3KKUA

Cruzain in complex with a non-covalent ligand
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
215
structure length
214
Chain Sequence
b'APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQLDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cruzipain
publication title Complementarity between a docking and a high-throughput screen in discovering new cruzain inhibitors.
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Hydrolase
total genus 70
structure length 214
sequence length 215
ec nomenclature ec 3.4.22.51: Cruzipain.
pdb deposition date 2009-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3kkuA00
1IWDA 4HWYA 3V6CA 1QDQA 2R9CA 2B1MA 4Q8GA 1F29A 2AUZA 1NLJA 3AI8A 2AU1A 2FO5A 4FJCA 4DMXA 3K24A 3CH3X 2HHNA 2OP3A 3QSDA 4BSQA 2NQAA 3BC3A 3PDFA 1PIPA 1PPDA 4P6EA 1BP4A 2ACTA 2FTDA 1QXPA 1AU4A 2ATOA 2AUXA 4N79A 5CVOB 1CS8A 4Q8HA 4FK5A 2DCDA 2YJ2A 3IHPA 1ME4A 3B79A 1MEMA 3N3GA 3WXGA 2G8EA 3P5UA 4P6GA 2O6XA 3KWBX 3IOQA 1S4VA 3DF0A 3BCNA 3K8UA 1X9YA 2JQGR 4MZOA 1NL6A 1ME3A 2P0RA 2IPPB 1POPA 3LXSA 3WXFA 5PADA 1KFUL 4OELA 2AIMA 1PE6A 1NQCA 4BS5A 1PADA 1SP4B 2OULA 4G54A 1BGOA 1STFE 2NQGA 1NPZA 4RY2A 4OEMA 1CQDA 1KFXL 2WBFX 2DZZA 4XUIA 1Y4HA 1GECE 1ITOA 5CVMA 2ARYA 1PCIA 2PADA 1NB3A 2E01A 3BWKA 3RVVA 4AXLA 1YT7A 3RVWA 2CB5A 4I04A 4AXMA 3KFQA 1EWPA 1O0EA 5CHVA 2VHSA 1CB5A 2Y5BA 4W5CA 2R6NA 4X6HA 4W4UA 3KW9A 4N8WA 2DC8A 2NQIA 2HXZA 2FRAA 1PPPA 1KHQA 2GFOA 3IV2A 4PP1A 2HH5A 4YV8A 1TL9A 1EWLA 2P86A 3K9MA 2DJFB 1MEGA 1Y08A 1KXRA 3H7DA 1SNKA 9PAPA 3CBKA 3I06A 2AS8A 1CJLA 2DCBA 3MHSA 3CBJA 2BDLA 3BPFA 2R9OA 4MZSA 5CVNB 3KWZA 3P5XA 2YJCA 2BDZA 3ZUAA 2YJ9A 1MIRA 2E00A 2NQDB 2PBHA 3OISA 1NB5A 2OZ2A 3OVXA 1AECA 2DC7A 2XU3A 2FYEA 1PPNA 4FIPA 2E02A 4QRXA 1DF0A 4YYRA 1AIMA 2XU5A 2XU1A 5EF4A 2F1GA 3IMAA 4YYVA 1QOLA 3S3RA 2AYOA 1MDWA 3PBHA 1U9WA 1CV8A 4CDFB 7PCKA 1YALA 1CVZA 4ZUXU 1CTEA 2CIOA 3BPMA 2AVWA 3MORA 3IUTA 1YK7A 1U9QX 1BY8A 3H6SA 2JQFR 1KHPA 1QMYA 1GMYA 1U9XA 3C9EA 2DC9A 4KLBA 4N4ZA 4YYQA 3O0UA 1PBHA 1AU3A 2PREA 4W5BA 2DCCA 1PXVA 4QH6A 1BQIA 2F7DA 3GCBA 1AYUA 4QRVA 1VSNA 1F2BA 1EWMA 3KX1A 1U5IA 3H89A 2YJ8A 4X6JA 1Q6KA 1TU6A 1XKGA 1GCBA 3ERVA 5A24A 3USVA 4I05A 2FRQA 4QRGA 2R9FA 4I07A 4CZWA 3NHEA 2GHUA 3QT4A 2VHFA 1YVBA 1ZIVA 1ICFA 4PI3A 4XR7A 1PPOA 3N4CA 3HHIA 3QJ3A 4YYUA 5J94A 2HD5A 1EF7A 3P5WA 4QBBA 3OF8A 5EGWA 5F02A 2G6DA 1AU2A 1JQPA 3M99A 2G8JA 4DMYA 1VJVA 2YJBA 2IBIA 2FUDA 1HUCB 4K7CA 3F5VA 3H8BA 3MHHA 1DEUA 5JH3A 2E03A 4PADA 3HD3A 2XU4A 1THEA 3TNXA 