1EWLA

Crystal structure of cruzain bound to wrr-99
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
215
structure length
215
Chain Sequence
b'APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQLDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CRUZAIN
molecule tags Hydrolase/hydrolase inhibitor
source organism Trypanosoma cruzi
publication title Crystal Structure of Cruzain bound to WRR-99
rcsb
total genus 63
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.51: Cruzipain.
pdb deposition date 2000-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1ewlA00
1ME3A 4P6EA 2FQ9A 2FRAA 4X6IA 1QOLA 4BPVA 4HWYA 3H6SA 2G8JA 5F02A 3IV2A 4FK5A 3MTNA 4G54A 1MHWA 1TU6A 2DJFB 3KFQA 1U5IA 2G6DA 1PIPA 4BQVA 2XU4A 3D6SA 3PBHA 3OF8A 3E1ZB 2XU5A 1IWDA 1TL9A 2YJBA 3GCBA 4BS6A 1YVBA 4YYVA 4YYQA 3KW9A 3P5XA 4MZOA 4Q8GA 5CHVA 3CH3X 3OVXA 3IHPA 2ATOA 1BY8A 4AXMA 4CDCB 2PADA 3PNRA 1CVZA 4OELA 1POPA 1AYVA 2AIMA 1YT7A 1TLOA 1ICFA 2YJ9A 2DZYA 4X6HA 3S3RA 3P5UA 2Y5BA 3HHIA 1ZCMA 1EWOA 4MSXA 4P6GA 2NQGA 1MEMA 1AECA 2BDZA 3H8BA 3BOWA 2R6NA 3MORA 3BPMA 3MHHA 1CS8A 2DC8A 1ZIVA 1SNKA 2ARYA 3IMAA 2DCCA 4RY2A 5CVOB 3N3KA 2XU3A 2AU1A 1CTEA 2H7JA 3CH2X 1NPZA 1STFE 1GLOA 1U9VA 3HWNA 2FT2A 2GFOA 3KX1A 1GCBA 3LFYA 3P5WA 5CHTA 2DCBA 9PAPA 1HUCB 2CB5A 2XU1A 5PADA 2YJ8A 5K16A 1F2AA 1NQCA 2DZZA 1JQPA 1YK8A 3BCNA 1VSNA 2E00A 2DCAA 2OZ2A 6PADA 1SP4B 2FTDA 1DEUA 2YJ2A 5FPWA 1NLJA 1KHQA 3KKUA 2AS8A 4Q8HA 3KWZA 4FJCA 2HH5A 2NQAA 2P7UA 3USVA 2E03A 4AXLA 4ZUXU 1YALA 2HD5A 4YYRA 2Y6EA 1AYUA 1ATKA 3WXFA 4MZSA 7PCKA 2IPPB 3KSEA 2PBHA 1KFUL 2BDLA 3H7DA 2C0YA 3OVZA 4PADA 3HHAA 3PW3A 4YYUA 1A6RA 1FH0A 2F1GA 2FO5A 1KHPA 2R9NA 3C9EA 2DC9A 4WA6A 4BS5A 2AUZA 2YJCA 4I04A 2DC6A 3O1GA 4CDDB 3DF0A 4CDFB 1EWMA 2B1NA 3ZUAA 3BC3A 2R9MA 3S3QA 1BP4A 2PREA 1MIRA 3V6EA 1X9YA 3H8CA 2JQFR 1PBHA 2CIOA 2R9FA 3IOQA 1O0EA 4QRVA 4XR7A 3RVWA 2AYOA 4PI3A 4QH6A 1K3BB 1GECE 2FUDA 2FYEA 1PPNA 5CVNB 1YK7A 4QBBA 4YYSA 1F2CA 2OP3A 1NB3A 1MS6A 4W5BA 1PADA 4PP2E 3P5VA 2NQIA 1CQDA 3HD3A 1U9XA 4X6JA 8PCHA 4N79A 1ITOA 2DJGB 3K24A 3M99A 2JQGR 3PDFA 1BQIA 4W5CA 3OISA 3RVVA 4YV8A 2AUXA 1U9QX 1AU0A 5J94A 2E02A 1AU3A 2P86A 3CBJA 2FRQA 2HHNA 5CVMA 5JA7A 3B79A 3ERVA 3TNXA 3QJ3A 3WXEA 1EWLA 1CB5A 3MHSA 1KXRA 5EF4A 1Y4HA 3K8UA 1XKGA 1BGOA 1AU4A 4XUIA 3U8EA 1QXPA 4DMXA 3RVXA 1CPJA 4I07A 3IUTA 3V6CA 2PNSA 1CJLA 3AI8A 1PCIA 3F75A 4I05A 4N8WA 5EGWA 2G7YA 2VHFA 3CBKA 3WXGA 1AYWA 1S4VA 1THEA 4DMYA 1ME4A 1MDWA 1QDQA 2OULA 2E01A 1AIMA 1EWPA 1NL6A 