3KWBX

Structure of catk covalently bound to a dioxo-triazine inhibitor
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Cathepsin K
publication title Dioxo-triazines as a novel series of cathepsin K inhibitors
pubmed doi rcsb
source organism Homo sapiens
total genus 62
structure length 215
sequence length 215
chains with identical sequence Y
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2009-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3kwbX00
1F2BA 3N3GA 2XU3A 4ZUXU 2YJ2A 1F2AA 3MHHA 2FO5A 2FRQA 2AS8A 5PADA 1U9XA 1AU0A 1O0EA 2NQIA 1NQCA 3QT4A 3CBKA 1KFUL 1X9YA 3TNXA 1NPZA 4MZOA 2DJFB 3KX1A 1NL6A 2YJ8A 3MTNA 4YYWA 2FYEA 3KW9A 2P0RA 1ATKA 2AUXA 4MZSA 2P7UA 3HWNA 1U9WA 2BDLA 3B79A 6PADA 4PI3A 1KFXL 3KFQA 5CHVA 3DF0A 3IV2A 2G8EA 2DC7A 2VHSA 3RVWA 3K9MA 1IWDA 4HWYA 1NB5A 2FTDA 1SNKA 5K16A 2R9OA 1QXPA 1PPDA 4FJCA 2DC8A 2OP3A 2ARYA 2AYOA 2E03A 1A6RA 2G7YA 1Y08A 3H8BA 2H7JA 3AI8A 1JQPA 2F7DA 1KXRA 1CVZA 2E00A 3CH2X 3I3TA 1F2CA 2AUZA 3K24A 3BPFA 2P86A 1YALA 2NQAA 4CZWA 4YV8A 3HHIA 4N4ZA 4I04A 2JQFR 1STFE 2DZZA 2Y6EA 3LFYA 2F1GA 3QJ3A 2HHNA 1S4VA 3I06A 2ATOA 1NB3A 3BCNA 2VHFA 5A24A 3OF8A 1AYUA 2YJ9A 3BPMA 2DCBA 4Q8HA 2YJBA 1U9VA 5JH3A 4OEMA 3PDFA 4X6JA 1PBHA 3PBHA 1PADA 2FQ9A 1ME4A 3F75A 1MEMA 1QOLA 4KLBA 1ITOA 4FIPA 3P5WA 4QH6A 3OISA 3KKUA 3OF9A 3P5UA 1MS6A 1EWOA 2DCDA 3HHAA 3IUTA 4YYVA 4I07A 4N8WA 1AU2A 1CTEA 1PIPA 3H6SA 2G8JA 2PNSA 3P5VA 4Q8GA 3E1ZB 4PADA 2DJGB 1NLJA 1Q6KA 4QRVA 1YT7A 5CVOB 1AU3A 4P6GA 4QBBA 4W4UA 3O1GA 1SP4B 1PPOA 4YYUA 2CIOA 3S3RA 3MORA 1ICFA 1FH0A 3CH3X 4K7CA 3KWBX 1ME3A 2R9NA 1AIMA 1EF7A 2R9MA 2FUDA 4YYQA 1KHQA 3C9EA 2DC9A 4PP2E 1HUCB 1PPNA 3IEJA 4WA6A 5F02A 4BS5A 1QMYA 1M6DA 2PREA 2AYNA 4X6IA 4YVAA 8PCHA 1PXVA 3KSEA 3D6SA 3WXFA 1XKGA 1YVBA 1ZIVA 4FK5A 1PPPA 5J94A 3U8EA 2R9FA 4AXMA 3GCBA 4X6HA 3QSDA 1CPJA 2DC6A 1POPA 3WXGA 4PP1A 4CDCB 3BC3A 2NQDB 1BY8A 3BOWA 1VSNA 2HH5A 1THEA 4MSXA 1GMYA 2E01A 2HXZA 5CVMA 9PAPA 5CVNB 4DMYA 4DMXA 1TU6A 5JA7A 1BGOA 2G6DA 1MHWA 2CB5A 4W5BA 1ZCMA 3V6CA 3M99A 1EWMA 2ACTA 2NQGA 2R9CA 2FT2A 4G54A 5FPWA 2JQGR 1K3BB 1BQIA 1TL9A 2Y5BA 1DF0A 1TLOA 1U9QX 1BP4A 1EWPA 1KHPA 2DCAA 3OVZA 3N4CA 4YYRA 2DCCA 2FRAA 1AYVA 3H7DA 3V6EA 1U5IA 2OULA 2XU1A 2E02A 1DEUA 1MDWA 2B1NA 3O0UA 2R6NA 3BWKA 2IPPB 4BPVA 1YK7A 4CDDB 2XU5A 4I05A 3HD3A 2PBHA 1AECA 3ERVA 4XR7A 4AXLA 4YYSA 2AIMA 2BDZA 3F5VA 1EWLA 3IMAA 1Y4HA 3LXSA 4QRGA 4BS6A 4CDFB 1QDQA 2GHUA 3NHEA 1PE6A 3RVVA 1PCIA 4RY2A 2PADA 4CDEB 3OVXA 3N3KA 3RVXA 5EF4A 4N79A 2GFOA 2AU1A 2B1MA 2O6XA 1CJLA 3PW3A 4P6EA 3IOQA 3P5XA 1CS8A 3H8CA 1AU4A 2AVWA 1CQDA 3IHPA 3ZUAA 5CHTA 3WXEA 2DZYA 1MIRA 1CB5A 2OZ2A 3MHSA 4QRXA 4W5CA 3K8UA 3KWZA 4BQVA 2HD5A 1F29A 1CSBB 1GECE 3S3QA 4XUIA 1AYWA 1YK8A 1VJVA 4BSQA 3USVA 3PNRA 3CBJA 2WBFX 5EGWA 1CV8A 1GCBA 1GLOA 2IBIA 4OELA 3H89A 1MEGA 7PCKA 2XU4A 2YJCA 2C0YA
