1EWLA

Crystal structure of cruzain bound to wrr-99
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
215
structure length
215
Chain Sequence
b'APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQLDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CRUZAIN
publication title Crystal Structure of Cruzain bound to WRR-99
rcsb
source organism Trypanosoma cruzi
molecule tags Hydrolase/hydrolase inhibitor
total genus 63
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.51: Cruzipain.
pdb deposition date 2000-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1ewlA00
3P5VA 1ICFA 3HWNA 1NLJA 1X9YA 3KWBX 2PBHA 1FH0A 2FT2A 4CDFB 1VSNA 3HHIA 5EF4A 1ATKA 4X6JA 2DCAA 1U9QX 1CB5A 4YYQA 2HHNA 1PCIA 1GECE 2OULA 4XR7A 1QDQA 1ZCMA 2WBFX 4P6GA 2AUXA 2DC6A 9PAPA 3MHSA 3O1GA 3H8CA 1NL6A 1PPOA 2DZYA 1AU4A 3IV2A 3H7DA 2E00A 3OISA 4PADA 2HD5A 2E01A 5FPWA 2R9MA 1AYUA 5CHTA 2P0RA 1ME3A 3PBHA 3ZUAA 2G6DA 2XU5A 2NQDB 3CH2X 1DEUA 2FO5A 1CJLA 4XUIA 3N3KA 1SNKA 3RVVA 5A24A 2ATOA 4YVAA 4FK5A 1ME4A 2Y5BA 4YYRA 2B1NA 4PP2E 2P86A 3F75A 2DC8A 2FTDA 2YJ2A 3AI8A 4MSXA 2E03A 2ACTA 1YVBA 1K3BB 1AU0A 4QRVA 3V6CA 4W5CA 1O0EA 3RVWA 2AUZA 5PADA 2ARYA 1TL9A 2PNSA 1KHPA 2XU4A 4OEMA 1PE6A 3OVXA 1TLOA 5EGWA 3KSEA 3H8BA 2R9FA 1F2BA 2DJGB 2OZ2A 1Y4HA 3C9EA 2G8JA 5JA7A 2JQFR 3P5WA 3P5XA 4AXMA 1ITOA 4Q8HA 3PNRA 4QRXA 2DCBA 2DC9A 3MORA 4Q8GA 3RVXA 1U9WA 3B79A 2OP3A 1QOLA 3BPFA 2VHFA 3K8UA 3HHAA 1IWDA 1MEMA 2PADA 3CH3X 4CDEB 4DMXA 2YJCA 2GHUA 3I3TA 1CS8A 2DC7A 3ERVA 4I05A 1QMYA 1POPA 3MHHA 3K9MA 1CV8A 4YYWA 4ZUXU 1YK7A 3BCNA 4W4UA 4W5BA 7PCKA 3E1ZB 2FYEA 3CBKA 4N79A 3S3RA 2DJFB 1GMYA 1Q6KA 1GCBA 2FRAA 3IUTA 4QRGA 3V6EA 2XU3A 2CIOA 1AYVA 2HH5A 4G54A 2AIMA 3WXGA 1YALA 3KX1A 2F1GA 5CVOB 3BOWA 1U9XA 3DF0A 2HXZA 1DF0A 1AYWA 3BPMA 1EWLA 3QT4A 2AU1A 1MHWA 3OF8A 1A6RA 1KFUL 1CVZA 2FQ9A 4BS5A 3QSDA 1PPPA 2JQGR 3QJ3A 1NB5A 4I04A 2BDZA 4HWYA 3O0UA 3GCBA 4I07A 2R9OA 2YJ8A 1PADA 4WA6A 2NQAA 2IPPB 2P7UA 4CDDB 3H6SA 2AYOA 1SP4B 5CHVA 4MZOA 2BDLA 4QH6A 1VJVA 2H7JA 1PPDA 2PREA 4PP1A 1EWPA 1YK8A 1F29A 1CSBB 1EF7A 1BGOA 3NHEA 3KFQA 3IMAA 2R9CA 2DCCA 2NQGA 1MS6A 2YJ9A 2IBIA 4BSQA 1JQPA 3U8EA 1KFXL 1F2CA 2AS8A 2DCDA 3OVZA 5JH3A 3PDFA 3BC3A 2F7DA 2AYNA 2C0YA 2NQIA 4CDCB 1HUCB 3K24A 4X6HA 1GLOA 1BY8A 2G8EA 4AXLA 4CZWA 3KWZA 5F02A 1XKGA 1ZIVA 1M6DA 2DZZA 1STFE 3P5UA 3N4CA 4YYSA 3N3GA 3KW9A 4FJCA 4QBBA 3USVA 6PADA 2E02A 2FUDA 1NB3A 1PIPA 5CVMA 4DMYA 3TNXA 1AIMA 3IHPA 2YJBA 8PCHA 1AECA 1PXVA 1TU6A 2GFOA 3D6SA 1EWOA 1AU3A 