2Y6EA 3D6SA 1AYWA 1TLOA 3KSEA 3KKUA 1AYVA 3V6EA 3O1GA 4CDCB 1CPJA 3BOWA 1YK8A 2C0YA 5JA7A 2DC6A 4BPVA 5K16A 1U9VA 5CHTA 2B1NA 3PW3A 4CDEB 1EWOA 3WXEA 3PNRA 1AU0A 2DJGB 2R9NA 3HWNA 3OVZA 2P7UA 4PP2E 4YVAA 3RVXA 2AYNA 1CSBB 2FT2A 6PADA 3S3QA 1GLOA 3U8EA 4MSXA 4CDDB 1M6DA 3I3TA 3IEJA 1A6RA 1ZCMA 5FPWA 3MTNA 1F2CA 2DCAA 3CH2X 2PNSA 4YYSA 3E1ZB 2R9MA 4BQVA 3N3KA 4BS6A 4X6IA 1ATKA 1MHWA 4YYWA 2G7YA 3H8CA 3LFYA 3P5VA 1K3BB 3OF9A 1F2AA 8PCHA 1MS6A 3HHAA 2H7JA 1FH0A 4WA6A 3F75A 2FQ9A 2DZYA
chains in the Genus database with same CATH superfamily
1IWDA 4HWYA 3V6CA 4A5UA 1QDQA 2R9CA 4IP3A 2B1MA 4Q8GA 1F29A 4OVZA 2AUZA 1NLJA 3AI8A 2AU1A 2FO5A 4FJCA 3BB7A 4DMXA 4BOQA 3K24A 3CH3X 2HHNA 4ZTBA 2OP3A 3QSDA 4BSQA 2NQAA 3BC3A 3PDFA 1PIPA 1PPDA 3MJ5A 4P6EA 1BP4A 2ACTA 2FTDA 1QXPA 1AU4A 3OQCA 4OVZB 2ATOA 2AUXA 4N79A 5CVOB 3PHUA 1CS8A 4Q8HA 4FK5A 2DCDA 2YJ2A 3IHPA 1ME4A 3B79A 3ZNHA 2BTWA 1MEMA 3N3GA 2JTCA 3RNVA 3WXGA 2G8EA 3P5UA 4P6GA 2O6XA 3KWBX 3IOQA 1S4VA 4M0WA 3DF0A 3BCNA 3K8UA 1X9YA 2JQGR 3W31A 4MZOA 1NL6A 1ME3A 2P0RA 2IPPB 4D8BA 1POPA 3LXSA 2BTWB 3WXFA 5PADA 1KFUL 4OELA 2AIMA 1PE6A 1NQCA 4BS5A 1PADA 1SP4B 2OULA 4G54A 1BGOA 3PHWA 1STFE 2NQGA 1NPZA 4RY2A 4OEMA 1CQDA 1KFXL 2WBFX 4P16A 2J7QC 2DZZA 2HWKA 4XUIA 1Y4HA 1GECE 1ITOA 5CVMA 2ARYA 3O65A 1PCIA 2PADA 1NB3A 2E01A 3BWKA 3RVVA 4AXLA 1YT7A 3RVWA 2CB5A 4I04A 4AXMA 3KFQA 1EWPA 1O0EA 5CHVA 5EZQA 2VHSA 1CB5A 2Y5BA 4W5CA 2R6NA 4X6HA 4W4UA 3TMPA 3KW9A 4N8WA 2DC8A 2NQIA 2HXZA 2FRAA 1PPPA 1KHQA 2GFOA 3IV2A 4PP1A 2HH5A 4YV8A 1TL9A 1EWLA 2P86A 3K9MA 2DJFB 4OW0A 1MEGA 1Y08A 1KXRA 3H7DA 1SNKA 9PAPA 3CBKA 4RNAA 4IUMA 3I06A 2AS8A 1CJLA 2DCBA 3MHSA 3CBJA 2BDLA 3BPFA 2R9OA 4MZSA 5JZEA 4PT5A 5CVNB 3KWZA 3P5XA 2YJCA 2BDZA 4REZA 3ZUAA 2YJ9A 1MIRA 2E00A 2FE8A 2NQDB 2PBHA 3OISA 1NB5A 2OZ2A 3OVXA 1AECA 2DC7A 2XU3A 2FYEA 1PPNA 4FIPA 2E02A 4QRXA 1DF0A 3E9SA 4YYRA 1AIMA 2XU5A 2XU1A 5EF4A 2AGAA 3W30A 2F1GA 3IMAA 4D8IA 4YYVA 3MP2A 1QOLA 2Z84A 3S3RA 2AYOA 1MDWA 2UZJA 3PBHA 1U9WA 1CV8A 3MTVA 4MM3B 4CDFB 7PCKA 1YALA 1CVZA 4ZUXU 4RF1A 1CTEA 2CIOA 3BPMA 5KO3A 2AVWA 3MORA 3IUTA 1YK7A 1U9QX 4RKXA 1BY8A 3H6SA 4MI7A 2JQFR 1KHPA 1QMYA 1GMYA 1U9XA 3C9EA 2DC9A 4KLBA 4N4ZA 3TRKA 4XZXA 4YYQA 3PHXA 3O0UA 1PBHA 1AU3A 2PREA 4W5BA 2DCCA 1PXVA 4QH6A 1BQIA 3B21A 2JRIA 2F7DA 3GCBA 1AYUA 4QRVA 5EZSA 1VSNA 4RF0A 1F2BA 1EWMA 4D8EA 3KX1A 1U5IA 1UKFA 3H89A 2YJ8A 4X6JA 1Q6KA 1TU6A 1XKGA 1GCBA 3ERVA 5A24A 3USVA 1PVJA 4I05A 4BOUA 2FRQA 4QRGA 2R9FA 4I07A 4CZWA 3NHEA 2GHUA 3QT4A 2VHFA 1YVBA 4BOSA 