chains in the Genus database with same CATH superfamily
1F2BA 3N3GA 2XU3A 4ZUXU 2YJ2A 1F2AA 3MHHA 2FO5A 2FRQA 2AS8A 5PADA 1U9XA 1AU0A 1O0EA 2NQIA 1NQCA 3QT4A 3CBKA 1KFUL 1X9YA 2BTWA 3TNXA 1NPZA 4MZOA 2DJFB 3KX1A 1NL6A 2J7QA 2YJ8A 3MTNA 4YYWA 2FYEA 3KW9A 2P0RA 4RKXA 1ATKA 2AUXA 3IFUA 4MZSA 2P7UA 3HWNA 1U9WA 2BDLA 3B79A 4XZXA 6PADA 4PI3A 1KFXL 3KFQA 5CHVA 3DF0A 4OW0A 3IV2A 2G8EA 2DC7A 3ZNHA 2VHSA 3RVWA 3K9MA 1IWDA 2AGAA 4HWYA 1NB5A 2FTDA 4OVZB 1SNKA 5K16A 2R9OA 1QXPA 1PPDA 4FJCA 2DC8A 3PSEA 2OP3A 2ARYA 2AYOA 2E03A 1A6RA 2G7YA 1Y08A 3H8BA 2H7JA 3AI8A 1JQPA 1PVJA 2F7DA 1KXRA 1CVZA 2E00A 3CH2X 3I3TA 1F2CA 2AUZA 3K24A 3BPFA 2P86A 2UZJA 1YALA 2NQAA 4BOSA 4CZWA 4YV8A 3HHIA 4N4ZA 2HWKA 4I04A 2JQFR 3B21A 1STFE 2DZZA 2Y6EA 3BBAA 3LFYA 2F1GA 3QJ3A 2HHNA 1S4VA 3I06A 2ATOA 1NB3A 3BCNA 4RF0A 2VHFA 5A24A 3OF8A 1AYUA 2YJ9A 3BPMA 2DCBA 4Q8HA 2YJBA 1U9VA 5JH3A 3O65A 3PHWA 4OEMA 3PDFA 4X6JA 2BTWB 1PBHA 3PBHA 1PADA 4BOPA 2FQ9A 1ME4A 3F75A 1MEMA 1QOLA 4IP3A 4KLBA 1ITOA 4FIPA 3P5WA 4QH6A 3OISA 3KKUA 3OF9A 3P5UA 1MS6A 3BB7A 1EWOA 2DCDA 3HHAA 3IUTA 4YYVA 3PT2A 4WURA 4I07A 4N8WA 1AU2A 1CTEA 3W31A 1PIPA 3H6SA 4P16A 2G8JA 2PNSA 3P5VA 3E1ZB 4Q8GA 4PADA 2DJGB 1NLJA 1Q6KA 4QRVA 1YT7A 5CVOB 1AU3A 4P6GA 4QBBA 4W4UA 3O1GA 4ZTBA 1SP4B 1PPOA 4RF1A 4YYUA 2CIOA 3S3RA 3MORA 1ICFA 2Z84A 1FH0A 3CH3X 4K7CA 3KWBX 1ME3A 2R9NA 1AIMA 1YZBA 1EF7A 2R9MA 2FUDA 4YYQA 1KHQA 3C9EA 2DC9A 4PP2E 5E6JA 1HUCB 1PPNA 3IEJA 4WA6A 5F02A 4BS5A 1QMYA 1M6DA 2PREA 2AYNA 4X6IA 4YVAA 8PCHA 1PXVA 1UKFA 3KSEA 3D6SA 3WXFA 4REZA 1XKGA 1YVBA 1ZIVA 4FK5A 1PPPA 4OVZA 5J94A 2R9FA 3U8EA 4AXMA 3GCBA 4X6HA 3QSDA 1CPJA 2DC6A 1POPA 3PHUA 3WXGA 4PP1A 4CDCB 3BC3A 2NQDB 1BY8A 3BOWA 3MJ5A 1VSNA 2HH5A 4D8IA 1THEA 2BU3A 4M0WA 4MSXA 1GMYA 2E01A 2JRIA 2HXZA 5CVMA 9PAPA 5CVNB 4DMYA 4DMXA 1TU6A 5JA7A 1BGOA 2G6DA 1MHWA 4D8BA 5KO3A 2CB5A 4W5BA 4BOZA 1ZCMA 3V6CA 3M99A 1EWMA 2DOSA 2ACTA 2NQGA 2R9CA 2FT2A 4G54A 5FPWA 2JQGR 1K3BB 1BQIA 1TL9A 2Y5BA 1DF0A 3MTVA 1TLOA 1U9QX 1BP4A 1EWPA 1KHPA 2DCAA 3PRMA 3OVZA 2J7QC 3W30A 3N4CA 4YYRA 2DCCA 2FRAA 3TMPA 4BOUA 1AYVA 3H7DA 4A5UA 3V6EA 1U5IA 2OULA 2XU1A 2E02A 4HXDB 1DEUA 