2B1MA 4BQVA 4OELA 1CTEA 1CQDA 1NPZA 2AVWA 2G7YA 4X6IA 4YYUA 1EWMA 5J94A 1BP4A 2FRQA 2XU1A 1THEA 1MEGA 4YYVA 2CB5A 4KLBA 3H89A 4N4ZA 1F2AA 1U9VA 3F5VA 2Y6EA 2R9NA 3S3QA 3CBJA 1KXRA 4FIPA 3HD3A 4RY2A 3IEJA 1S4VA 5CVNB 3MTNA 5K16A 1BQIA 4P6EA 4N8WA 4MZSA 1Y08A 3OF9A 4BPVA 2VHSA 2O6XA 4K7CA 2R6NA 4YV8A 3IOQA 3PW3A 1QXPA 1U5IA 1PBHA 1PPNA 1NQCA 3WXFA 1MDWA 3I06A 3LFYA 3BWKA 3LXSA 1KHQA 3KKUA 3WXEA 1YT7A 1MIRA 4PI3A 1CPJA 3M99A 4BS6A 1AU2A
chains in the Genus database with same CATH superfamily
3P5VA 1ICFA 4BOQA 3HWNA 4PT5A 3PRPA 1NLJA 1X9YA 3KWBX 2PBHA 1FH0A 2FT2A 4CDFB 4D8IA 1VSNA 3PHUA 3HHIA 3RNVA 5EF4A 1ATKA 4X6JA 2DCAA 1U9QX 1CB5A 4YYQA 2HHNA 1PCIA 1GECE 2OULA 4XR7A 1QDQA 1ZCMA 2WBFX 4P6GA 2AUXA 2DC6A 9PAPA 3MHSA 3O1GA 3H8CA 1NL6A 3ZNHA 1PPOA 2BTWB 3W31A 3O65A 2DZYA 1AU4A 3BY4A 3IV2A 3H7DA 2E00A 3OISA 2J7QC 4PADA 2HD5A 2E01A 5FPWA 2R9MA 1AYUA 5CHTA 2P0RA 1ME3A 3PBHA 3ZUAA 2G6DA 2XU5A 2NQDB 3CH2X 3IFUA 1DEUA 2FO5A 1CJLA 4XUIA 3N3KA 1SNKA 3RVVA 5A24A 2ATOA 5EZQA 4YVAA 3TMPA 4FK5A 1ME4A 4MM3B 2Y5BA 4YYRA 2B1NA 4PP2E 2P86A 3F75A 2DC8A 2FTDA 4WURA 2YJ2A 3AI8A 4MSXA 4D8BA 2E03A 2ACTA 1YVBA 1K3BB 1AU0A 4QRVA 3V6CA 4W5CA 1O0EA 3RVWA 2AUZA 5PADA 4OVZB 2ARYA 1TL9A 3PRMA 2PNSA 1KHPA 2XU4A 4OEMA 1PE6A 3OVXA 4RKXA 1TLOA 5EGWA 3KSEA 1UKFA 3H8BA 2R9FA 1F2BA 2DJGB 2OZ2A 1Y4HA 5KO3A 3C9EA 2G8JA 5JA7A 2JQFR 3P5WA 3P5XA 4BOZA 4AXMA 1ITOA 4HXDB 4ZTBA 4Q8HA 3PNRA 4QRXA 2DCBA 2DC9A 3MORA 4Q8GA 3RVXA 2Z84A 1U9WA 3B79A 2OP3A 1QOLA 3BPFA 2VHFA 3K8UA 2BU3A 3HHAA 1IWDA 1MEMA 2PADA 3CH3X 4CDEB 4DMXA 2YJCA 2GHUA 3I3TA 1CS8A 4A5UA 2DC7A 2HWKA 4REZA 3ERVA 4I05A 1QMYA 4M0WA 1POPA 4D8EA 3MHHA 3K9MA 1CV8A 4YYWA 4ZUXU 1YK7A 3BCNA 4RF0A 4W4UA 4W5BA 7PCKA 3E1ZB 2FYEA 3CBKA 4BOPA 4N79A 3BB7A 3S3RA 2DJFB 1GMYA 1Q6KA 1GCBA 2FRAA 3IUTA 3PSEA 4QRGA 3V6EA 2XU3A 2JRIA 2AGAA 1AYVA 2CIOA 2HH5A 4G54A 2AIMA 3WXGA 1YALA 3KX1A 2F1GA 3PT2A 5CVOB 1YZBA 3BOWA 1U9XA 3DF0A 2HXZA 3MTVA 4BOSA 1DF0A 1AYWA 3BPMA 5E6JA 1EWLA 3QT4A 2AU1A 1MHWA 3OF8A 3BBAA 1A6RA 1KFUL 1CVZA 2FQ9A 4BS5A 3QSDA 1PPPA 2JQGR 3QJ3A 1NB5A 4I04A 2BDZA 4HWYA 3O0UA 3GCBA 4I07A 2R9OA 2YJ8A 1PADA 4WA6A 3PHXA 3OQCA 3C0RA 2NQAA 2JTCA 2IPPB 2P7UA 4CDDB 4IUMA 2BTWA 3H6SA 2AYOA 1SP4B 5CHVA 4MZOA 4RNAA 2BDLA 4QH6A 1VJVA 2H7JA 2J7QA 1PPDA 2PREA 2DOSA 4PP1A 1EWPA 1YK8A 1F29A 1CSBB 1EF7A 1BGOA 3TRKA 3NHEA 3KFQA 3IMAA 2R9CA 2DCCA 2NQGA 1MS6A 2YJ9A 2IBIA 4BSQA 1JQPA 3U8EA 1KFXL 1F2CA 2AS8A 2DCDA 3OVZA 5JH3A 3PDFA 3BC3A 3E9SA 2F7DA 2AYNA 2C0YA 3W30A 2NQIA 4CDCB 