1ZIVA 1ICFA 4PI3A 4XR7A 1PPOA 3N4CA 3HHIA 3QJ3A 4YYUA 5J94A 4BOZA 2HD5A 1EF7A 3P5WA 4QBBA 3OF8A 5EGWA 5F02A 2G6DA 1AU2A 1JQPA 4GUAA 3M99A 2G8JA 4DMYA 1YZBA 2DOSA 1DKIA 1VJVA 2YJBA 2BU3A 2IBIA 2FUDA 1HUCB 4K7CA 3F5VA 3H8BA 3MHHA 1DEUA 5JH3A 4BOPA 2E03A 4PADA 3HD3A 2XU4A 1THEA 3TNXA 2Y6EA 3D6SA 1AYWA 1TLOA 3KSEA 3KKUA 1AYVA 3V6EA 3O1GA 4CDCB 1CPJA 3PSEA 3BOWA 1YK8A 2C0YA 5JA7A 4WURA 3PRPA 2DC6A 4BPVA 5K16A 1U9VA 5CHTA 3BY4A 4R3DA 2B1NA 3PW3A 4CDEB 1EWOA 3WXEA 3PNRA 1AU0A 2DJGB 2R9NA 3HWNA 3OVZA 2P7UA 4PP2E 4YVAA 5E6JA 3RVXA 2J7QA 2AYNA 1CSBB 2FT2A 6PADA 3S3QA 1GLOA 3U8EA 4MSXA 4CDDB 1M6DA 3I3TA 3IEJA 3PT2A 1A6RA 1ZCMA 5FPWA 3MTNA 3BBAA 1F2CA 2DCAA 3CH2X 2PNSA 4YYSA 3E1ZB 2R9MA 4BQVA 3N3KA 4BS6A 4X6IA 1ATKA 3C0RA 3PRMA 1MHWA 4YYWA 2G7YA 3H8CA 3LFYA 3P5VA 1K3BB 3OF9A 1F2AA 8PCHA 1MS6A 3HHAA 2H7JA 3IFUA 1FH0A 4WA6A 3F75A 2FQ9A 2DZYA 4HXDB
chains in the Genus database with same CATH topology
1IWDA 4HWYA 3V6CA 1QDQA 2R9CA 2B1MA 4Q8GA 1F29A 2AUZA 1NLJA 3AI8A 2AU1A 2FO5A 4FJCA 4DMXA 3K24A 3CH3X 2HHNA 2OP3A 3QSDA 4BSQA 2NQAA 3BC3A 3PDFA 1PIPA 1PPDA 4P6EA 1W6FA 1BP4A 2ACTA 2FTDA 1QXPA 1AU4A 4B55A 2ATOA 2AUXA 4N79A 5CVOB 1CS8A 4Q8HA 4FK5A 2DCDA 2YJ2A 3IHPA 1ME4A 3B79A 1MEMA 3N3GA 3WXGA 2G8EA 3P5UA 4P6GA 2O6XA 3KWBX 3IOQA 1S4VA 3DF0A 3BCNA 3K8UA 4BGFA 1X9YA 2JQGR 4MZOA 1NL6A 1ME3A 2P0RA 2IPPB 1POPA 3LXSA 3WXFA 5PADA 1KFUL 4OELA 2AIMA 1PE6A 1GX3A 1NQCA 4BS5A 1PADA 1SP4B 2OULA 4G54A 1BGOA 1STFE 2NQGA 1NPZA 4RY2A 4OEMA 1CQDA 1KFXL 2WBFX 2DZZA 4XUIA 1Y4HA 1GECE 1ITOA 5CVMA 2ARYA 1PCIA 2PADA 1W4TA 4NV8A 2BSZA 1NB3A 2E01A 3BWKA 3RVVA 4AXLA 1YT7A 3RVWA 2CB5A 4I04A 4AXMA 3KFQA 1EWPA 1O0EA 5CHVA 2VHSA 2Y5BA 1CB5A 4W5CA 2R6NA 4X6HA 4W4UA 1E2TA 3KW9A 4N8WA 2DC8A 2NQIA 2HXZA 2FRAA 1PPPA 1KHQA 2GFOA 3IV2A 4PP1A 2HH5A 4YV8A 3D9WA 1TL9A 1EWLA 2P86A 3K9MA 2DJFB 1MEGA 1Y08A 1KXRA 3H7DA 1SNKA 9PAPA 3CBKA 3I06A 2AS8A 1CJLA 2DCBA 3MHSA 3CBJA 2BDLA 3BPFA 2R9OA 4MZSA 5CVNB 3KWZA 3P5XA 2YJCA 2BDZA 3ZUAA 2YJ9A 1MIRA 2E00A 2NQDB 2PBHA 3OISA 1NB5A 2OZ2A 3OVXA 1AECA 2DC7A 2XU3A 2FYEA 1PPNA 4FIPA 2E02A 4QRXA 1DF0A 2VFBA 4YYRA 1AIMA 2XU5A 2XU1A 5EF4A 2F1GA 3IMAA 4YYVA 1QOLA 3S3RA 2AYOA 1MDWA 3PBHA 1U9WA 1CV8A 4CDFB 7PCKA 1YALA 1CVZA 4ZUXU 1CTEA 2CIOA 3BPMA 2AVWA 3MORA 3IUTA 1YK7A 1U9QX 1BY8A 3H6SA 2JQFR 1KHPA 1QMYA 1GMYA 1U9XA 3C9EA 2DC9A 4KLBA 4N4ZA 4C5PA 4YYQA 3O0UA 1PBHA 1AU3A 2PREA 3LTWA 4W5BA 2DCCA 1PXVA 4QH6A 1BQIA 2F7DA 3GCBA 1AYUA 4QRVA 1VSNA 1F2BA 1EWMA 3KX1A 1U5IA 3H89A 2YJ8A 4X6JA 1Q6KA 1TU6A 