 A;  2IPP B;  1MDW A;  1MEM A;  3H7D A;  3RVV A;  1AU4 A;  1IWD A;  4K7C A;  3BCN A;  3K8U A;  2DC8 A;  2BU3 A;  3IFU A;  3HWN A;  1SP4 B;  3IEJ A;  5F02 A;  1NB3 A;  4YYV A;  5JA7 A;  2DCC A;  2R9C A;  3KX1 A;  3D6S A;  1KFX L;  2R9M A;  2OP3 A;  2AGA A;  1TL9 A;  3PBH A;  4QBB A;  2FT2 A;  2H7J A;  1EWM A;  4M0W A;  4D8B A;  1VSN A;  3E1Z B;  4MM3 B;  4PAD A;  3QJ3 A;  5EF4 A;  1AIM A;  4QH6 A;  2AUZ A;  1AYV A;  2G6D A;  4I07 A;  3BY4 A;  5CVN B;  4BSQ A;  2BDL A;  5FPW A;  2JTC A;  7PCK A;  4QRX A;  4WA6 A;  3BPF A;  2NQI A;  3IUT A;  3M99 A;  2E00 A;  2UZJ A;  4P16 A;  2HWK A;  5EGW A;  4RY2 A;  4A5U A;  4CDF B;  3OQC A;  2R9N A;  4PP1 A;  3RNV A;  5PAD A;  1TU6 A;  2G8E A;  1PPD A;  2AYO A;  1YAL A;  4DMX A;  5EZQ A;  3HHA A;  1BY8 A;  2F7D A;  2BDZ A;  1ME4 A;  4CZW A;  1U9V A;  1XKG A;  3MTV A;  2DJG B;  1NPZ A;  4WUR A;  4BS5 A;  3O1G A;  1TLO A;  2YJ2 A;  5JZE A;  2Y5B A;  2XU1 A;  3PHX A;  3B21 A;  2YJB A;  4MZO A;  4OVZ A;  1M6D A;  2C0Y A;  1CB5 A;  4G54 A;  3TRK A;  1F2B A;  1MEG A;  3HD3 A;  1POP A;  2P0R A;  2YJ9 A;  3H6S A;  1QOL A;  2E03 A;  3AI8 A;  2FRA A;  3NHE A;  4YYR A;  1PPN A;  4CDD B;  1AYW A;  3KW9 A;  3PW3 A;  3V6C A;  2AU1 A;  3GCB A;  4XR7 A;  2DCA A;  2FUD A;  2DC9 A;  3E9S A;  4YYQ A;  5CHT A;  2FYE A;  3CH2 X;  3MHH A;  2DC7 A;  1U5I A;  4RF1 A;  1CSB B;  2OUL A;  2DCB A;  1F2C A;  2ATO A;  3H8B A;  5J94 A;  1CTE A;  1KXR A;  1MIR A;  4RKX A;  4BPV A;  3TNX A;  2AVW A;  1YK8 A;  3S3R A;  1CS8 A;  1PE6 A;  1ZIV A;  4Q8H A;  1GMY A;  4DMY A;  1EF7 A;  4BOQ A;  4CDC B;  1ITO A;  2BTW A;  5JH3 A;  5CVM A;  3C9E A;  1KHQ A;  1AU3 A;  1ZCM A;  4OVZ B;  3OVZ A;  1X9Y A;  2DZY A;  1CPJ A;  2NQA A;  2J7Q C;  2FTD A;  4I04 A;  5A24 A;  1QDQ A;  5EZS A;  2FQ9 A;  1DF0 A;  5KO3 A;  1GCB A;  2HHN A;  2HXZ A;  4W5C A;  3MP2 A;  2J7Q A;  2PAD A;  1CV8 A;  3RVW A;  1AU0 A;  2DCD A;  3OVX A;  2XU5 A;  2GHU A;  4N4Z A;  3HHI A;  1EWP A;  2IBI A;  1YT7 A;  2R6N A;  2YJC A;  2ACT A;  2OZ2 A;  2O6X A;  3I3T A;  3QT4 A;  3P5U A;  3PSE A;  4D8I A;  3QSD A;  3PT2 A;  4QRG A;  3PRP A;  1F2A A;  1YK7 A;  3KSE A;  8PCH A;  4X6I A;  1Q6K A;  