1MDWA 2B1NA 3RNVA 3E9SA 3O0UA 2R6NA 3BWKA 2IPPB 4BPVA 1YK7A 4CDDB 2XU5A 4I05A 3HD3A 2PBHA 4BOQA 1AECA 3ERVA 4GUAA 3PHXA 4XR7A 4AXLA 4YYSA 2AIMA 1DKIA 3OQCA 2BDZA 3F5VA 1EWLA 4R3DA 2FE8A 3IMAA 1Y4HA 3LXSA 4QRGA 4BS6A 4CDFB 1QDQA 2JTCA 2GHUA 3NHEA 1PE6A 4IUMA 3RVVA 1PCIA 3MP2A 3PRPA 4RY2A 2PADA 4CDEB 3OVXA 3N3KA 3RVXA 5EF4A 4N79A 2GFOA 2AU1A 2B1MA 2O6XA 1CJLA 5EZSA 3PW3A 4P6EA 5JZEA 4PT5A 3IOQA 3P5XA 1CS8A 3H8CA 1AU4A 2AVWA 1CQDA 4RNAA 3IHPA 3ZUAA 5CHTA 3WXEA 4MI7A 2DZYA 1MIRA 3BY4A 1CB5A 2OZ2A 3MHSA 4QRXA 4W5CA 3K8UA 3KWZA 4BQVA 2HD5A 5EZQA 1F29A 1CSBB 1GECE 4MM3B 3C0RA 3S3QA 4XUIA 1AYWA 1YK8A 1VJVA 4BSQA 3USVA 3PNRA 3CBJA 2WBFX 5EGWA 1CV8A 1GCBA 1GLOA 2IBIA 4OELA 4D8EA 3H89A 1MEGA 7PCKA 3TRKA 2XU4A 2YJCA 2C0YA
chains in the Genus database with same CATH topology
1F2BA 3N3GA 2XU3A 4ZUXU 2YJ2A 1F2AA 3MHHA 2FO5A 2FRQA 2AS8A 5PADA 1U9XA 1AU0A 1O0EA 2NQIA 1NQCA 3QT4A 3CBKA 1KFUL 1X9YA 3TNXA 1NPZA 4MZOA 2DJFB 3KX1A 1NL6A 2YJ8A 3MTNA 4YYWA 2FYEA 3KW9A 2P0RA 1ATKA 2AUXA 4MZSA 2P7UA 1W4TA 3HWNA 1U9WA 2BDLA 3D9WA 3B79A 6PADA 4PI3A 1KFXL 3KFQA 5CHVA 3DF0A 3IV2A 2G8EA 2DC7A 2VHSA 3RVWA 3K9MA 1IWDA 4HWYA 1NB5A 2FTDA 1SNKA 5K16A 2R9OA 1QXPA 1PPDA 4FJCA 2DC8A 2OP3A 2ARYA 2AYOA 2E03A 1A6RA 2G7YA 1Y08A 3H8BA 2H7JA 3AI8A 1JQPA 2F7DA 1KXRA 1CVZA 2E00A 3CH2X 3I3TA 1F2CA 2AUZA 3K24A 4GUZA 3BPFA 2P86A 1YALA 2NQAA 4CZWA 4YV8A 3HHIA 4N4ZA 4I04A 2JQFR 1STFE 2DZZA 2Y6EA 3LFYA 2F1GA 3QJ3A 2HHNA 1S4VA 3I06A 2ATOA 1NB3A 3BCNA 2BSZA 2VHFA 5A24A 3OF8A 1AYUA 2YJ9A 3BPMA 2DCBA 4Q8HA 2YJBA 1U9VA 5JH3A 4OEMA 3PDFA 4X6JA 1PBHA 3PBHA 1PADA 2FQ9A 1ME4A 3F75A 1MEMA 1QOLA 4KLBA 1ITOA 4FIPA 3P5WA 2VFCA 4QH6A 3OISA 3KKUA 3OF9A 3P5UA 1MS6A 4B55A 1EWOA 2DCDA 3HHAA 3IUTA 4YYVA 4I07A 4N8WA 1AU2A 1CTEA 4NV8A 1PIPA 3H6SA 2G8JA 2PNSA 3P5VA 3E1ZB 4Q8GA 3LTWA 4PADA 2DJGB 1NLJA 1Q6KA 4QRVA 1YT7A 5CVOB 1AU3A 4P6GA 4QBBA 4W4UA 3O1GA 1W5RA 1SP4B 1PPOA 4YYUA 2CIOA 3S3RA 3MORA 1ICFA 1FH0A 3CH3X 4K7CA 3KWBX 1ME3A 2R9NA 1AIMA 1EF7A 2R9MA 2FUDA 4YYQA 1KHQA 3C9EA 2DC9A 4PP2E 1HUCB 1E2TA 1PPNA 3IEJA 4WA6A 5F02A 4BS5A 1QMYA 1M6DA 2PREA 2AYNA 4X6IA 4YVAA 8PCHA 1PXVA 3KSEA 3D6SA 3WXFA 1XKGA 1YVBA 1ZIVA 4FK5A 1PPPA 5J94A 3U8EA 2R9FA 4AXMA 3GCBA 4X6HA 3QSDA 1CPJA 2DC6A 1POPA 3WXGA 4PP1A 4CDCB 3BC3A 2NQDB 1BY8A 3BOWA 1VSNA 2HH5A 1THEA 4MSXA 4NV7A 1GMYA 2E01A 2HXZA 5CVMA 9PAPA 1W6FA 5CVNB 4DMYA 4DMXA 1TU6A 5JA7A 1BGOA 2G6DA 1MHWA 2CB5A 4W5BA 1ZCMA 3V6CA 3M99A 2VFBA 4C5PA 1EWMA 2ACTA 2NQGA 2R9CA 2FT2A 4G54A 5FPWA 