1XKGA 1GCBA 3ERVA 5A24A 3USVA 4I05A 2FRQA 4QRGA 2R9FA 4I07A 4CZWA 3NHEA 2GHUA 3QT4A 2VHFA 1YVBA 1ZIVA 1W5RA 1ICFA 4PI3A 4XR7A 4NV7A 1PPOA 3N4CA 3HHIA 3QJ3A 4YYUA 5J94A 2HD5A 1EF7A 3P5WA 4QBBA 3OF8A 5EGWA 5F02A 2G6DA 1AU2A 1JQPA 3M99A 2G8JA 4DMYA 1VJVA 2YJBA 2VFCA 2IBIA 2FUDA 1HUCB 4K7CA 3F5VA 3H8BA 3MHHA 1DEUA 5JH3A 4GUZA 2E03A 4PADA 3HD3A 2XU4A 1THEA 3TNXA 2Y6EA 3D6SA 1AYWA 1TLOA 3KSEA 3KKUA 1AYVA 3V6EA 3O1GA 4CDCB 1CPJA 3BOWA 1YK8A 2C0YA 5JA7A 2DC6A 4BPVA 5K16A 1U9VA 5CHTA 2B1NA 3PW3A 4CDEB 1EWOA 3WXEA 3PNRA 1AU0A 2DJGB 2R9NA 3HWNA 3OVZA 2P7UA 4PP2E 4YVAA 3RVXA 2AYNA 1CSBB 2FT2A 6PADA 3S3QA 1GLOA 3U8EA 4MSXA 4CDDB 1M6DA 3I3TA 3IEJA 1A6RA 1ZCMA 5FPWA 3MTNA 1F2CA 2DCAA 3CH2X 2PNSA 4YYSA 3E1ZB 2R9MA 4BQVA 3N3KA 4BS6A 4X6IA 1ATKA 1MHWA 4YYWA 2G7YA 3H8CA 3LFYA 3P5VA 1K3BB 3OF9A 1F2AA 8PCHA 1MS6A 3HHAA 2H7JA 1FH0A 4WA6A 3F75A 2FQ9A 2DZYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IWD A;  4HWY A;  3V6C A;  1QDQ A;  2R9C A;  2B1M A;  4Q8G A;  1F29 A;  2AUZ A;  1NLJ A;  3AI8 A;  2AU1 A;  2FO5 A;  4FJC A;  4DMX A;  3K24 A;  3CH3 X;  2HHN A;  2OP3 A;  3QSD A;  4BSQ A;  2NQA A;  3BC3 A;  3PDF A;  1PIP A;  1PPD A;  4P6E A;  1BP4 A;  2ACT A;  2FTD A;  1QXP A;  1AU4 A;  2ATO A;  2AUX A;  4N79 A;  5CVO B;  1CS8 A;  4Q8H A;  4FK5 A;  2DCD A;  2YJ2 A;  3IHP A;  1ME4 A;  3B79 A;  1MEM A;  3N3G A;  3WXG A;  2G8E A;  3P5U A;  4P6G A;  2O6X A;  3KWB X;  3IOQ A;  1S4V A;  3DF0 A;  3BCN A;  3K8U A;  1X9Y A;  2JQG R;  4MZO A;  1NL6 A;  1ME3 A;  2P0R A;  2IPP B;  1POP A;  3LXS A;  3WXF A;  5PAD A;  1KFU L;  4OEL A;  2AIM A;  1PE6 A;  1NQC A;  4BS5 A;  1PAD A;  1SP4 B;  2OUL A;  4G54 A;  1BGO A;  1STF E;  2NQG A;  1NPZ A;  4RY2 A;  4OEM A;  1CQD A;  1KFX L;  2WBF X;  2DZZ A;  4XUI A;  1Y4H A;  1GEC E;  1ITO A;  5CVM A;  2ARY A;  1PCI A;  2PAD A;  1NB3 A;  2E01 A;  3BWK A;  3RVV A;  4AXL A;  1YT7 A;  3RVW A;  2CB5 A;  4I04 A;  4AXM A;  3KFQ A;  1EWP A;  1O0E A;  5CHV A;  2VHS A;  1CB5 A;  2Y5B A;  4W5C A;  2R6N A;  4X6H A;  4W4U A;  3KW9 A;  4N8W A;  2DC8 A;  2NQI A;  2HXZ A;  2FRA A;  1PPP A;  1KHQ A;  2GFO A;  3IV2 A;  4PP1 A;  2HH5 A;  4YV8 A;  1TL9 A;  1EWL A;  2P86 A;  3K9M A;  2DJF B;  1MEG A;  1Y08 A;  1KXR A;  3H7D A;  1SNK A;  9PAP A;  3CBK A;  3I06 A;  2AS8 A;  1CJL A;  2DCB A;  3MHS A;  3CBJ A;  2BDL A;  3BPF A;  2R9O A;  4MZS A;  5CVN B;  3KWZ A;  3P5X A;  2YJC A;  2BDZ A;  3ZUA A;  2YJ9 A;  1MIR A;  2E00 A;  2NQD B;  2PBH A;  3OIS A;  1NB5 A;  2OZ2 A;  3OVX A;  1AEC A;  