3KWBX 4CZWA 3I3TA 4QRGA 1F2BA 1Q6KA 1PXVA 2VHSA 2ACTA 1PPDA 2O6XA 3LXSA 1EF7A 2AYNA 2IBIA 1VJVA 2B1MA 4N4ZA 1Y08A 2DCDA 1F29A 2WBFX 3O0UA 3BWKA 4K7CA 1M6DA 1CV8A 3N4CA 4FIPA 4OEMA 4YVAA 4PP1A 3K9MA 2P0RA 3H89A 2GHUA 1PPPA 1AU2A 4W4UA 4QRXA 2NQDB 4BSQA 2AVWA 3F5VA 3I06A 3QT4A 2G8EA 5JH3A 1U9WA 4CDEB 3IEJA 1PE6A 1CSBB 2HXZA 3NHEA 2DC7A 3QSDA 3N3GA 3OF9A 2F7DA 4KLBA 1DF0A 1PPOA 1GMYA 5A24A 2R9OA 1MEGA 3BPFA 1NB5A 4YYWA 2R9CA 1QMYA 1KFXL
chains in the Genus database with same CATH superfamily
1ME3A 4P6EA 2FQ9A 2FRAA 4X6IA 1QOLA 4BPVA 4IUMA 4HWYA 3H6SA 2G8JA 5F02A 3IV2A 4GUAA 4FK5A 3MTNA 4G54A 4A5UA 1MHWA 1TU6A 4ZTBA 2DJFB 3KFQA 3PHWA 1U5IA 2G6DA 1PIPA 4BQVA 2XU4A 3D6SA 3PBHA 3OF8A 3W31A 1UKFA 3E1ZB 1PVJA 2XU5A 3MJ5A 1IWDA 1TL9A 2YJBA 3GCBA 3E9SA 4BS6A 1YVBA 1DKIA 4YYVA 4YYQA 3KW9A 3P5XA 2J7QC 4MZOA 4Q8GA 5CHVA 3CH3X 3OVXA 3IHPA 2ATOA 1BY8A 4AXMA 4CDCB 2PADA 3PNRA 1CVZA 4OELA 1POPA 1AYVA 2AIMA 1YT7A 1TLOA 1ICFA 2YJ9A 3W30A 2DZYA 2UZJA 4X6HA 3S3RA 3P5UA 2Y5BA 4OVZB 2HWKA 2JRIA 3HHIA 1ZCMA 1EWOA 4MSXA 3RNVA 4P6GA 2NQGA 1MEMA 1AECA 2BDZA 3H8BA 3BOWA 2R6NA 3MORA 3BPMA 3MHHA 1CS8A 2DC8A 1ZIVA 1SNKA 2ARYA 3IMAA 2DCCA 4RY2A 5CVOB 3N3KA 2XU3A 2AU1A 3PRPA 3IFUA 1CTEA 2H7JA 3BY4A 3CH2X 1NPZA 1STFE 1GLOA 1U9VA 3HWNA 2FT2A 2GFOA 3KX1A 1GCBA 3LFYA 3P5WA 5CHTA 2DCBA 3PT2A 9PAPA 1HUCB 4WURA 2CB5A 2XU1A 5PADA 2YJ8A 5K16A 1F2AA 1NQCA 3C0RA 2DZZA 3OQCA 1JQPA 1YK8A 3BCNA 1VSNA 2E00A 2DCAA 2OZ2A 6PADA 1SP4B 2FTDA 1DEUA 2YJ2A 5FPWA 3MP2A 1NLJA 1KHQA 3KKUA 2AS8A 4Q8HA 5EZQA 3TRKA 3KWZA 4FJCA 2HH5A 2NQAA 2P7UA 4MM3B 3PSEA 3USVA 2E03A 4AXLA 4ZUXU 2Z84A 1YALA 2HD5A 4YYRA 2Y6EA 1AYUA 1ATKA 3WXFA 4MZSA 7PCKA 2IPPB 3KSEA 2PBHA 1KFUL 2BDLA 3H7DA 2C0YA 3OVZA 4PADA 3HHAA 2AGAA 3PW3A 4YYUA 1A6RA 1FH0A 2F1GA 3TMPA 2FO5A 1KHPA 2R9NA 4HXDB 3C9EA 2DC9A 4WA6A 4BS5A 2AUZA 2YJCA 4R3DA 4I04A 2DC6A 3O1GA 4CDDB 3DF0A 4CDFB 1EWMA 2B1NA 4REZA 3ZUAA 3BC3A 2R9MA 1BP4A 3S3QA 2PREA 1MIRA 3V6EA 4IP3A 1X9YA 3H8CA 2JQFR 1PBHA 2CIOA 2R9FA 3IOQA 1O0EA 4XZXA 4QRVA 4XR7A 3RVWA 2AYOA 4PI3A 2BTWA 4QH6A 1K3BB 1GECE 2FUDA 2FYEA 1PPNA 5CVNB 1YK7A 4QBBA 4YYSA 1F2CA 2OP3A 1NB3A 3BBAA 1MS6A 4W5BA 1PADA 4PP2E 3P5VA 2NQIA 1CQDA 3HD3A 1U9XA 4X6JA 8PCHA 3PHUA 4N79A 1ITOA 2DJGB 3K24A 3M99A 2JQGR 3PDFA 1BQIA 2J7QA 4W5CA 3OISA 3RVVA 4YV8A 2AUXA 1U9QX 1AU0A 5J94A 2E02A 1AU3A 2P86A 4OVZA 3CBJA 2FRQA 2HHNA 3B21A 5CVMA 2BTWB 5JA7A 3B79A 3ERVA 3TNXA 3QJ3A 3WXEA 1EWLA 1CB5A 3MHSA 2DOSA 4BOQA 1KXRA 5EF4A 4P16A 1Y4HA 2JTCA 3K8UA 1XKGA 1BGOA 