1HUCB 3K24A 4OW0A 4X6HA 1GLOA 1BY8A 2G8EA 4AXLA 4CZWA 3KWZA 5F02A 1XKGA 1ZIVA 4R3DA 1M6DA 2DZZA 1STFE 3P5UA 3N4CA 4YYSA 3N3GA 4OVZA 3KW9A 4FJCA 4QBBA 3USVA 6PADA 2E02A 2FUDA 1NB3A 1PIPA 5CVMA 4DMYA 3TNXA 1AIMA 3IHPA 2YJBA 3MJ5A 8PCHA 1AECA 1PXVA 1TU6A 2GFOA 3D6SA 1EWOA 1AU3A 2B1MA 4BQVA 4OELA 4RF1A 1CTEA 1CQDA 1NPZA 2AVWA 4BOUA 2G7YA 4X6IA 4YYUA 2UZJA 1EWMA 5J94A 3MP2A 1DKIA 1BP4A 5EZSA 2FRQA 2XU1A 1THEA 1MEGA 4YYVA 2CB5A 4KLBA 3H89A 3PHWA 4N4ZA 1F2AA 1U9VA 3F5VA 2Y6EA 2R9NA 3S3QA 1PVJA 3CBJA 1KXRA 4FIPA 3HD3A 4RY2A 3IEJA 1S4VA 5CVNB 3MTNA 5K16A 1BQIA 4P6EA 4GUAA 4MZSA 4N8WA 1Y08A 3OF9A 4BPVA 2VHSA 2O6XA 4K7CA 2R6NA 4YV8A 3IOQA 4IP3A 5JZEA 3PW3A 1QXPA 1U5IA 1PBHA 1PPNA 1NQCA 2FE8A 4MI7A 3B21A 4P16A 3WXFA 1MDWA 3I06A 3LFYA 3BWKA 3LXSA 1KHQA 3KKUA 3WXEA 1YT7A 1MIRA 4PI3A 1CPJA 3M99A 4BS6A 4XZXA 1AU2A
chains in the Genus database with same CATH topology
3P5VA 1ICFA 3HWNA 1NLJA 1X9YA 3KWBX 2PBHA 1FH0A 2FT2A 4CDFB 1VSNA 3HHIA 5EF4A 1ATKA 1W6FA 4X6JA 2DCAA 1U9QX 1CB5A 4YYQA 2BSZA 2HHNA 1PCIA 1GECE 2OULA 4XR7A 1QDQA 1ZCMA 2WBFX 4P6GA 2AUXA 2DC6A 9PAPA 3MHSA 3O1GA 3H8CA 1NL6A 1PPOA 2DZYA 1AU4A 3IV2A 3H7DA 2E00A 3OISA 4PADA 2HD5A 2E01A 5FPWA 2R9MA 1AYUA 5CHTA 2P0RA 1ME3A 3PBHA 3ZUAA 2G6DA 2XU5A 2NQDB 3CH2X 1DEUA 2FO5A 1CJLA 4XUIA 3N3KA 1SNKA 3RVVA 5A24A 2ATOA 4YVAA 4FK5A 1ME4A 2Y5BA 4YYRA 2B1NA 4PP2E 2P86A 3F75A 2DC8A 2FTDA 2YJ2A 3AI8A 4MSXA 2E03A 2ACTA 1YVBA 1K3BB 1AU0A 4QRVA 3V6CA 4W5CA 1O0EA 3RVWA 2AUZA 5PADA 2ARYA 1TL9A 2PNSA 1KHPA 2XU4A 4OEMA 1PE6A 4B55A 3OVXA 1TLOA 5EGWA 3KSEA 3H8BA 2R9FA 1F2BA 2DJGB 2OZ2A 1Y4HA 3C9EA 2G8JA 5JA7A 2JQFR 3P5WA 2VFBA 3P5XA 4AXMA 1ITOA 4Q8HA 3PNRA 4QRXA 2DCBA 2DC9A 3MORA 4Q8GA 3RVXA 1U9WA 3B79A 2OP3A 1QOLA 3BPFA 2VHFA 3K8UA 3HHAA 1IWDA 1MEMA 2PADA 3CH3X 4CDEB 4DMXA 2YJCA 2GHUA 3I3TA 1CS8A 2DC7A 3ERVA 4I05A 1QMYA 1POPA 3MHHA 3K9MA 1CV8A 4YYWA 4ZUXU 1YK7A 3BCNA 4W4UA 4W5BA 4C5PA 7PCKA 3E1ZB 2FYEA 3CBKA 4N79A 3S3RA 2DJFB 1GMYA 1Q6KA 1GCBA 2FRAA 3IUTA 4QRGA 1E2TA 3V6EA 2XU3A 2CIOA 1AYVA 2HH5A 4G54A 2AIMA 3WXGA 1YALA 3KX1A 2F1GA 5CVOB 3BOWA 1U9XA 3DF0A 2HXZA 1DF0A 1AYWA 3BPMA 1EWLA 3QT4A 2AU1A 1MHWA 3OF8A 1A6RA 1KFUL 1CVZA 2FQ9A 4BS5A 3QSDA 1PPPA 2JQGR 3QJ3A 4BGFA 1NB5A 4I04A 2BDZA 4HWYA 3O0UA 3GCBA 4I07A 2R9OA 2YJ8A 1PADA 4WA6A 2NQAA 2IPPB 2P7UA 4CDDB 3H6SA 2AYOA 1SP4B 5CHVA 4MZOA 2BDLA 4QH6A 1VJVA 2H7JA 1PPDA 2PREA 4PP1A 1EWPA 1YK8A 1F29A 1CSBB 1EF7A 1BGOA 3NHEA 1W4TA 3KFQA 3IMAA 2R9CA 2DCCA 2NQGA 1MS6A 3D9WA 2YJ9A 2IBIA 4BSQA 1JQPA 3U8EA 