2JQGR 1K3BB 1BQIA 1TL9A 2Y5BA 1DF0A 1TLOA 1U9QX 1BP4A 1EWPA 1KHPA 2DCAA 3OVZA 3N4CA 4YYRA 2DCCA 2FRAA 1AYVA 3H7DA 3V6EA 1U5IA 2OULA 2XU1A 2E02A 1DEUA 1MDWA 2B1NA 3O0UA 2R6NA 3BWKA 2IPPB 4BPVA 1YK7A 4CDDB 2XU5A 4I05A 3HD3A 2PBHA 1AECA 3ERVA 4XR7A 4AXLA 4YYSA 2AIMA 2BDZA 3F5VA 1EWLA 3IMAA 1Y4HA 3LXSA 4QRGA 4BGFA 4BS6A 4CDFB 1QDQA 2GHUA 3NHEA 1PE6A 3RVVA 1PCIA 4RY2A 2PADA 4CDEB 3OVXA 3N3KA 3RVXA 5EF4A 4N79A 2GFOA 2AU1A 2B1MA 2O6XA 1CJLA 3PW3A 4P6EA 3IOQA 3P5XA 1CS8A 3H8CA 1AU4A 2AVWA 1CQDA 3IHPA 3ZUAA 5CHTA 3WXEA 2DZYA 1MIRA 1CB5A 2OZ2A 3MHSA 4QRXA 4W5CA 3K8UA 3KWZA 4BQVA 2HD5A 1F29A 1CSBB 1GECE 3S3QA 4XUIA 1AYWA 1YK8A 1VJVA 4BSQA 3USVA 3PNRA 3CBJA 2WBFX 5EGWA 1CV8A 1GCBA 1GLOA 2IBIA 4OELA 3H89A 1MEGA 1GX3A 7PCKA 2XU4A 2YJCA 2C0YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F2B A;  3N3G A;  2XU3 A;  4ZUX U;  2YJ2 A;  1F2A A;  3MHH A;  2FO5 A;  2FRQ A;  2AS8 A;  5PAD A;  1U9X A;  1AU0 A;  1O0E A;  2NQI A;  1NQC A;  3QT4 A;  3CBK A;  1KFU L;  1X9Y A;  3TNX A;  1NPZ A;  4MZO A;  2DJF B;  3KX1 A;  1NL6 A;  2YJ8 A;  3MTN A;  4YYW A;  2FYE A;  3KW9 A;  2P0R A;  1ATK A;  2AUX A;  4MZS A;  2P7U A;  3HWN A;  1U9W A;  2BDL A;  3B79 A;  6PAD A;  4PI3 A;  1KFX L;  3KFQ A;  5CHV A;  3DF0 A;  3IV2 A;  2G8E A;  2DC7 A;  2VHS A;  3RVW A;  3K9M A;  1IWD A;  4HWY A;  1NB5 A;  2FTD A;  1SNK A;  5K16 A;  2R9O A;  1QXP A;  1PPD A;  4FJC A;  2DC8 A;  2OP3 A;  2ARY A;  2AYO A;  2E03 A;  1A6R A;  2G7Y A;  1Y08 A;  3H8B A;  2H7J A;  3AI8 A;  1JQP A;  2F7D A;  1KXR A;  1CVZ A;  2E00 A;  3CH2 X;  3I3T A;  1F2C A;  2AUZ A;  3K24 A;  3BPF A;  2P86 A;  1YAL A;  2NQA A;  4CZW A;  4YV8 A;  3HHI A;  4N4Z A;  4I04 A;  2JQF R;  1STF E;  2DZZ A;  2Y6E A;  3LFY A;  2F1G A;  3QJ3 A;  2HHN A;  1S4V A;  3I06 A;  2ATO A;  1NB3 A;  3BCN A;  2VHF A;  5A24 A;  3OF8 A;  1AYU A;  2YJ9 A;  3BPM A;  2DCB A;  4Q8H A;  2YJB A;  1U9V A;  5JH3 A;  4OEM A;  3PDF A;  4X6J A;  1PBH A;  3PBH A;  1PAD A;  2FQ9 A;  1ME4 A;  3F75 A;  1MEM A;  1QOL A;  4KLB A;  1ITO A;  4FIP A;  3P5W A;  4QH6 A;  3OIS A;  3KKU A;  3OF9 A;  3P5U A;  1MS6 A;  1EWO A;  2DCD A;  3HHA A;  3IUT A;  4YYV A;  4I07 A;  4N8W A;  1AU2 A;  1CTE A;  1PIP A;  3H6S A;  2G8J A;  2PNS A;  3P5V A;  4Q8G A;  3E1Z B;  4PAD A;  2DJG B;  1NLJ A;  1Q6K A;  4QRV A;  1YT7 A;  5CVO B;  1AU3 A;  4P6G A;  4QBB A;  4W4U A;  3O1G A;  1SP4 B;  1PPO A;  4YYU A;  2CIO A;  3S3R A;  3MOR A;  1ICF A;  1FH0 A;  3CH3 X;  4K7C A;  3KWB X;  1ME3 A;  2R9N