1AU4A 4OW0A 4XUIA 3U8EA 3ZNHA 4BOSA 1QXPA 4PT5A 4DMXA 3RVXA 1CPJA 4I07A 3IUTA 4M0WA 3V6CA 2PNSA 4BOZA 1CJLA 3AI8A 1PCIA 3F75A 4D8IA 4I05A 4MI7A 4BOUA 4N8WA 5EGWA 2G7YA 2VHFA 3CBKA 3WXGA 1AYWA 1S4VA 1THEA 4DMYA 1ME4A 5JZEA 1MDWA 1QDQA 1YZBA 2OULA 2E01A 1AIMA 4RNAA 1EWPA 1NL6A 3KWBX 4CZWA 5EZSA 3I3TA 4QRGA 5E6JA 1F2BA 1Q6KA 1PXVA 5KO3A 3O65A 2VHSA 2FE8A 2ACTA 1PPDA 2O6XA 3LXSA 1EF7A 4RF1A 2AYNA 2IBIA 1VJVA 4D8EA 4N4ZA 2B1MA 1Y08A 2DCDA 1F29A 2WBFX 3O0UA 3BWKA 4K7CA 4D8BA 1M6DA 1CV8A 3N4CA 4FIPA 4OEMA 4YVAA 4PP1A 4RF0A 3K9MA 2P0RA 3H89A 3PHXA 3BB7A 2BU3A 4BOPA 2GHUA 3PRMA 1PPPA 1AU2A 4W4UA 4QRXA 2NQDB 4BSQA 2AVWA 3F5VA 3I06A 3QT4A 2G8EA 3MTVA 5JH3A 1U9WA 4CDEB 3IEJA 1PE6A 1CSBB 2HXZA 3NHEA 2DC7A 3QSDA 3N3GA 3OF9A 2F7DA 4KLBA 1DF0A 1PPOA 4RKXA 1GMYA 5A24A 2R9OA 1MEGA 3BPFA 1NB5A 4YYWA 2R9CA 1QMYA 1KFXL
chains in the Genus database with same CATH topology
1ME3A 4P6EA 2FQ9A 2FRAA 4X6IA 1QOLA 4BPVA 4HWYA 3H6SA 2G8JA 5F02A 3IV2A 4FK5A 3MTNA 4G54A 1MHWA 1TU6A 2DJFB 3KFQA 1U5IA 2G6DA 1PIPA 4BQVA 2XU4A 3D6SA 3PBHA 3OF8A 3E1ZB 2XU5A 1IWDA 1TL9A 2YJBA 3GCBA 4BS6A 1YVBA 4YYVA 4YYQA 3KW9A 3P5XA 4MZOA 4Q8GA 5CHVA 3CH3X 3OVXA 3IHPA 2ATOA 1BY8A 4AXMA 4CDCB 2PADA 3PNRA 1CVZA 4OELA 1POPA 1AYVA 2AIMA 1YT7A 1TLOA 1ICFA 2YJ9A 2DZYA 4X6HA 3S3RA 3P5UA 2Y5BA 2VFBA 3HHIA 1ZCMA 1EWOA 4MSXA 4P6GA 2NQGA 1MEMA 1AECA 2BDZA 3H8BA 3BOWA 2R6NA 3MORA 3BPMA 3MHHA 1CS8A 2DC8A 1ZIVA 1SNKA 2ARYA 3IMAA 2DCCA 1W5RA 4RY2A 5CVOB 3N3KA 2XU3A 2AU1A 4BGFA 1CTEA 2H7JA 3CH2X 1NPZA 1STFE 1GLOA 1U9VA 3HWNA 2FT2A 2GFOA 3KX1A 4B55A 1GCBA 3LFYA 3P5WA 5CHTA 2DCBA 9PAPA 2BSZA 1HUCB 2CB5A 2XU1A 5PADA 2YJ8A 5K16A 1F2AA 1NQCA 2DZZA 1JQPA 1YK8A 3BCNA 1VSNA 2E00A 2DCAA 3D9WA 2OZ2A 6PADA 1SP4B 2FTDA 1DEUA 2YJ2A 5FPWA 1NLJA 1KHQA 3KKUA 2AS8A 4Q8HA 3KWZA 4FJCA 2HH5A 2NQAA 2P7UA 3USVA 2E03A 4AXLA 4ZUXU 1YALA 2HD5A 4YYRA 2Y6EA 1AYUA 1ATKA 3WXFA 4MZSA 7PCKA 2IPPB 3KSEA 2PBHA 1KFUL 2BDLA 3H7DA 2C0YA 3LTWA 3OVZA 4PADA 3HHAA 3PW3A 4YYUA 1A6RA 1FH0A 2F1GA 2FO5A 1KHPA 2R9NA 3C9EA 2DC9A 4WA6A 4BS5A 2AUZA 2YJCA 4I04A 2DC6A 3O1GA 4CDDB 3DF0A 4CDFB 1EWMA 2B1NA 3ZUAA 3BC3A 2R9MA 1BP4A 3S3QA 2PREA 1MIRA 3V6EA 1X9YA 3H8CA 2JQFR 1PBHA 2CIOA 2R9FA 4NV8A 3IOQA 1O0EA 4QRVA 4XR7A 3RVWA 2AYOA 4PI3A 4QH6A 1K3BB 1GECE 2FUDA 2FYEA 1PPNA 5CVNB 1YK7A 4QBBA 4YYSA 1F2CA 2OP3A 1NB3A 1MS6A 4W5BA 1PADA 4PP2E 3P5VA 2NQIA 1CQDA 3HD3A 1U9XA 4X6JA 8PCHA 4N79A 1ITOA 2DJGB 3K24A 3M99A 2JQGR 3PDFA 1BQIA 1W6FA 4W5CA 3OISA 3RVVA 4YV8A 2AUXA 1U9QX 1AU0A 5J94A 2E02A 