4N8W A;  2VHF A;  4AXL A;  2DJF B;  2F1G A;  2ARY A;  3BWK A;  2BTW B;  1AYU A;  2Y6E A;  1DEU A;  3TMP A;  3P5W A;  4W4U A;  3WXF A;  4I05 A;  4REZ A;  2HH5 A;  3KWZ A;  1PCI A;  3MHS A;  2AUX A;  4YYW A;  5CVO B;  3BPM A;  2FO5 A;  4FJC A;  2R9O A;  1PAD A;  1QXP A;  3USV A;  2JRI A;  6PAD A;  2R9F A;  2AS8 A;  3PRM A;  4X6H A;  4BOP A;  3CBK A;  2Z84 A;  3LFY A;  3N3K A;  1KHP A;  4R3D A;  1JQP A;  4YVA A;  4GUA A;  4MSX A;  3PNR A;  3BB7 A;  4AXM A;  1CQD A;  4FK5 A;  2DC6 A;  3N4C A;  4MZS A;  4PT5 A;  2DOS A;  3BBA A;  3CBJ A; 
#chains in the Genus database with same CATH homology
 1CVZ A;  1K3B B;  3P5X A;  1U9X A;  3U8E A;  3WXE A;  1AU2 A;  4QRV A;  1PBH A;  2AIM A;  2XU3 A;  1MHW A;  3O0U A;  2BSZ A;  3IOQ A;  4ZUX U;  1PIP A;  1YVB A;  1GLO A;  3IHP A;  3F75 A;  3PDF A;  2G8J A;  4P6G A;  3ERV A;  2NQG A;  2CIO A;  4OEM A;  2AYN A;  1Y08 A;  2PBH A;  3OIS A;  1BGO A;  1BP4 A;  2G7Y A;  3KKU A;  3ZUA A;  3B79 A;  4C5P A;  1GEC E;  3MTN A;  2YJ8 A;  4W5B A;  3K9M A;  2FRQ A;  4HWY A;  1QMY A;  3KWB X;  2PNS A;  2GFO A;  3BC3 A;  4CDE B;  3BOW A;  2XU4 A;  1BQI A;  1A6R A;  3MOR A;  3IMA A;  1ICF A;  3I06 A;  1PPO A;  1W5R A;  4YYU A;  4PI3 A;  3P5V A;  1THE A;  1NL6 A;  1NLJ A;  1STF E;  4YV8 A;  2HD5 A;  3KFQ A;  3F5V A;  4Q8G A;  1U9W A;  1GX3 A;  2NQD B;  3N3G A;  3WXG A;  1NB5 A;  1EWL A;  4BS6 A;  2VHS A;  5K16 A;  4OEL A;  1KFU L;  5CHV A;  3S3Q A;  4YYS A;  1HUC B;  2PRE A;  2WBF X;  1U9Q X;  1SNK A;  4X6J A;  3DF0 A;  3H8C A;  1AEC A;  2P86 A;  2B1N A;  4FIP A;  1F29 A;  3V6E A;  2B1M A;  1VJV A;  1Y4H A;  1CJL A;  4KLB A;  3RVX A;  4N79 A;  1ATK A;  2CB5 A;  3H89 A;  3LXS A;  1PPP A;  2E01 A;  1NQC A;  1S4V A;  3CH3 X;  1ME3 A;  3OF8 A;  2DZZ A;  3K24 A;  9PAP A;  4XUI A;  1FH0 A;  2P7U A;  1EWO A;  3IV2 A;  4BQV A;  3OF9 A;  1O0E A;  2JQF R;  2E02 A;  2JQG R;  4P6E A;  4PP2 E;  1PXV A;  1MS6 A;  2IPP B;  1MDW A;  1MEM A;  3H7D A;  3RVV A;  1AU4 A;  1IWD A;  4K7C A;  3BCN A;  3K8U A;  2DC8 A;  3HWN A;  1SP4 B;  3IEJ A;  5F02 A;  1NB3 A;  4YYV A;  5JA7 A;  2DCC A;  2R9C A;  3KX1 A;  3D6S A;  1KFX L;  2R9M A;  2OP3 A;  1TL9 A;  3PBH A;  