1KFXL 1F2CA 2AS8A 3LTWA 2DCDA 3OVZA 5JH3A 3PDFA 3BC3A 2F7DA 2AYNA 2C0YA 2NQIA 4CDCB 1HUCB 3K24A 1GX3A 4X6HA 1GLOA 1BY8A 2G8EA 4AXLA 4CZWA 3KWZA 5F02A 4GUZA 1XKGA 1ZIVA 1M6DA 2DZZA 1STFE 3P5UA 3N4CA 4YYSA 3N3GA 2VFCA 3KW9A 4FJCA 4QBBA 3USVA 6PADA 2E02A 2FUDA 1NB3A 1PIPA 5CVMA 4DMYA 3TNXA 1AIMA 3IHPA 2YJBA 8PCHA 4NV7A 1AECA 1PXVA 1TU6A 2GFOA 3D6SA 1EWOA 1AU3A 2B1MA 4BQVA 4OELA 1CTEA 1CQDA 1NPZA 2AVWA 2G7YA 4X6IA 4YYUA 1EWMA 5J94A 1BP4A 1W5RA 2FRQA 2XU1A 1THEA 1MEGA 4YYVA 2CB5A 4KLBA 3H89A 4N4ZA 1F2AA 1U9VA 3F5VA 2Y6EA 2R9NA 3S3QA 4NV8A 3CBJA 1KXRA 4FIPA 3HD3A 4RY2A 3IEJA 1S4VA 5CVNB 3MTNA 5K16A 1BQIA 4P6EA 4N8WA 4MZSA 1Y08A 3OF9A 4BPVA 2VHSA 2O6XA 4K7CA 2R6NA 4YV8A 3IOQA 3PW3A 1QXPA 1U5IA 1PBHA 1PPNA 1NQCA 3WXFA 1MDWA 3I06A 3LFYA 3BWKA 3LXSA 1KHQA 3KKUA 3WXEA 1YT7A 1MIRA 4PI3A 1CPJA 3M99A 4BS6A 1AU2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P5V A;  1ICF A;  3HWN A;  1NLJ A;  1X9Y A;  3KWB X;  2PBH A;  1FH0 A;  2FT2 A;  4CDF B;  1VSN A;  3HHI A;  5EF4 A;  1ATK A;  4X6J A;  2DCA A;  1U9Q X;  1CB5 A;  4YYQ A;  2HHN A;  1PCI A;  1GEC E;  2OUL A;  4XR7 A;  1QDQ A;  1ZCM A;  2WBF X;  4P6G A;  2AUX A;  2DC6 A;  9PAP A;  3MHS A;  3O1G A;  3H8C A;  1NL6 A;  1PPO A;  2DZY A;  1AU4 A;  3IV2 A;  3H7D A;  2E00 A;  3OIS A;  4PAD A;  2HD5 A;  2E01 A;  5FPW A;  2R9M A;  1AYU A;  5CHT A;  2P0R A;  1ME3 A;  3PBH A;  3ZUA A;  2G6D A;  2XU5 A;  2NQD B;  3CH2 X;  1DEU A;  2FO5 A;  1CJL A;  4XUI A;  3N3K A;  1SNK A;  3RVV A;  5A24 A;  2ATO A;  4YVA A;  4FK5 A;  1ME4 A;  2Y5B A;  4YYR A;  2B1N A;  4PP2 E;  2P86 A;  3F75 A;  2DC8 A;  2FTD A;  2YJ2 A;  3AI8 A;  4MSX A;  2E03 A;  2ACT A;  1YVB A;  1K3B B;  1AU0 A;  4QRV A;  3V6C A;  4W5C A;  1O0E A;  3RVW A;  2AUZ A;  5PAD A;  2ARY A;  1TL9 A;  2PNS A;  1KHP A;  2XU4 A;  4OEM A;  1PE6 A;  3OVX A;  1TLO A;  5EGW A;  3KSE A;  3H8B A;  2R9F A;  1F2B A;  2DJG B;  2OZ2 A;  1Y4H A;  3C9E A;  2G8J A;  5JA7 A;  2JQF R;  3P5W A;  3P5X A;  4AXM A;  1ITO A;  4Q8H A;  3PNR A;  4QRX A;  2DCB A;  2DC9 A;  3MOR A;  4Q8G A;  3RVX A;  1U9W A;  3B79 A;  2OP3 A;  1QOL A;  3BPF A;  2VHF A;  3K8U A;  3HHA A;  1IWD A;  1MEM A;  2PAD A;  3CH3 X;  4CDE B;  4DMX A;  2YJC A;  2GHU A;  3I3T A;  1CS8 A;  2DC7 A;  3ERV A;  4I05 A;  1QMY A;  1POP A;  3MHH A;  3K9M A;  1CV8 A;  4YYW A;  4ZUX U;  1YK7 A;  3BCN A;  4W4U A;  4W5B A;  7PCK A;  3E1Z B;  2FYE A;  3CBK A;  4N79 A;  3S3R A;  2DJF B;  1GMY A;  1Q6K A;  1GCB A;  2FRA A;  3IUT A;  4QRG A;  3V6E A;  