2DC7 A;  2XU3 A;  2FYE A;  1PPN A;  4FIP A;  2E02 A;  4QRX A;  1DF0 A;  4YYR A;  1AIM A;  2XU5 A;  2XU1 A;  5EF4 A;  2F1G A;  3IMA A;  4YYV A;  1QOL A;  3S3R A;  2AYO A;  1MDW A;  3PBH A;  1U9W A;  1CV8 A;  4CDF B;  7PCK A;  1YAL A;  1CVZ A;  4ZUX U;  1CTE A;  2CIO A;  3BPM A;  2AVW A;  3MOR A;  3IUT A;  1YK7 A;  1U9Q X;  1BY8 A;  3H6S A;  2JQF R;  1KHP A;  1QMY A;  1GMY A;  1U9X A;  3C9E A;  2DC9 A;  4KLB A;  4N4Z A;  4YYQ A;  3O0U A;  1PBH A;  1AU3 A;  2PRE A;  4W5B A;  2DCC A;  1PXV A;  4QH6 A;  1BQI A;  2F7D A;  3GCB A;  1AYU A;  4QRV A;  1VSN A;  1F2B A;  1EWM A;  3KX1 A;  1U5I A;  3H89 A;  2YJ8 A;  4X6J A;  1Q6K A;  1TU6 A;  1XKG A;  1GCB A;  3ERV A;  5A24 A;  3USV A;  4I05 A;  2FRQ A;  4QRG A;  2R9F A;  4I07 A;  4CZW A;  3NHE A;  2GHU A;  3QT4 A;  2VHF A;  1YVB A;  1ZIV A;  1ICF A;  4PI3 A;  4XR7 A;  1PPO A;  3N4C A;  3HHI A;  3QJ3 A;  4YYU A;  5J94 A;  2HD5 A;  1EF7 A;  3P5W A;  4QBB A;  3OF8 A;  5EGW A;  5F02 A;  2G6D A;  1AU2 A;  1JQP A;  3M99 A;  2G8J A;  4DMY A;  1VJV A;  2YJB A;  2IBI A;  2FUD A;  1HUC B;  4K7C A;  3F5V A;  3H8B A;  3MHH A;  1DEU A;  5JH3 A;  2E03 A;  4PAD A;  3HD3 A;  2XU4 A;  1THE A;  3TNX A;  2Y6E A;  3D6S A;  1AYW A;  1TLO A;  3KSE A;  3KKU A;  1AYV A;  3V6E A;  3O1G A;  4CDC B;  1CPJ A;  3BOW A;  1YK8 A;  2C0Y A;  5JA7 A;  2DC6 A;  4BPV A;  5K16 A;  1U9V A;  5CHT A;  2B1N A;  3PW3 A;  4CDE B;  1EWO A;  3WXE A;  3PNR A;  1AU0 A;  2DJG B;  2R9N A;  3HWN A;  3OVZ A;  2P7U A;  4PP2 E;  4YVA A;  3RVX A;  2AYN A;  1CSB B;  2FT2 A;  6PAD A;  3S3Q A;  1GLO A;  3U8E A;  4MSX A;  4CDD B;  1M6D A;  3I3T A;  3IEJ A;  1A6R A;  1ZCM A;  5FPW A;  3MTN A;  1F2C A;  2DCA A;  3CH2 X;  2PNS A;  4YYS A;  3E1Z B;  2R9M A;  4BQV A;  3N3K A;  4BS6 A;  4X6I A;  1ATK A;  1MHW A;  4YYW A;  2G7Y A;  3H8C A;  3LFY A;  3P5V A;  1K3B B;  3OF9 A;  1F2A A;  8PCH A;  1MS6 A;  3HHA A;  2H7J A;  1FH0 A;  4WA6 A;  3F75 A;  2FQ9 A;  2DZY A; 
#chains in the Genus database with same CATH topology
 1IWD A;  4HWY A;  3V6C A;  4A5U A;  1QDQ A;  2R9C A;  4IP3 A;  2B1M A;  4Q8G A;  1F29 A;  4OVZ A;  2AUZ A;  1NLJ A;  3AI8 A;  2AU1 A;  2FO5 A;  4FJC A;  3BB7 A;  4DMX A;  4BOQ A;  3K24 A;  3CH3 X;  2HHN A;  4ZTB A;  2OP3 A;  3QSD A;  4BSQ A;  2NQA A;  3BC3 A;  3PDF A;  1PIP A;  1PPD A;  3MJ5 A;  4P6E A;  1BP4 A;  2ACT A;  2FTD A;  1QXP A;  1AU4 A;  3OQC A;  4OVZ B;  2ATO A;  2AUX A;  4N79 A;  5CVO B;  3PHU A;  1CS8 A;  4Q8H A;  4FK5 A;  2DCD A;  2YJ2 A;  3IHP A;  1ME4 A;  3B79 A;  