A;  1AIM A;  1EF7 A;  2R9M A;  2FUD A;  4YYQ A;  1KHQ A;  3C9E A;  2DC9 A;  4PP2 E;  1HUC B;  1PPN A;  3IEJ A;  4WA6 A;  5F02 A;  4BS5 A;  1QMY A;  1M6D A;  2PRE A;  2AYN A;  4X6I A;  4YVA A;  8PCH A;  1PXV A;  3KSE A;  3D6S A;  3WXF A;  1XKG A;  1YVB A;  1ZIV A;  4FK5 A;  1PPP A;  5J94 A;  3U8E A;  2R9F A;  4AXM A;  3GCB A;  4X6H A;  3QSD A;  1CPJ A;  2DC6 A;  1POP A;  3WXG A;  4PP1 A;  4CDC B;  3BC3 A;  2NQD B;  1BY8 A;  3BOW A;  1VSN A;  2HH5 A;  1THE A;  4MSX A;  1GMY A;  2E01 A;  2HXZ A;  5CVM A;  9PAP A;  5CVN B;  4DMY A;  4DMX A;  1TU6 A;  5JA7 A;  1BGO A;  2G6D A;  1MHW A;  2CB5 A;  4W5B A;  1ZCM A;  3V6C A;  3M99 A;  1EWM A;  2ACT A;  2NQG A;  2R9C A;  2FT2 A;  4G54 A;  5FPW A;  2JQG R;  1K3B B;  1BQI A;  1TL9 A;  2Y5B A;  1DF0 A;  1TLO A;  1U9Q X;  1BP4 A;  1EWP A;  1KHP A;  2DCA A;  3OVZ A;  3N4C A;  4YYR A;  2DCC A;  2FRA A;  1AYV A;  3H7D A;  3V6E A;  1U5I A;  2OUL A;  2XU1 A;  2E02 A;  1DEU A;  1MDW A;  2B1N A;  3O0U A;  2R6N A;  3BWK A;  2IPP B;  4BPV A;  1YK7 A;  4CDD B;  2XU5 A;  4I05 A;  3HD3 A;  2PBH A;  1AEC A;  3ERV A;  4XR7 A;  4AXL A;  4YYS A;  2AIM A;  2BDZ A;  3F5V A;  1EWL A;  3IMA A;  1Y4H A;  3LXS A;  4QRG A;  4BS6 A;  4CDF B;  1QDQ A;  2GHU A;  3NHE A;  1PE6 A;  3RVV A;  1PCI A;  4RY2 A;  2PAD A;  4CDE B;  3OVX A;  3N3K A;  3RVX A;  5EF4 A;  4N79 A;  2GFO A;  2AU1 A;  2B1M A;  2O6X A;  1CJL A;  3PW3 A;  4P6E A;  3IOQ A;  3P5X A;  1CS8 A;  3H8C A;  1AU4 A;  2AVW A;  1CQD A;  3IHP A;  3ZUA A;  5CHT A;  3WXE A;  2DZY A;  1MIR A;  1CB5 A;  2OZ2 A;  3MHS A;  4QRX A;  4W5C A;  3K8U A;  3KWZ A;  4BQV A;  2HD5 A;  1F29 A;  1CSB B;  1GEC E;  3S3Q A;  4XUI A;  1AYW A;  1YK8 A;  1VJV A;  4BSQ A;  3USV A;  3PNR A;  3CBJ A;  2WBF X;  5EGW A;  1CV8 A;  1GCB A;  1GLO A;  2IBI A;  4OEL A;  3H89 A;  1MEG A;  7PCK A;  2XU4 A;  2YJC A;  2C0Y A; 
#chains in the Genus database with same CATH topology
 1F2B A;  3N3G A;  2XU3 A;  4ZUX U;  2YJ2 A;  1F2A A;  3MHH A;  2FO5 A;  2FRQ A;  2AS8 A;  5PAD A;  1U9X A;  1AU0 A;  1O0E A;  2NQI A;  1NQC A;  3QT4 A;  3CBK A;  1KFU L;  1X9Y A;  2BTW A;  3TNX A;  1NPZ A;  4MZO A;  2DJF B;  3KX1 A;  1NL6 A;  2J7Q A;  2YJ8 A;  3MTN A;  4YYW A;  2FYE A;  3KW9 A;  2P0R A;  4RKX A;  1ATK A;  2AUX A;  3IFU A;  4MZS A;  2P7U A;  3HWN A;  1U9W A;  2BDL A;  3B79 A;  4XZX A;  6PAD A;  4PI3 A;  1KFX L;  3KFQ A;  5CHV A;  3DF0 A;  4OW0 A;  3IV2 A;  2G8E A;  2DC7 A;  3ZNH A;  2VHS A;  3RVW A;  3K9M A;  1IWD A;  2AGA