2XU3 A;  2CIO A;  1AYV A;  2HH5 A;  4G54 A;  2AIM A;  3WXG A;  1YAL A;  3KX1 A;  2F1G A;  5CVO B;  3BOW A;  1U9X A;  3DF0 A;  2HXZ A;  1DF0 A;  1AYW A;  3BPM A;  1EWL A;  3QT4 A;  2AU1 A;  1MHW A;  3OF8 A;  1A6R A;  1KFU L;  1CVZ A;  2FQ9 A;  4BS5 A;  3QSD A;  1PPP A;  2JQG R;  3QJ3 A;  1NB5 A;  4I04 A;  2BDZ A;  4HWY A;  3O0U A;  3GCB A;  4I07 A;  2R9O A;  2YJ8 A;  1PAD A;  4WA6 A;  2NQA A;  2IPP B;  2P7U A;  4CDD B;  3H6S A;  2AYO A;  1SP4 B;  5CHV A;  4MZO A;  2BDL A;  4QH6 A;  1VJV A;  2H7J A;  1PPD A;  2PRE A;  4PP1 A;  1EWP A;  1YK8 A;  1F29 A;  1CSB B;  1EF7 A;  1BGO A;  3NHE A;  3KFQ A;  3IMA A;  2R9C A;  2DCC A;  2NQG A;  1MS6 A;  2YJ9 A;  2IBI A;  4BSQ A;  1JQP A;  3U8E A;  1KFX L;  1F2C A;  2AS8 A;  2DCD A;  3OVZ A;  5JH3 A;  3PDF A;  3BC3 A;  2F7D A;  2AYN A;  2C0Y A;  2NQI A;  4CDC B;  1HUC B;  3K24 A;  4X6H A;  1GLO A;  1BY8 A;  2G8E A;  4AXL A;  4CZW A;  3KWZ A;  5F02 A;  1XKG A;  1ZIV A;  1M6D A;  2DZZ A;  1STF E;  3P5U A;  3N4C A;  4YYS A;  3N3G A;  3KW9 A;  4FJC A;  4QBB A;  3USV A;  6PAD A;  2E02 A;  2FUD A;  1NB3 A;  1PIP A;  5CVM A;  4DMY A;  3TNX A;  1AIM A;  3IHP A;  2YJB A;  8PCH A;  1AEC A;  1PXV A;  1TU6 A;  2GFO A;  3D6S A;  1EWO A;  1AU3 A;  2B1M A;  4BQV A;  4OEL A;  1CTE A;  1CQD A;  1NPZ A;  2AVW A;  2G7Y A;  4X6I A;  4YYU A;  1EWM A;  5J94 A;  1BP4 A;  2FRQ A;  2XU1 A;  1THE A;  1MEG A;  4YYV A;  2CB5 A;  4KLB A;  3H89 A;  4N4Z A;  1F2A A;  1U9V A;  3F5V A;  2Y6E A;  2R9N A;  3S3Q A;  3CBJ A;  1KXR A;  4FIP A;  3HD3 A;  4RY2 A;  3IEJ A;  1S4V A;  5CVN B;  3MTN A;  5K16 A;  1BQI A;  4P6E A;  4N8W A;  4MZS A;  1Y08 A;  3OF9 A;  4BPV A;  2VHS A;  2O6X A;  4K7C A;  2R6N A;  4YV8 A;  3IOQ A;  3PW3 A;  1QXP A;  1U5I A;  1PBH A;  1PPN A;  1NQC A;  3WXF A;  1MDW A;  3I06 A;  3LFY A;  3BWK A;  3LXS A;  1KHQ A;  3KKU A;  3WXE A;  1YT7 A;  1MIR A;  4PI3 A;  1CPJ A;  3M99 A;  4BS6 A;  1AU2 A; 
#chains in the Genus database with same CATH topology
 3P5V A;  1ICF A;  4BOQ A;  3HWN A;  4PT5 A;  3PRP A;  1NLJ A;  1X9Y A;  3KWB X;  2PBH A;  1FH0 A;  2FT2 A;  4CDF B;  4D8I A;  1VSN A;  3PHU A;  3HHI A;  3RNV A;  5EF4 A;  1ATK A;  4X6J A;  2DCA A;  1U9Q X;  1CB5 A;  4YYQ A;  2HHN A;  1PCI A;  1GEC E;  2OUL A;  4XR7 A;  1QDQ A;  1ZCM A;  2WBF X;  4P6G A;  2AUX A;  2DC6 A;  9PAP A;  3MHS A;  3O1G A;  3H8C A;  1NL6 A;  3ZNH A;  1PPO A;  2BTW B;  3W31 A;  3O65 A;  2DZY A;  1AU4 A;  3BY4 A;  3IV2 A;  3H7D A;  2E00 A;  3OIS A;  2J7Q C;  4PAD A;  2HD5 A;  