1AU3A 2P86A 3CBJA 2FRQA 2HHNA 5CVMA 4C5PA 4GUZA 5JA7A 3B79A 3ERVA 3TNXA 3QJ3A 3WXEA 1EWLA 1CB5A 3MHSA 1KXRA 5EF4A 1Y4HA 3K8UA 1XKGA 1BGOA 1AU4A 4XUIA 3U8EA 1GX3A 1QXPA 4DMXA 3RVXA 1CPJA 4I07A 3IUTA 3V6CA 2PNSA 1CJLA 3AI8A 1PCIA 3F75A 4I05A 4N8WA 5EGWA 2G7YA 2VHFA 3CBKA 3WXGA 1AYWA 1S4VA 1THEA 4DMYA 1ME4A 1MDWA 1QDQA 2OULA 2E01A 1AIMA 1EWPA 1NL6A 3KWBX 4CZWA 3I3TA 4QRGA 1F2BA 1Q6KA 1PXVA 2VHSA 2ACTA 1PPDA 2O6XA 3LXSA 1EF7A 2AYNA 2IBIA 1VJVA 2B1MA 4N4ZA 1Y08A 2DCDA 1F29A 2WBFX 3O0UA 3BWKA 4K7CA 1M6DA 1CV8A 3N4CA 2VFCA 4FIPA 4OEMA 4YVAA 4PP1A 3K9MA 2P0RA 3H89A 2GHUA 1PPPA 1AU2A 4W4UA 4QRXA 2NQDB 1E2TA 4BSQA 2AVWA 3F5VA 3I06A 3QT4A 2G8EA 5JH3A 1U9WA 4CDEB 3IEJA 1PE6A 1CSBB 2HXZA 3NHEA 2DC7A 3QSDA 3N3GA 3OF9A 2F7DA 4KLBA 1DF0A 1PPOA 1W4TA 1GMYA 5A24A 2R9OA 1MEGA 3BPFA 4NV7A 1NB5A 4YYWA 2R9CA 1QMYA 1KFXL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ME3 A;  4P6E A;  2FQ9 A;  2FRA A;  4X6I A;  1QOL A;  4BPV A;  4HWY A;  3H6S A;  2G8J A;  5F02 A;  3IV2 A;  4FK5 A;  3MTN A;  4G54 A;  1MHW A;  1TU6 A;  2DJF B;  3KFQ A;  1U5I A;  2G6D A;  1PIP A;  4BQV A;  2XU4 A;  3D6S A;  3PBH A;  3OF8 A;  3E1Z B;  2XU5 A;  1IWD A;  1TL9 A;  2YJB A;  3GCB A;  4BS6 A;  1YVB A;  4YYV A;  4YYQ A;  3KW9 A;  3P5X A;  4MZO A;  4Q8G A;  5CHV A;  3CH3 X;  3OVX A;  3IHP A;  2ATO A;  1BY8 A;  4AXM A;  4CDC B;  2PAD A;  3PNR A;  1CVZ A;  4OEL A;  1POP A;  1AYV A;  2AIM A;  1YT7 A;  1TLO A;  1ICF A;  2YJ9 A;  2DZY A;  4X6H A;  3S3R A;  3P5U A;  2Y5B A;  3HHI A;  1ZCM A;  1EWO A;  4MSX A;  4P6G A;  2NQG A;  1MEM A;  1AEC A;  2BDZ A;  3H8B A;  3BOW A;  2R6N A;  3MOR A;  3BPM A;  3MHH A;  1CS8 A;  2DC8 A;  1ZIV A;  1SNK A;  2ARY A;  3IMA A;  2DCC A;  4RY2 A;  5CVO B;  3N3K A;  2XU3 A;  2AU1 A;  1CTE A;  2H7J A;  3CH2 X;  1NPZ A;  1STF E;  1GLO A;  1U9V A;  3HWN A;  2FT2 A;  2GFO A;  3KX1 A;  1GCB A;  3LFY A;  3P5W A;  5CHT A;  2DCB A;  9PAP A;  1HUC B;  2CB5 A;  2XU1 A;  5PAD A;  2YJ8 A;  5K16 A;  1F2A A;  1NQC A;  2DZZ A;  1JQP A;  1YK8 A;  3BCN A;  1VSN A;  2E00 A;  2DCA A;  2OZ2 A;  6PAD A;  1SP4 B;  2FTD A;  1DEU A;  2YJ2 A;  5FPW A;  1NLJ A;  1KHQ A;  3KKU A;  2AS8 A;  4Q8H A;  3KWZ A;  4FJC A;  2HH5 A;  2NQA A;  2P7U A;  3USV A;  2E03 A;  4AXL A;  4ZUX U;  1YAL A;  2HD5 A;  4YYR A;  2Y6E A;  1AYU A;  1ATK A;  3WXF A;  4MZS A;  7PCK A;  2IPP B;  3KSE A;  2PBH A;  1KFU L;  2BDL A;  3H7D A;  2C0Y A;  3OVZ A;  4PAD A;  3HHA A;  3PW3 A;  4YYU A;  1A6R A;  1FH0 A;  2F1G A;  2FO5 A;  1KHP A;  