3ZNH A;  2BTW A;  1MEM A;  3N3G A;  2JTC A;  3RNV A;  3WXG A;  2G8E A;  3P5U A;  4P6G A;  2O6X A;  3KWB X;  3IOQ A;  1S4V A;  4M0W A;  3DF0 A;  3BCN A;  3K8U A;  1X9Y A;  2JQG R;  3W31 A;  4MZO A;  1NL6 A;  1ME3 A;  2P0R A;  2IPP B;  4D8B A;  1POP A;  3LXS A;  2BTW B;  3WXF A;  5PAD A;  1KFU L;  4OEL A;  2AIM A;  1PE6 A;  1NQC A;  4BS5 A;  1PAD A;  1SP4 B;  2OUL A;  4G54 A;  1BGO A;  3PHW A;  1STF E;  2NQG A;  1NPZ A;  4RY2 A;  4OEM A;  1CQD A;  1KFX L;  2WBF X;  4P16 A;  2J7Q C;  2DZZ A;  2HWK A;  4XUI A;  1Y4H A;  1GEC E;  1ITO A;  5CVM A;  2ARY A;  3O65 A;  1PCI A;  2PAD A;  1NB3 A;  2E01 A;  3BWK A;  3RVV A;  4AXL A;  1YT7 A;  3RVW A;  2CB5 A;  4I04 A;  4AXM A;  3KFQ A;  1EWP A;  1O0E A;  5CHV A;  5EZQ A;  2VHS A;  1CB5 A;  2Y5B A;  4W5C A;  2R6N A;  4X6H A;  4W4U A;  3TMP A;  3KW9 A;  4N8W A;  2DC8 A;  2NQI A;  2HXZ A;  2FRA A;  1PPP A;  1KHQ A;  2GFO A;  3IV2 A;  4PP1 A;  2HH5 A;  4YV8 A;  1TL9 A;  1EWL A;  2P86 A;  3K9M A;  2DJF B;  4OW0 A;  1MEG A;  1Y08 A;  1KXR A;  3H7D A;  1SNK A;  9PAP A;  3CBK A;  4RNA A;  4IUM A;  3I06 A;  2AS8 A;  1CJL A;  2DCB A;  3MHS A;  3CBJ A;  2BDL A;  3BPF A;  2R9O A;  4MZS A;  5JZE A;  4PT5 A;  5CVN B;  3KWZ A;  3P5X A;  2YJC A;  2BDZ A;  4REZ A;  3ZUA A;  2YJ9 A;  1MIR A;  2E00 A;  2FE8 A;  2NQD B;  2PBH A;  3OIS A;  1NB5 A;  2OZ2 A;  3OVX A;  1AEC A;  2DC7 A;  2XU3 A;  2FYE A;  1PPN A;  4FIP A;  2E02 A;  4QRX A;  1DF0 A;  3E9S A;  4YYR A;  1AIM A;  2XU5 A;  2XU1 A;  5EF4 A;  2AGA A;  3W30 A;  2F1G A;  3IMA A;  4D8I A;  4YYV A;  3MP2 A;  1QOL A;  2Z84 A;  3S3R A;  2AYO A;  1MDW A;  2UZJ A;  3PBH A;  1U9W A;  1CV8 A;  3MTV A;  4MM3 B;  4CDF B;  7PCK A;  1YAL A;  1CVZ A;  4ZUX U;  4RF1 A;  1CTE A;  2CIO A;  3BPM A;  5KO3 A;  2AVW A;  3MOR A;  3IUT A;  1YK7 A;  1U9Q X;  4RKX A;  1BY8 A;  3H6S A;  4MI7 A;  2JQF R;  1KHP A;  1QMY A;  1GMY A;  1U9X A;  3C9E A;  2DC9 A;  4KLB A;  4N4Z A;  3TRK A;  4XZX A;  4YYQ A;  3PHX A;  3O0U A;  1PBH A;  1AU3 A;  2PRE A;  4W5B A;  2DCC A;  1PXV A;  4QH6 A;  1BQI A;  3B21 A;  2JRI A;  2F7D A;  3GCB A;  1AYU A;  4QRV A;  5EZS A;  1VSN A;  4RF0 A;  1F2B A;  1EWM A;  4D8E A;  3KX1 A;  1U5I A;  1UKF A;  3H89 A;  2YJ8 A;  4X6J A;  1Q6K A;  1TU6 A;  1XKG A;  1GCB A;  3ERV A;  5A24 A;  3USV A;  1PVJ A;  4I05 A;  4BOU A;  2FRQ A;  4QRG A;  2R9F A;  4I07 A;  4CZW A;  3NHE A;  2GHU A;  3QT4 A;  2VHF A;  1YVB A;  4BOS A;  1ZIV A;  1ICF A;  4PI3 A;  4XR7 A;  1PPO A;  3N4C A;  3HHI A;  3QJ3 A;  4YYU A;  5J94 