2E01 A;  5FPW A;  2R9M A;  1AYU A;  5CHT A;  2P0R A;  1ME3 A;  3PBH A;  3ZUA A;  2G6D A;  2XU5 A;  2NQD B;  3CH2 X;  3IFU A;  1DEU A;  2FO5 A;  1CJL A;  4XUI A;  3N3K A;  1SNK A;  3RVV A;  5A24 A;  2ATO A;  5EZQ A;  4YVA A;  3TMP A;  4FK5 A;  1ME4 A;  4MM3 B;  2Y5B A;  4YYR A;  2B1N A;  4PP2 E;  2P86 A;  3F75 A;  2DC8 A;  2FTD A;  4WUR A;  2YJ2 A;  3AI8 A;  4MSX A;  4D8B A;  2E03 A;  2ACT A;  1YVB A;  1K3B B;  1AU0 A;  4QRV A;  3V6C A;  4W5C A;  1O0E A;  3RVW A;  2AUZ A;  5PAD A;  4OVZ B;  2ARY A;  1TL9 A;  3PRM A;  2PNS A;  1KHP A;  2XU4 A;  4OEM A;  1PE6 A;  3OVX A;  4RKX A;  1TLO A;  5EGW A;  3KSE A;  1UKF A;  3H8B A;  2R9F A;  1F2B A;  2DJG B;  2OZ2 A;  1Y4H A;  5KO3 A;  3C9E A;  2G8J A;  5JA7 A;  2JQF R;  3P5W A;  3P5X A;  4BOZ A;  4AXM A;  1ITO A;  4HXD B;  4ZTB A;  4Q8H A;  3PNR A;  4QRX A;  2DCB A;  2DC9 A;  3MOR A;  4Q8G A;  3RVX A;  2Z84 A;  1U9W A;  3B79 A;  2OP3 A;  1QOL A;  3BPF A;  2VHF A;  3K8U A;  2BU3 A;  3HHA A;  1IWD A;  1MEM A;  2PAD A;  3CH3 X;  4CDE B;  4DMX A;  2YJC A;  2GHU A;  3I3T A;  1CS8 A;  4A5U A;  2DC7 A;  2HWK A;  4REZ A;  3ERV A;  4I05 A;  1QMY A;  4M0W A;  1POP A;  4D8E A;  3MHH A;  3K9M A;  1CV8 A;  4YYW A;  4ZUX U;  1YK7 A;  3BCN A;  4RF0 A;  4W4U A;  4W5B A;  7PCK A;  3E1Z B;  2FYE A;  3CBK A;  4BOP A;  4N79 A;  3BB7 A;  3S3R A;  2DJF B;  1GMY A;  1Q6K A;  1GCB A;  2FRA A;  3IUT A;  3PSE A;  4QRG A;  3V6E A;  2XU3 A;  2JRI A;  2AGA A;  1AYV A;  2CIO A;  2HH5 A;  4G54 A;  2AIM A;  3WXG A;  1YAL A;  3KX1 A;  2F1G A;  3PT2 A;  5CVO B;  1YZB A;  3BOW A;  1U9X A;  3DF0 A;  2HXZ A;  3MTV A;  4BOS A;  1DF0 A;  1AYW A;  3BPM A;  5E6J A;  1EWL A;  3QT4 A;  2AU1 A;  1MHW A;  3OF8 A;  3BBA A;  1A6R A;  1KFU L;  1CVZ A;  2FQ9 A;  4BS5 A;  3QSD A;  1PPP A;  2JQG R;  3QJ3 A;  1NB5 A;  4I04 A;  2BDZ A;  4HWY A;  3O0U A;  3GCB A;  4I07 A;  2R9O A;  2YJ8 A;  1PAD A;  4WA6 A;  3PHX A;  3OQC A;  3C0R A;  2NQA A;  2JTC A;  2IPP B;  2P7U A;  4CDD B;  4IUM A;  2BTW A;  3H6S A;  2AYO A;  1SP4 B;  5CHV A;  4MZO A;  4RNA A;  2BDL A;  4QH6 A;  1VJV A;  2H7J A;  2J7Q A;  1PPD A;  2PRE A;  2DOS A;  4PP1 A;  1EWP A;  1YK8 A;  1F29 A;  1CSB B;  1EF7 A;  1BGO A;  3TRK A;  3NHE A;  3KFQ A;  3IMA A;  2R9C A;  2DCC A;  2NQG A;  1MS6 A;  2YJ9 A;  2IBI A;  4BSQ A;  1JQP A;  3U8E A;  1KFX L;  1F2C A;  2AS8 A;  2DCD A;  3OVZ A;  5JH3 A;  3PDF A;  3BC3 A;  3E9S A;  2F7D A;  2AYN A;  2C0Y A;  3W30 A;  2NQI A;  4CDC B;  1HUC B;  3K24 A;  4OW0 A;  4X6H A;  1GLO A;  