2R9N A;  3C9E A;  2DC9 A;  4WA6 A;  4BS5 A;  2AUZ A;  2YJC A;  4I04 A;  2DC6 A;  3O1G A;  4CDD B;  3DF0 A;  4CDF B;  1EWM A;  2B1N A;  3ZUA A;  3BC3 A;  2R9M A;  3S3Q A;  1BP4 A;  2PRE A;  1MIR A;  3V6E A;  1X9Y A;  3H8C A;  2JQF R;  1PBH A;  2CIO A;  2R9F A;  3IOQ A;  1O0E A;  4QRV A;  4XR7 A;  3RVW A;  2AYO A;  4PI3 A;  4QH6 A;  1K3B B;  1GEC E;  2FUD A;  2FYE A;  1PPN A;  5CVN B;  1YK7 A;  4QBB A;  4YYS A;  1F2C A;  2OP3 A;  1NB3 A;  1MS6 A;  4W5B A;  1PAD A;  4PP2 E;  3P5V A;  2NQI A;  1CQD A;  3HD3 A;  1U9X A;  4X6J A;  8PCH A;  4N79 A;  1ITO A;  2DJG B;  3K24 A;  3M99 A;  2JQG R;  3PDF A;  1BQI A;  4W5C A;  3OIS A;  3RVV A;  4YV8 A;  2AUX A;  1U9Q X;  1AU0 A;  5J94 A;  2E02 A;  1AU3 A;  2P86 A;  3CBJ A;  2FRQ A;  2HHN A;  5CVM A;  5JA7 A;  3B79 A;  3ERV A;  3TNX A;  3QJ3 A;  3WXE A;  1EWL A;  1CB5 A;  3MHS A;  1KXR A;  5EF4 A;  1Y4H A;  3K8U A;  1XKG A;  1BGO A;  1AU4 A;  4XUI A;  3U8E A;  1QXP A;  4DMX A;  3RVX A;  1CPJ A;  4I07 A;  3IUT A;  3V6C A;  2PNS A;  1CJL A;  3AI8 A;  1PCI A;  3F75 A;  4I05 A;  4N8W A;  5EGW A;  2G7Y A;  2VHF A;  3CBK A;  3WXG A;  1AYW A;  1S4V A;  1THE A;  4DMY A;  1ME4 A;  1MDW A;  1QDQ A;  2OUL A;  2E01 A;  1AIM A;  1EWP A;  1NL6 A;  3KWB X;  4CZW A;  3I3T A;  4QRG A;  1F2B A;  1Q6K A;  1PXV A;  2VHS A;  2ACT A;  1PPD A;  2O6X A;  3LXS A;  1EF7 A;  2AYN A;  2IBI A;  1VJV A;  2B1M A;  4N4Z A;  1Y08 A;  2DCD A;  1F29 A;  2WBF X;  3O0U A;  3BWK A;  4K7C A;  1M6D A;  1CV8 A;  3N4C A;  4FIP A;  4OEM A;  4YVA A;  4PP1 A;  3K9M A;  2P0R A;  3H89 A;  2GHU A;  1PPP A;  1AU2 A;  4W4U A;  4QRX A;  2NQD B;  4BSQ A;  2AVW A;  3F5V A;  3I06 A;  3QT4 A;  2G8E A;  5JH3 A;  1U9W A;  4CDE B;  3IEJ A;  1PE6 A;  1CSB B;  2HXZ A;  3NHE A;  2DC7 A;  3QSD A;  3N3G A;  3OF9 A;  2F7D A;  4KLB A;  1DF0 A;  1PPO A;  1GMY A;  5A24 A;  2R9O A;  1MEG A;  3BPF A;  1NB5 A;  4YYW A;  2R9C A;  1QMY A;  1KFX L; 
#chains in the Genus database with same CATH topology
 1ME3 A;  4P6E A;  2FQ9 A;  2FRA A;  4X6I A;  1QOL A;  4BPV A;  4IUM A;  4HWY A;  3H6S A;  2G8J A;  5F02 A;  3IV2 A;  4GUA A;  4FK5 A;  3MTN A;  4G54 A;  4A5U A;  1MHW A;  1TU6 A;  4ZTB A;  2DJF B;  3KFQ A;  3PHW A;  1U5I A;  2G6D A;  1PIP A;  4BQV A;  2XU4 A;  3D6S A;  3PBH A;  3OF8 A;  3W31 A;  1UKF A;  3E1Z B;  1PVJ A;  2XU5 A;  3MJ5 A;  1IWD A;  1TL9 A;  2YJB A;  3GCB A;  3E9S A;  4BS6 A;  1YVB A;  1DKI A;  4YYV A;  4YYQ A;  3KW9 A;  3P5X A;  2J7Q C;  4MZO A;  4Q8G A;  5CHV A;  3CH3 X;  3OVX A;  