A;  4HWY A;  1NB5 A;  2FTD A;  4OVZ B;  1SNK A;  5K16 A;  2R9O A;  1QXP A;  1PPD A;  4FJC A;  2DC8 A;  3PSE A;  2OP3 A;  2ARY A;  2AYO A;  2E03 A;  1A6R A;  2G7Y A;  1Y08 A;  3H8B A;  2H7J A;  3AI8 A;  1JQP A;  1PVJ A;  2F7D A;  1KXR A;  1CVZ A;  2E00 A;  3CH2 X;  3I3T A;  1F2C A;  2AUZ A;  3K24 A;  3BPF A;  2P86 A;  2UZJ A;  1YAL A;  2NQA A;  4BOS A;  4CZW A;  4YV8 A;  3HHI A;  4N4Z A;  2HWK A;  4I04 A;  2JQF R;  3B21 A;  1STF E;  2DZZ A;  2Y6E A;  3BBA A;  3LFY A;  2F1G A;  3QJ3 A;  2HHN A;  1S4V A;  3I06 A;  2ATO A;  1NB3 A;  3BCN A;  4RF0 A;  2VHF A;  5A24 A;  3OF8 A;  1AYU A;  2YJ9 A;  3BPM A;  2DCB A;  4Q8H A;  2YJB A;  1U9V A;  5JH3 A;  3O65 A;  3PHW A;  4OEM A;  3PDF A;  4X6J A;  2BTW B;  1PBH A;  3PBH A;  1PAD A;  4BOP A;  2FQ9 A;  1ME4 A;  3F75 A;  1MEM A;  1QOL A;  4IP3 A;  4KLB A;  1ITO A;  4FIP A;  3P5W A;  4QH6 A;  3OIS A;  3KKU A;  3OF9 A;  3P5U A;  1MS6 A;  3BB7 A;  1EWO A;  2DCD A;  3HHA A;  3IUT A;  4YYV A;  3PT2 A;  4WUR A;  4I07 A;  4N8W A;  1AU2 A;  1CTE A;  3W31 A;  1PIP A;  3H6S A;  4P16 A;  2G8J A;  2PNS A;  3P5V A;  3E1Z B;  4Q8G A;  4PAD A;  2DJG B;  1NLJ A;  1Q6K A;  4QRV A;  1YT7 A;  5CVO B;  1AU3 A;  4P6G A;  4QBB A;  4W4U A;  3O1G A;  4ZTB A;  1SP4 B;  1PPO A;  4RF1 A;  4YYU A;  2CIO A;  3S3R A;  3MOR A;  1ICF A;  2Z84 A;  1FH0 A;  3CH3 X;  4K7C A;  3KWB X;  1ME3 A;  2R9N A;  1AIM A;  1YZB A;  1EF7 A;  2R9M A;  2FUD A;  4YYQ A;  1KHQ A;  3C9E A;  2DC9 A;  4PP2 E;  5E6J A;  1HUC B;  1PPN A;  3IEJ A;  4WA6 A;  5F02 A;  4BS5 A;  1QMY A;  1M6D A;  2PRE A;  2AYN A;  4X6I A;  4YVA A;  8PCH A;  1PXV A;  1UKF A;  3KSE A;  3D6S A;  3WXF A;  4REZ A;  1XKG A;  1YVB A;  1ZIV A;  4FK5 A;  1PPP A;  4OVZ A;  5J94 A;  2R9F A;  3U8E A;  4AXM A;  3GCB A;  4X6H A;  3QSD A;  1CPJ A;  2DC6 A;  1POP A;  3PHU A;  3WXG A;  4PP1 A;  4CDC B;  3BC3 A;  2NQD B;  1BY8 A;  3BOW A;  3MJ5 A;  1VSN A;  2HH5 A;  4D8I A;  1THE A;  2BU3 A;  4M0W A;  4MSX A;  1GMY A;  2E01 A;  2JRI A;  2HXZ A;  5CVM A;  9PAP A;  5CVN B;  4DMY A;  4DMX A;  1TU6 A;  5JA7 A;  1BGO A;  2G6D A;  1MHW A;  4D8B A;  5KO3 A;  2CB5 A;  4W5B A;  4BOZ A;  1ZCM A;  3V6C A;  3M99 A;  1EWM A;  2DOS A;  2ACT A;  2NQG A;  2R9C A;  2FT2 A;  4G54 A;  5FPW A;  2JQG R;  1K3B B;  1BQI A;  1TL9 A;  2Y5B A;  1DF0 A;  3MTV A;  1TLO A;  1U9Q X;  1BP4 A;  1EWP A;  1KHP A;  2DCA A;  3PRM A;  3OVZ A;  2J7Q C;  3W30 A;  3N4C A;  4YYR A;  2DCC A;  2FRA A;  3TMP A;  4BOU A;  1AYV A;  3H7D A;  4A5U A;  