1BY8 A;  2G8E A;  4AXL A;  4CZW A;  3KWZ A;  5F02 A;  1XKG A;  1ZIV A;  4R3D A;  1M6D A;  2DZZ A;  1STF E;  3P5U A;  3N4C A;  4YYS A;  3N3G A;  4OVZ A;  3KW9 A;  4FJC A;  4QBB A;  3USV A;  6PAD A;  2E02 A;  2FUD A;  1NB3 A;  1PIP A;  5CVM A;  4DMY A;  3TNX A;  1AIM A;  3IHP A;  2YJB A;  3MJ5 A;  8PCH A;  1AEC A;  1PXV A;  1TU6 A;  2GFO A;  3D6S A;  1EWO A;  1AU3 A;  2B1M A;  4BQV A;  4OEL A;  4RF1 A;  1CTE A;  1CQD A;  1NPZ A;  2AVW A;  4BOU A;  2G7Y A;  4X6I A;  4YYU A;  2UZJ A;  1EWM A;  5J94 A;  3MP2 A;  1DKI A;  1BP4 A;  5EZS A;  2FRQ A;  2XU1 A;  1THE A;  1MEG A;  4YYV A;  2CB5 A;  4KLB A;  3H89 A;  3PHW A;  4N4Z A;  1F2A A;  1U9V A;  3F5V A;  2Y6E A;  2R9N A;  3S3Q A;  1PVJ A;  3CBJ A;  1KXR A;  4FIP A;  3HD3 A;  4RY2 A;  3IEJ A;  1S4V A;  5CVN B;  3MTN A;  5K16 A;  1BQI A;  4P6E A;  4GUA A;  4MZS A;  4N8W A;  1Y08 A;  3OF9 A;  4BPV A;  2VHS A;  2O6X A;  4K7C A;  2R6N A;  4YV8 A;  3IOQ A;  4IP3 A;  5JZE A;  3PW3 A;  1QXP A;  1U5I A;  1PBH A;  1PPN A;  1NQC A;  2FE8 A;  4MI7 A;  3B21 A;  4P16 A;  3WXF A;  1MDW A;  3I06 A;  3LFY A;  3BWK A;  3LXS A;  1KHQ A;  3KKU A;  3WXE A;  1YT7 A;  1MIR A;  4PI3 A;  1CPJ A;  3M99 A;  4BS6 A;  4XZX A;  1AU2 A; 
#chains in the Genus database with same CATH homology
 3P5V A;  1ICF A;  3HWN A;  1NLJ A;  1X9Y A;  3KWB X;  2PBH A;  1FH0 A;  2FT2 A;  4CDF B;  1VSN A;  3HHI A;  5EF4 A;  1ATK A;  1W6F A;  4X6J A;  2DCA A;  1U9Q X;  1CB5 A;  4YYQ A;  2BSZ A;  2HHN A;  1PCI A;  1GEC E;  2OUL A;  4XR7 A;  1QDQ A;  1ZCM A;  2WBF X;  4P6G A;  2AUX A;  2DC6 A;  9PAP A;  3MHS A;  3O1G A;  3H8C A;  1NL6 A;  1PPO A;  2DZY A;  1AU4 A;  3IV2 A;  3H7D A;  2E00 A;  3OIS A;  4PAD A;  2HD5 A;  2E01 A;  5FPW A;  2R9M A;  1AYU A;  5CHT A;  2P0R A;  1ME3 A;  3PBH A;  3ZUA A;  2G6D A;  2XU5 A;  2NQD B;  3CH2 X;  1DEU A;  2FO5 A;  1CJL A;  4XUI A;  3N3K A;  1SNK A;  3RVV A;  5A24 A;  2ATO A;  4YVA A;  4FK5 A;  1ME4 A;  2Y5B A;  4YYR A;  2B1N A;  4PP2 E;  2P86 A;  3F75 A;  2DC8 A;  2FTD A;  2YJ2 A;  3AI8 A;  4MSX A;  2E03 A;  2ACT A;  1YVB A;  1K3B B;  1AU0 A;  4QRV A;  3V6C A;  4W5C A;  1O0E A;  3RVW A;  2AUZ A;  5PAD A;  2ARY A;  1TL9 A;  2PNS A;  1KHP A;  2XU4 A;  4OEM A;  1PE6 A;  4B55 A;  3OVX A;  1TLO A;  5EGW A;  3KSE A;  3H8B A;  2R9F A;  1F2B A;  2DJG B;  2OZ2 A;  1Y4H A;  3C9E A;  2G8J A;  5JA7 A;  2JQF R;  3P5W A;  2VFB A;  3P5X A;  4AXM A;  1ITO A;  4Q8H A;  3PNR A;  4QRX A;  2DCB A;  2DC9 A;  3MOR A;  4Q8G A;  3RVX A;  1U9W A;  3B79 