3IHP A;  2ATO A;  1BY8 A;  4AXM A;  4CDC B;  2PAD A;  3PNR A;  1CVZ A;  4OEL A;  1POP A;  1AYV A;  2AIM A;  1YT7 A;  1TLO A;  1ICF A;  2YJ9 A;  3W30 A;  2DZY A;  2UZJ A;  4X6H A;  3S3R A;  3P5U A;  2Y5B A;  4OVZ B;  2HWK A;  2JRI A;  3HHI A;  1ZCM A;  1EWO A;  4MSX A;  3RNV A;  4P6G A;  2NQG A;  1MEM A;  1AEC A;  2BDZ A;  3H8B A;  3BOW A;  2R6N A;  3MOR A;  3BPM A;  3MHH A;  1CS8 A;  2DC8 A;  1ZIV A;  1SNK A;  2ARY A;  3IMA A;  2DCC A;  4RY2 A;  5CVO B;  3N3K A;  2XU3 A;  2AU1 A;  3PRP A;  3IFU A;  1CTE A;  2H7J A;  3BY4 A;  3CH2 X;  1NPZ A;  1STF E;  1GLO A;  1U9V A;  3HWN A;  2FT2 A;  2GFO A;  3KX1 A;  1GCB A;  3LFY A;  3P5W A;  5CHT A;  2DCB A;  3PT2 A;  9PAP A;  1HUC B;  4WUR A;  2CB5 A;  2XU1 A;  5PAD A;  2YJ8 A;  5K16 A;  1F2A A;  1NQC A;  3C0R A;  2DZZ A;  3OQC A;  1JQP A;  1YK8 A;  3BCN A;  1VSN A;  2E00 A;  2DCA A;  2OZ2 A;  6PAD A;  1SP4 B;  2FTD A;  1DEU A;  2YJ2 A;  5FPW A;  3MP2 A;  1NLJ A;  1KHQ A;  3KKU A;  2AS8 A;  4Q8H A;  5EZQ A;  3TRK A;  3KWZ A;  4FJC A;  2HH5 A;  2NQA A;  2P7U A;  4MM3 B;  3PSE A;  3USV A;  2E03 A;  4AXL A;  4ZUX U;  2Z84 A;  1YAL A;  2HD5 A;  4YYR A;  2Y6E A;  1AYU A;  1ATK A;  3WXF A;  4MZS A;  7PCK A;  2IPP B;  3KSE A;  2PBH A;  1KFU L;  2BDL A;  3H7D A;  2C0Y A;  3OVZ A;  4PAD A;  3HHA A;  2AGA A;  3PW3 A;  4YYU A;  1A6R A;  1FH0 A;  2F1G A;  3TMP A;  2FO5 A;  1KHP A;  2R9N A;  4HXD B;  3C9E A;  2DC9 A;  4WA6 A;  4BS5 A;  2AUZ A;  2YJC A;  4R3D A;  4I04 A;  2DC6 A;  3O1G A;  4CDD B;  3DF0 A;  4CDF B;  1EWM A;  2B1N A;  4REZ A;  3ZUA A;  3BC3 A;  2R9M A;  1BP4 A;  3S3Q A;  2PRE A;  1MIR A;  3V6E A;  4IP3 A;  1X9Y A;  3H8C A;  2JQF R;  1PBH A;  2CIO A;  2R9F A;  3IOQ A;  1O0E A;  4XZX A;  4QRV A;  4XR7 A;  3RVW A;  2AYO A;  4PI3 A;  2BTW A;  4QH6 A;  1K3B B;  1GEC E;  2FUD A;  2FYE A;  1PPN A;  5CVN B;  1YK7 A;  4QBB A;  4YYS A;  1F2C A;  2OP3 A;  1NB3 A;  3BBA A;  1MS6 A;  4W5B A;  1PAD A;  4PP2 E;  3P5V A;  2NQI A;  1CQD A;  3HD3 A;  1U9X A;  4X6J A;  8PCH A;  3PHU A;  4N79 A;  1ITO A;  2DJG B;  3K24 A;  3M99 A;  2JQG R;  3PDF A;  1BQI A;  2J7Q A;  4W5C A;  3OIS A;  3RVV A;  4YV8 A;  2AUX A;  1U9Q X;  1AU0 A;  5J94 A;  2E02 A;  1AU3 A;  2P86 A;  4OVZ A;  3CBJ A;  2FRQ A;  2HHN A;  3B21 A;  5CVM A;  2BTW B;  5JA7 A;  3B79 A;  3ERV A;  3TNX A;  3QJ3 A;  3WXE A;  1EWL A;  1CB5 A;  3MHS A;  2DOS A;  4BOQ A;  1KXR A;  5EF4 A;  4P16 A;  1Y4H A;  2JTC A;  3K8U A;  1XKG A;  1BGO A;  1AU4 A;  4OW0 A;  4XUI A;  3U8E A;  3ZNH A;  