3V6E A;  1U5I A;  2OUL A;  2XU1 A;  2E02 A;  4HXD B;  1DEU A;  1MDW A;  2B1N A;  3RNV A;  3E9S A;  3O0U A;  2R6N A;  3BWK A;  2IPP B;  4BPV A;  1YK7 A;  4CDD B;  2XU5 A;  4I05 A;  3HD3 A;  2PBH A;  4BOQ A;  1AEC A;  3ERV A;  4GUA A;  3PHX A;  4XR7 A;  4AXL A;  4YYS A;  2AIM A;  1DKI A;  3OQC A;  2BDZ A;  3F5V A;  1EWL A;  4R3D A;  2FE8 A;  3IMA A;  1Y4H A;  3LXS A;  4QRG A;  4BS6 A;  4CDF B;  1QDQ A;  2JTC A;  2GHU A;  3NHE A;  1PE6 A;  4IUM A;  3RVV A;  1PCI A;  3MP2 A;  3PRP A;  4RY2 A;  2PAD A;  4CDE B;  3OVX A;  3N3K A;  3RVX A;  5EF4 A;  4N79 A;  2GFO A;  2AU1 A;  2B1M A;  2O6X A;  1CJL A;  5EZS A;  3PW3 A;  4P6E A;  5JZE A;  4PT5 A;  3IOQ A;  3P5X A;  1CS8 A;  3H8C A;  1AU4 A;  2AVW A;  1CQD A;  4RNA A;  3IHP A;  3ZUA A;  5CHT A;  3WXE A;  4MI7 A;  2DZY A;  1MIR A;  3BY4 A;  1CB5 A;  2OZ2 A;  3MHS A;  4QRX A;  4W5C A;  3K8U A;  3KWZ A;  4BQV A;  2HD5 A;  5EZQ A;  1F29 A;  1CSB B;  1GEC E;  4MM3 B;  3C0R A;  3S3Q A;  4XUI A;  1AYW A;  1YK8 A;  1VJV A;  4BSQ A;  3USV A;  3PNR A;  3CBJ A;  2WBF X;  5EGW A;  1CV8 A;  1GCB A;  1GLO A;  2IBI A;  4OEL A;  4D8E A;  3H89 A;  1MEG A;  7PCK A;  3TRK A;  2XU4 A;  2YJC A;  2C0Y A; 
#chains in the Genus database with same CATH homology
 1F2B A;  3N3G A;  2XU3 A;  4ZUX U;  2YJ2 A;  1F2A A;  3MHH A;  2FO5 A;  2FRQ A;  2AS8 A;  5PAD A;  1U9X A;  1AU0 A;  1O0E A;  2NQI A;  1NQC A;  3QT4 A;  3CBK A;  1KFU L;  1X9Y A;  3TNX A;  1NPZ A;  4MZO A;  2DJF B;  3KX1 A;  1NL6 A;  2YJ8 A;  3MTN A;  4YYW A;  2FYE A;  3KW9 A;  2P0R A;  1ATK A;  2AUX A;  4MZS A;  2P7U A;  1W4T A;  3HWN A;  1U9W A;  2BDL A;  3D9W A;  3B79 A;  6PAD A;  4PI3 A;  1KFX L;  3KFQ A;  5CHV A;  3DF0 A;  3IV2 A;  2G8E A;  2DC7 A;  2VHS A;  3RVW A;  3K9M A;  1IWD A;  4HWY A;  1NB5 A;  2FTD A;  1SNK A;  5K16 A;  2R9O A;  1QXP A;  1PPD A;  4FJC A;  2DC8 A;  2OP3 A;  2ARY A;  2AYO A;  2E03 A;  1A6R A;  2G7Y A;  1Y08 A;  3H8B A;  2H7J A;  3AI8 A;  1JQP A;  2F7D A;  1KXR A;  1CVZ A;  2E00 A;  3CH2 X;  3I3T A;  1F2C A;  2AUZ A;  3K24 A;  4GUZ A;  3BPF A;  2P86 A;  1YAL A;  2NQA A;  4CZW A;  4YV8 A;  3HHI A;  4N4Z A;  4I04 A;  2JQF R;  1STF E;  2DZZ A;  2Y6E A;  3LFY A;  2F1G A;  3QJ3 A;  2HHN A;  1S4V A;  3I06 A;  2ATO A;  1NB3 A;  3BCN A;  2BSZ A;  2VHF A;  5A24 A;  3OF8 A;  1AYU A;  2YJ9 A;  3BPM A;  2DCB A;  4Q8H A;  2YJB A;  1U9V A;  5JH3 A;  4OEM A;  3PDF A;  4X6J A;  1PBH A;  3PBH A;  1PAD A;  2FQ9 A;  1ME4 A;  3F75 A;  1MEM A;  1QOL A;  4KLB A;  