A;  2OP3 A;  1QOL A;  3BPF A;  2VHF A;  3K8U A;  3HHA A;  1IWD A;  1MEM A;  2PAD A;  3CH3 X;  4CDE B;  4DMX A;  2YJC A;  2GHU A;  3I3T A;  1CS8 A;  2DC7 A;  3ERV A;  4I05 A;  1QMY A;  1POP A;  3MHH A;  3K9M A;  1CV8 A;  4YYW A;  4ZUX U;  1YK7 A;  3BCN A;  4W4U A;  4W5B A;  4C5P A;  7PCK A;  3E1Z B;  2FYE A;  3CBK A;  4N79 A;  3S3R A;  2DJF B;  1GMY A;  1Q6K A;  1GCB A;  2FRA A;  3IUT A;  4QRG A;  1E2T A;  3V6E A;  2XU3 A;  2CIO A;  1AYV A;  2HH5 A;  4G54 A;  2AIM A;  3WXG A;  1YAL A;  3KX1 A;  2F1G A;  5CVO B;  3BOW A;  1U9X A;  3DF0 A;  2HXZ A;  1DF0 A;  1AYW A;  3BPM A;  1EWL A;  3QT4 A;  2AU1 A;  1MHW A;  3OF8 A;  1A6R A;  1KFU L;  1CVZ A;  2FQ9 A;  4BS5 A;  3QSD A;  1PPP A;  2JQG R;  3QJ3 A;  4BGF A;  1NB5 A;  4I04 A;  2BDZ A;  4HWY A;  3O0U A;  3GCB A;  4I07 A;  2R9O A;  2YJ8 A;  1PAD A;  4WA6 A;  2NQA A;  2IPP B;  2P7U A;  4CDD B;  3H6S A;  2AYO A;  1SP4 B;  5CHV A;  4MZO A;  2BDL A;  4QH6 A;  1VJV A;  2H7J A;  1PPD A;  2PRE A;  4PP1 A;  1EWP A;  1YK8 A;  1F29 A;  1CSB B;  1EF7 A;  1BGO A;  3NHE A;  1W4T A;  3KFQ A;  3IMA A;  2R9C A;  2DCC A;  2NQG A;  1MS6 A;  3D9W A;  2YJ9 A;  2IBI A;  4BSQ A;  1JQP A;  3U8E A;  1KFX L;  1F2C A;  2AS8 A;  3LTW A;  2DCD A;  3OVZ A;  5JH3 A;  3PDF A;  3BC3 A;  2F7D A;  2AYN A;  2C0Y A;  2NQI A;  4CDC B;  1HUC B;  3K24 A;  1GX3 A;  4X6H A;  1GLO A;  1BY8 A;  2G8E A;  4AXL A;  4CZW A;  3KWZ A;  5F02 A;  4GUZ A;  1XKG A;  1ZIV A;  1M6D A;  2DZZ A;  1STF E;  3P5U A;  3N4C A;  4YYS A;  3N3G A;  2VFC A;  3KW9 A;  4FJC A;  4QBB A;  3USV A;  6PAD A;  2E02 A;  2FUD A;  1NB3 A;  1PIP A;  5CVM A;  4DMY A;  3TNX A;  1AIM A;  3IHP A;  2YJB A;  8PCH A;  4NV7 A;  1AEC A;  1PXV A;  1TU6 A;  2GFO A;  3D6S A;  1EWO A;  1AU3 A;  2B1M A;  4BQV A;  4OEL A;  1CTE A;  1CQD A;  1NPZ A;  2AVW A;  2G7Y A;  4X6I A;  4YYU A;  1EWM A;  5J94 A;  1BP4 A;  1W5R A;  2FRQ A;  2XU1 A;  1THE A;  1MEG A;  4YYV A;  2CB5 A;  4KLB A;  3H89 A;  4N4Z A;  1F2A A;  1U9V A;  3F5V A;  2Y6E A;  2R9N A;  3S3Q A;  4NV8 A;  3CBJ A;  1KXR A;  4FIP A;  3HD3 A;  4RY2 A;  3IEJ A;  1S4V A;  5CVN B;  3MTN A;  5K16 A;  1BQI A;  4P6E A;  4N8W A;  4MZS A;  1Y08 A;  3OF9 A;  4BPV A;  2VHS A;  2O6X A;  4K7C A;  2R6N A;  4YV8 A;  3IOQ A;  3PW3 A;  1QXP A;  1U5I A;  1PBH A;  1PPN A;  1NQC A;  3WXF A;  1MDW A;  3I06 A;  3LFY A;  3BWK A;  3LXS A;  1KHQ A;  3KKU A;  3WXE A;  1YT7 A;  1MIR A;  4PI3 A;  1CPJ A;  3M99 A;  4BS6 A;  1AU2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...