4BOS A;  1QXP A;  4PT5 A;  4DMX A;  3RVX A;  1CPJ A;  4I07 A;  3IUT A;  4M0W A;  3V6C A;  2PNS A;  4BOZ A;  1CJL A;  3AI8 A;  1PCI A;  3F75 A;  4D8I A;  4I05 A;  4MI7 A;  4BOU A;  4N8W A;  5EGW A;  2G7Y A;  2VHF A;  3CBK A;  3WXG A;  1AYW A;  1S4V A;  1THE A;  4DMY A;  1ME4 A;  5JZE A;  1MDW A;  1QDQ A;  1YZB A;  2OUL A;  2E01 A;  1AIM A;  4RNA A;  1EWP A;  1NL6 A;  3KWB X;  4CZW A;  5EZS A;  3I3T A;  4QRG A;  5E6J A;  1F2B A;  1Q6K A;  1PXV A;  5KO3 A;  3O65 A;  2VHS A;  2FE8 A;  2ACT A;  1PPD A;  2O6X A;  3LXS A;  1EF7 A;  4RF1 A;  2AYN A;  2IBI A;  1VJV A;  4D8E A;  4N4Z A;  2B1M A;  1Y08 A;  2DCD A;  1F29 A;  2WBF X;  3O0U A;  3BWK A;  4K7C A;  4D8B A;  1M6D A;  1CV8 A;  3N4C A;  4FIP A;  4OEM A;  4YVA A;  4PP1 A;  4RF0 A;  3K9M A;  2P0R A;  3H89 A;  3PHX A;  3BB7 A;  2BU3 A;  4BOP A;  2GHU A;  3PRM A;  1PPP A;  1AU2 A;  4W4U A;  4QRX A;  2NQD B;  4BSQ A;  2AVW A;  3F5V A;  3I06 A;  3QT4 A;  2G8E A;  3MTV A;  5JH3 A;  1U9W A;  4CDE B;  3IEJ A;  1PE6 A;  1CSB B;  2HXZ A;  3NHE A;  2DC7 A;  3QSD A;  3N3G A;  3OF9 A;  2F7D A;  4KLB A;  1DF0 A;  1PPO A;  4RKX A;  1GMY A;  5A24 A;  2R9O A;  1MEG A;  3BPF A;  1NB5 A;  4YYW A;  2R9C A;  1QMY A;  1KFX L; 
#chains in the Genus database with same CATH homology
 1ME3 A;  4P6E A;  2FQ9 A;  2FRA A;  4X6I A;  1QOL A;  4BPV A;  4HWY A;  3H6S A;  2G8J A;  5F02 A;  3IV2 A;  4FK5 A;  3MTN A;  4G54 A;  1MHW A;  1TU6 A;  2DJF B;  3KFQ A;  1U5I A;  2G6D A;  1PIP A;  4BQV A;  2XU4 A;  3D6S A;  3PBH A;  3OF8 A;  3E1Z B;  2XU5 A;  1IWD A;  1TL9 A;  2YJB A;  3GCB A;  4BS6 A;  1YVB A;  4YYV A;  4YYQ A;  3KW9 A;  3P5X A;  4MZO A;  4Q8G A;  5CHV A;  3CH3 X;  3OVX A;  3IHP A;  2ATO A;  1BY8 A;  4AXM A;  4CDC B;  2PAD A;  3PNR A;  1CVZ A;  4OEL A;  1POP A;  1AYV A;  2AIM A;  1YT7 A;  1TLO A;  1ICF A;  2YJ9 A;  2DZY A;  4X6H A;  3S3R A;  3P5U A;  2Y5B A;  2VFB A;  3HHI A;  1ZCM A;  1EWO A;  4MSX A;  4P6G A;  2NQG A;  1MEM A;  1AEC A;  2BDZ A;  3H8B A;  3BOW A;  2R6N A;  3MOR A;  3BPM A;  3MHH A;  1CS8 A;  2DC8 A;  1ZIV A;  1SNK A;  2ARY A;  3IMA A;  2DCC A;  1W5R A;  4RY2 A;  5CVO B;  3N3K A;  2XU3 A;  2AU1 A;  4BGF A;  1CTE A;  2H7J A;  3CH2 X;  1NPZ A;  1STF E;  1GLO A;  1U9V A;  3HWN A;  2FT2 A;  2GFO A;  3KX1 A;  4B55 A;  1GCB A;  3LFY A;  3P5W A;  5CHT A;  2DCB A;  9PAP A;  2BSZ A;  1HUC B;  2CB5 A;  2XU1 A;  5PAD A;  2YJ8 A;  5K16 A;  1F2A A;  1NQC A;  2DZZ A;  1JQP A;  1YK8 A;  3BCN A;  1VSN A;  2E00 A;  2DCA A;  3D9W A;  2OZ2 A;  