4QBB A;  2FT2 A;  2H7J A;  1EWM A;  1VSN A;  3E1Z B;  4PAD A;  3QJ3 A;  5EF4 A;  1AIM A;  4QH6 A;  2AUZ A;  1AYV A;  2G6D A;  4I07 A;  5CVN B;  4BSQ A;  3LTW A;  2BDL A;  5FPW A;  7PCK A;  4QRX A;  4WA6 A;  3BPF A;  2NQI A;  3IUT A;  3M99 A;  2E00 A;  5EGW A;  4RY2 A;  4CDF B;  2R9N A;  4PP1 A;  5PAD A;  1TU6 A;  2G8E A;  1PPD A;  2AYO A;  1W4T A;  1YAL A;  4DMX A;  4B55 A;  3HHA A;  2VFC A;  1BY8 A;  2F7D A;  2BDZ A;  1ME4 A;  4CZW A;  1U9V A;  1XKG A;  2DJG B;  1NPZ A;  4BS5 A;  3O1G A;  1TLO A;  2YJ2 A;  2Y5B A;  2XU1 A;  2YJB A;  4MZO A;  1M6D A;  2C0Y A;  1CB5 A;  4G54 A;  1F2B A;  1MEG A;  3HD3 A;  1POP A;  2P0R A;  2YJ9 A;  3H6S A;  1QOL A;  2E03 A;  3AI8 A;  4BGF A;  2FRA A;  3NHE A;  4YYR A;  1PPN A;  3D9W A;  1AYW A;  3KW9 A;  4CDD B;  3PW3 A;  3V6C A;  2AU1 A;  3GCB A;  4XR7 A;  2DCA A;  2FUD A;  2DC9 A;  4YYQ A;  5CHT A;  2FYE A;  3CH2 X;  3MHH A;  2DC7 A;  1U5I A;  1CSB B;  2OUL A;  2VFB A;  4NV7 A;  2DCB A;  1F2C A;  2ATO A;  3H8B A;  5J94 A;  1CTE A;  1KXR A;  1MIR A;  4BPV A;  3TNX A;  2AVW A;  1YK8 A;  3S3R A;  1CS8 A;  1PE6 A;  1ZIV A;  4Q8H A;  1GMY A;  1E2T A;  4DMY A;  1EF7 A;  4CDC B;  1ITO A;  5JH3 A;  5CVM A;  3C9E A;  1KHQ A;  1AU3 A;  1ZCM A;  3OVZ A;  1X9Y A;  2DZY A;  1CPJ A;  2NQA A;  2FTD A;  4I04 A;  5A24 A;  1QDQ A;  2FQ9 A;  1DF0 A;  1GCB A;  2HHN A;  2HXZ A;  4W5C A;  2PAD A;  1CV8 A;  3RVW A;  1AU0 A;  2DCD A;  3OVX A;  2XU5 A;  2GHU A;  4N4Z A;  3HHI A;  1EWP A;  2IBI A;  1YT7 A;  2R6N A;  2YJC A;  2ACT A;  2OZ2 A;  2O6X A;  3I3T A;  3QT4 A;  3P5U A;  3QSD A;  4QRG A;  1F2A A;  1YK7 A;  3KSE A;  8PCH A;  4X6I A;  1Q6K A;  4N8W A;  2VHF A;  4AXL A;  2DJF B;  4GUZ A;  2F1G A;  2ARY A;  3BWK A;  1AYU A;  2Y6E A;  1DEU A;  3P5W A;  4W4U A;  3WXF A;  4I05 A;  2HH5 A;  3KWZ A;  1PCI A;  3MHS A;  2AUX A;  4YYW A;  5CVO B;  3BPM A;  2FO5 A;  4FJC A;  2R9O A;  1PAD A;  1QXP A;  3USV A;  6PAD A;  2R9F A;  2AS8 A;  4NV8 A;  4X6H A;  3CBK A;  3LFY A;  3N3K A;  1KHP A;  1JQP A;  4YVA A;  4MSX A;  1W6F A;  3PNR A;  4AXM A;  1CQD A;  4FK5 A;  2DC6 A;  3N4C A;  4MZS A;  3CBJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...