A;  4BOZ A;  2HD5 A;  1EF7 A;  3P5W A;  4QBB A;  3OF8 A;  5EGW A;  5F02 A;  2G6D A;  1AU2 A;  1JQP A;  4GUA A;  3M99 A;  2G8J A;  4DMY A;  1YZB A;  2DOS A;  1DKI A;  1VJV A;  2YJB A;  2BU3 A;  2IBI A;  2FUD A;  1HUC B;  4K7C A;  3F5V A;  3H8B A;  3MHH A;  1DEU A;  5JH3 A;  4BOP A;  2E03 A;  4PAD A;  3HD3 A;  2XU4 A;  1THE A;  3TNX A;  2Y6E A;  3D6S A;  1AYW A;  1TLO A;  3KSE A;  3KKU A;  1AYV A;  3V6E A;  3O1G A;  4CDC B;  1CPJ A;  3PSE A;  3BOW A;  1YK8 A;  2C0Y A;  5JA7 A;  4WUR A;  3PRP A;  2DC6 A;  4BPV A;  5K16 A;  1U9V A;  5CHT A;  3BY4 A;  4R3D A;  2B1N A;  3PW3 A;  4CDE B;  1EWO A;  3WXE A;  3PNR A;  1AU0 A;  2DJG B;  2R9N A;  3HWN A;  3OVZ A;  2P7U A;  4PP2 E;  4YVA A;  5E6J A;  3RVX A;  2J7Q A;  2AYN A;  1CSB B;  2FT2 A;  6PAD A;  3S3Q A;  1GLO A;  3U8E A;  4MSX A;  4CDD B;  1M6D A;  3I3T A;  3IEJ A;  3PT2 A;  1A6R A;  1ZCM A;  5FPW A;  3MTN A;  3BBA A;  1F2C A;  2DCA A;  3CH2 X;  2PNS A;  4YYS A;  3E1Z B;  2R9M A;  4BQV A;  3N3K A;  4BS6 A;  4X6I A;  1ATK A;  3C0R A;  3PRM A;  1MHW A;  4YYW A;  2G7Y A;  3H8C A;  3LFY A;  3P5V A;  1K3B B;  3OF9 A;  1F2A A;  8PCH A;  1MS6 A;  3HHA A;  2H7J A;  3IFU A;  1FH0 A;  4WA6 A;  3F75 A;  2FQ9 A;  2DZY A;  4HXD B; 
#chains in the Genus database with same CATH homology
 1IWD A;  4HWY A;  3V6C A;  1QDQ A;  2R9C A;  2B1M A;  4Q8G A;  1F29 A;  2AUZ A;  1NLJ A;  3AI8 A;  2AU1 A;  2FO5 A;  4FJC A;  4DMX A;  3K24 A;  3CH3 X;  2HHN A;  2OP3 A;  3QSD A;  4BSQ A;  2NQA A;  3BC3 A;  3PDF A;  1PIP A;  1PPD A;  4P6E A;  1W6F A;  1BP4 A;  2ACT A;  2FTD A;  1QXP A;  1AU4 A;  4B55 A;  2ATO A;  2AUX A;  4N79 A;  5CVO B;  1CS8 A;  4Q8H A;  4FK5 A;  2DCD A;  2YJ2 A;  3IHP A;  1ME4 A;  3B79 A;  1MEM A;  3N3G A;  3WXG A;  2G8E A;  3P5U A;  4P6G A;  2O6X A;  3KWB X;  3IOQ A;  1S4V A;  3DF0 A;  3BCN A;  3K8U A;  4BGF A;  1X9Y A;  2JQG R;  4MZO A;  1NL6 A;  1ME3 A;  2P0R A;  2IPP B;  1POP A;  3LXS A;  3WXF A;  5PAD A;  1KFU L;  4OEL A;  2AIM A;  1PE6 A;  1GX3 A;  1NQC A;  4BS5 A;  1PAD A;  1SP4 B;  2OUL A;  4G54 A;  1BGO A;  1STF E;  2NQG A;  1NPZ A;  4RY2 A;  4OEM A;  1CQD A;  1KFX L;  2WBF X;  2DZZ A;  4XUI A;  1Y4H A;  1GEC E;  1ITO A;  5CVM A;  2ARY A;  1PCI A;  2PAD A;  1W4T A;  4NV8 A;  2BSZ A;  1NB3 A;  2E01 A;  3BWK A;  3RVV A;  4AXL A;  1YT7 A;  3RVW A;  2CB5 A;  4I04 A;  4AXM A;  3KFQ A;  1EWP A;  1O0E A;  5CHV A;  2VHS A;  2Y5B A;  1CB5 A;  4W5C A;  2R6N A;  4X6H A;  4W4U A;  1E2T A;  3KW9 A;  4N8W A;  2DC8 A;  2NQI A;  2HXZ A;  