6PAD A;  1SP4 B;  2FTD A;  1DEU A;  2YJ2 A;  5FPW A;  1NLJ A;  1KHQ A;  3KKU A;  2AS8 A;  4Q8H A;  3KWZ A;  4FJC A;  2HH5 A;  2NQA A;  2P7U A;  3USV A;  2E03 A;  4AXL A;  4ZUX U;  1YAL A;  2HD5 A;  4YYR A;  2Y6E A;  1AYU A;  1ATK A;  3WXF A;  4MZS A;  7PCK A;  2IPP B;  3KSE A;  2PBH A;  1KFU L;  2BDL A;  3H7D A;  2C0Y A;  3LTW A;  3OVZ A;  4PAD A;  3HHA A;  3PW3 A;  4YYU A;  1A6R A;  1FH0 A;  2F1G A;  2FO5 A;  1KHP A;  2R9N A;  3C9E A;  2DC9 A;  4WA6 A;  4BS5 A;  2AUZ A;  2YJC A;  4I04 A;  2DC6 A;  3O1G A;  4CDD B;  3DF0 A;  4CDF B;  1EWM A;  2B1N A;  3ZUA A;  3BC3 A;  2R9M A;  1BP4 A;  3S3Q A;  2PRE A;  1MIR A;  3V6E A;  1X9Y A;  3H8C A;  2JQF R;  1PBH A;  2CIO A;  2R9F A;  4NV8 A;  3IOQ A;  1O0E A;  4QRV A;  4XR7 A;  3RVW A;  2AYO A;  4PI3 A;  4QH6 A;  1K3B B;  1GEC E;  2FUD A;  2FYE A;  1PPN A;  5CVN B;  1YK7 A;  4QBB A;  4YYS A;  1F2C A;  2OP3 A;  1NB3 A;  1MS6 A;  4W5B A;  1PAD A;  4PP2 E;  3P5V A;  2NQI A;  1CQD A;  3HD3 A;  1U9X A;  4X6J A;  8PCH A;  4N79 A;  1ITO A;  2DJG B;  3K24 A;  3M99 A;  2JQG R;  3PDF A;  1BQI A;  1W6F A;  4W5C A;  3OIS A;  3RVV A;  4YV8 A;  2AUX A;  1U9Q X;  1AU0 A;  5J94 A;  2E02 A;  1AU3 A;  2P86 A;  3CBJ A;  2FRQ A;  2HHN A;  5CVM A;  4C5P A;  4GUZ A;  5JA7 A;  3B79 A;  3ERV A;  3TNX A;  3QJ3 A;  3WXE A;  1EWL A;  1CB5 A;  3MHS A;  1KXR A;  5EF4 A;  1Y4H A;  3K8U A;  1XKG A;  1BGO A;  1AU4 A;  4XUI A;  3U8E A;  1GX3 A;  1QXP A;  4DMX A;  3RVX A;  1CPJ A;  4I07 A;  3IUT A;  3V6C A;  2PNS A;  1CJL A;  3AI8 A;  1PCI A;  3F75 A;  4I05 A;  4N8W A;  5EGW A;  2G7Y A;  2VHF A;  3CBK A;  3WXG A;  1AYW A;  1S4V A;  1THE A;  4DMY A;  1ME4 A;  1MDW A;  1QDQ A;  2OUL A;  2E01 A;  1AIM A;  1EWP A;  1NL6 A;  3KWB X;  4CZW A;  3I3T A;  4QRG A;  1F2B A;  1Q6K A;  1PXV A;  2VHS A;  2ACT A;  1PPD A;  2O6X A;  3LXS A;  1EF7 A;  2AYN A;  2IBI A;  1VJV A;  2B1M A;  4N4Z A;  1Y08 A;  2DCD A;  1F29 A;  2WBF X;  3O0U A;  3BWK A;  4K7C A;  1M6D A;  1CV8 A;  3N4C A;  2VFC A;  4FIP A;  4OEM A;  4YVA A;  4PP1 A;  3K9M A;  2P0R A;  3H89 A;  2GHU A;  1PPP A;  1AU2 A;  4W4U A;  4QRX A;  2NQD B;  1E2T A;  4BSQ A;  2AVW A;  3F5V A;  3I06 A;  3QT4 A;  2G8E A;  5JH3 A;  1U9W A;  4CDE B;  3IEJ A;  1PE6 A;  1CSB B;  2HXZ A;  3NHE A;  2DC7 A;  3QSD A;  3N3G A;  3OF9 A;  2F7D A;  4KLB A;  1DF0 A;  1PPO A;  1W4T A;  1GMY A;  5A24 A;  2R9O A;  1MEG A;  3BPF A;  4NV7 A;  1NB5 A;  4YYW A;  2R9C A;  1QMY A;  1KFX L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...