1ITO A;  4FIP A;  3P5W A;  2VFC A;  4QH6 A;  3OIS A;  3KKU A;  3OF9 A;  3P5U A;  1MS6 A;  4B55 A;  1EWO A;  2DCD A;  3HHA A;  3IUT A;  4YYV A;  4I07 A;  4N8W A;  1AU2 A;  1CTE A;  4NV8 A;  1PIP A;  3H6S A;  2G8J A;  2PNS A;  3P5V A;  3E1Z B;  4Q8G A;  3LTW A;  4PAD A;  2DJG B;  1NLJ A;  1Q6K A;  4QRV A;  1YT7 A;  5CVO B;  1AU3 A;  4P6G A;  4QBB A;  4W4U A;  3O1G A;  1W5R A;  1SP4 B;  1PPO A;  4YYU A;  2CIO A;  3S3R A;  3MOR A;  1ICF A;  1FH0 A;  3CH3 X;  4K7C A;  3KWB X;  1ME3 A;  2R9N A;  1AIM A;  1EF7 A;  2R9M A;  2FUD A;  4YYQ A;  1KHQ A;  3C9E A;  2DC9 A;  4PP2 E;  1HUC B;  1E2T A;  1PPN A;  3IEJ A;  4WA6 A;  5F02 A;  4BS5 A;  1QMY A;  1M6D A;  2PRE A;  2AYN A;  4X6I A;  4YVA A;  8PCH A;  1PXV A;  3KSE A;  3D6S A;  3WXF A;  1XKG A;  1YVB A;  1ZIV A;  4FK5 A;  1PPP A;  5J94 A;  3U8E A;  2R9F A;  4AXM A;  3GCB A;  4X6H A;  3QSD A;  1CPJ A;  2DC6 A;  1POP A;  3WXG A;  4PP1 A;  4CDC B;  3BC3 A;  2NQD B;  1BY8 A;  3BOW A;  1VSN A;  2HH5 A;  1THE A;  4MSX A;  4NV7 A;  1GMY A;  2E01 A;  2HXZ A;  5CVM A;  9PAP A;  1W6F A;  5CVN B;  4DMY A;  4DMX A;  1TU6 A;  5JA7 A;  1BGO A;  2G6D A;  1MHW A;  2CB5 A;  4W5B A;  1ZCM A;  3V6C A;  3M99 A;  2VFB A;  4C5P A;  1EWM A;  2ACT A;  2NQG A;  2R9C A;  2FT2 A;  4G54 A;  5FPW A;  2JQG R;  1K3B B;  1BQI A;  1TL9 A;  2Y5B A;  1DF0 A;  1TLO A;  1U9Q X;  1BP4 A;  1EWP A;  1KHP A;  2DCA A;  3OVZ A;  3N4C A;  4YYR A;  2DCC A;  2FRA A;  1AYV A;  3H7D A;  3V6E A;  1U5I A;  2OUL A;  2XU1 A;  2E02 A;  1DEU A;  1MDW A;  2B1N A;  3O0U A;  2R6N A;  3BWK A;  2IPP B;  4BPV A;  1YK7 A;  4CDD B;  2XU5 A;  4I05 A;  3HD3 A;  2PBH A;  1AEC A;  3ERV A;  4XR7 A;  4AXL A;  4YYS A;  2AIM A;  2BDZ A;  3F5V A;  1EWL A;  3IMA A;  1Y4H A;  3LXS A;  4QRG A;  4BGF A;  4BS6 A;  4CDF B;  1QDQ A;  2GHU A;  3NHE A;  1PE6 A;  3RVV A;  1PCI A;  4RY2 A;  2PAD A;  4CDE B;  3OVX A;  3N3K A;  3RVX A;  5EF4 A;  4N79 A;  2GFO A;  2AU1 A;  2B1M A;  2O6X A;  1CJL A;  3PW3 A;  4P6E A;  3IOQ A;  3P5X A;  1CS8 A;  3H8C A;  1AU4 A;  2AVW A;  1CQD A;  3IHP A;  3ZUA A;  5CHT A;  3WXE A;  2DZY A;  1MIR A;  1CB5 A;  2OZ2 A;  3MHS A;  4QRX A;  4W5C A;  3K8U A;  3KWZ A;  4BQV A;  2HD5 A;  1F29 A;  1CSB B;  1GEC E;  3S3Q A;  4XUI A;  1AYW A;  1YK8 A;  1VJV A;  4BSQ A;  3USV A;  3PNR A;  3CBJ A;  2WBF X;  5EGW A;  1CV8 A;  1GCB A;  1GLO A;  2IBI A;  4OEL A;  3H89 A;  1MEG A;  1GX3 A;  7PCK A;  2XU4 A;  2YJC A;  2C0Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...