2FRA A;  1PPP A;  1KHQ A;  2GFO A;  3IV2 A;  4PP1 A;  2HH5 A;  4YV8 A;  3D9W A;  1TL9 A;  1EWL A;  2P86 A;  3K9M A;  2DJF B;  1MEG A;  1Y08 A;  1KXR A;  3H7D A;  1SNK A;  9PAP A;  3CBK A;  3I06 A;  2AS8 A;  1CJL A;  2DCB A;  3MHS A;  3CBJ A;  2BDL A;  3BPF A;  2R9O A;  4MZS A;  5CVN B;  3KWZ A;  3P5X A;  2YJC A;  2BDZ A;  3ZUA A;  2YJ9 A;  1MIR A;  2E00 A;  2NQD B;  2PBH A;  3OIS A;  1NB5 A;  2OZ2 A;  3OVX A;  1AEC A;  2DC7 A;  2XU3 A;  2FYE A;  1PPN A;  4FIP A;  2E02 A;  4QRX A;  1DF0 A;  2VFB A;  4YYR A;  1AIM A;  2XU5 A;  2XU1 A;  5EF4 A;  2F1G A;  3IMA A;  4YYV A;  1QOL A;  3S3R A;  2AYO A;  1MDW A;  3PBH A;  1U9W A;  1CV8 A;  4CDF B;  7PCK A;  1YAL A;  1CVZ A;  4ZUX U;  1CTE A;  2CIO A;  3BPM A;  2AVW A;  3MOR A;  3IUT A;  1YK7 A;  1U9Q X;  1BY8 A;  3H6S A;  2JQF R;  1KHP A;  1QMY A;  1GMY A;  1U9X A;  3C9E A;  2DC9 A;  4KLB A;  4N4Z A;  4C5P A;  4YYQ A;  3O0U A;  1PBH A;  1AU3 A;  2PRE A;  3LTW A;  4W5B A;  2DCC A;  1PXV A;  4QH6 A;  1BQI A;  2F7D A;  3GCB A;  1AYU A;  4QRV A;  1VSN A;  1F2B A;  1EWM A;  3KX1 A;  1U5I A;  3H89 A;  2YJ8 A;  4X6J A;  1Q6K A;  1TU6 A;  1XKG A;  1GCB A;  3ERV A;  5A24 A;  3USV A;  4I05 A;  2FRQ A;  4QRG A;  2R9F A;  4I07 A;  4CZW A;  3NHE A;  2GHU A;  3QT4 A;  2VHF A;  1YVB A;  1ZIV A;  1W5R A;  1ICF A;  4PI3 A;  4XR7 A;  4NV7 A;  1PPO A;  3N4C A;  3HHI A;  3QJ3 A;  4YYU A;  5J94 A;  2HD5 A;  1EF7 A;  3P5W A;  4QBB A;  3OF8 A;  5EGW A;  5F02 A;  2G6D A;  1AU2 A;  1JQP A;  3M99 A;  2G8J A;  4DMY A;  1VJV A;  2YJB A;  2VFC A;  2IBI A;  2FUD A;  1HUC B;  4K7C A;  3F5V A;  3H8B A;  3MHH A;  1DEU A;  5JH3 A;  4GUZ A;  2E03 A;  4PAD A;  3HD3 A;  2XU4 A;  1THE A;  3TNX A;  2Y6E A;  3D6S A;  1AYW A;  1TLO A;  3KSE A;  3KKU A;  1AYV A;  3V6E A;  3O1G A;  4CDC B;  1CPJ A;  3BOW A;  1YK8 A;  2C0Y A;  5JA7 A;  2DC6 A;  4BPV A;  5K16 A;  1U9V A;  5CHT A;  2B1N A;  3PW3 A;  4CDE B;  1EWO A;  3WXE A;  3PNR A;  1AU0 A;  2DJG B;  2R9N A;  3HWN A;  3OVZ A;  2P7U A;  4PP2 E;  4YVA A;  3RVX A;  2AYN A;  1CSB B;  2FT2 A;  6PAD A;  3S3Q A;  1GLO A;  3U8E A;  4MSX A;  4CDD B;  1M6D A;  3I3T A;  3IEJ A;  1A6R A;  1ZCM A;  5FPW A;  3MTN A;  1F2C A;  2DCA A;  3CH2 X;  2PNS A;  4YYS A;  3E1Z B;  2R9M A;  4BQV A;  3N3K A;  4BS6 A;  4X6I A;  1ATK A;  1MHW A;  4YYW A;  2G7Y A;  3H8C A;  3LFY A;  3P5V A;  1K3B B;  3OF9 A;  1F2A A;  8PCH A;  1MS6 A;  3HHA A;  2H7J A;  1FH0 A;  4WA6 A;  3F75 A;  2FQ9 A;  2DZY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...