3KKUA

Cruzain in complex with a non-covalent ligand
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
215
structure length
214
Chain Sequence
APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQLDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cruzipain
publication title Complementarity between a docking and a high-throughput screen in discovering new cruzain inhibitors.
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Hydrolase
total genus 70
structure length 214
sequence length 215
ec nomenclature ec 3.4.22.51: Cruzipain.
pdb deposition date 2009-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3kkuA00
1GCBA 1NQCA 4PP1A 2E01A 1NLJA 4FJCA 1MHWA 3HHIA 1EWPA 3IEJA 3DF0A 3ZUAA 5JH3A 2YJCA 1YALA 3IHPA 3P5XA 2VHSA 7PCKA 1THEA 2AVWA 3RVVA 1F2AA 2DZYA 2HD5A 3OISA 1CSBB 2ARYA 2NQAA 2B1MA 2E03A 1VSNA 1CPJA 2H7JA 3CBKA 6PADA 4K7CA 4KLBA 5CHTA 3H89A 2GHUA 2OULA 4Q8GA 3BC3A 2P0RA 3QT4A 2G8EA 3BWKA 4HWYA 2WBFX 5F02A 3RVXA 1ME4A 1BP4A 1JQPA 5CVOB 3HHAA 4BSQA 2XU1A 1AU4A 5CVMA 1TU6A 2BDLA 3MHSA 1KHPA 1HUCB 4YYUA 1NB5A 2DCBA 1CVZA 4BPVA 3V6CA 1DEUA 2DZZA 2IPPB 2JQFR 1NL6A 2AIMA 4G54A 1PIPA 1EWOA 2B1NA 3MHHA 2Y6EA 4N79A 4QRGA 1PPOA 2DC6A 1ZIVA 4MZSA 2XU3A 1CTEA 1PADA 3C9EA 4AXLA 1EWLA 1TLOA 4WA6A 1F29A 2DCCA 1K3BB 3N4CA 2DCAA 4YYWA 4CDDB 1PPPA 1GLOA 1MDWA 2DJGB 1SNKA 2XU5A 3H8CA 2YJ9A 2FRQA 3QJ3A 3B79A 2R9MA 1NB3A 1ZCMA 4CDEB 3MORA 1NPZA 3CH3X 4YVAA 3O0UA 4BQVA 2HH5A 2FUDA 3KWBX 1PPDA 4P6EA 5CHVA 2OZ2A 1PE6A 2AUXA 2R9NA 3D6SA 1BGOA 2AS8A 1AYUA 1IWDA 2XU4A 1U9QX 3P5VA 1AYWA 3PDFA 4X6IA 1CV8A 2PBHA 1F2BA 3KWZA 3P5WA 2FTDA 4FK5A 2VHFA 3AI8A 3OF9A 4DMYA 1PXVA 5K16A 1QOLA 1KXRA 3KFQA 1GMYA 4RY2A 1Y08A 2Y5BA 1MIRA 4OEMA 2DC7A 3TNXA 4CZWA 1A6RA 1YK8A 2DC9A 1YK7A 4W5CA 1SP4B 2FYEA 9PAPA 2AU1A 3K9MA 4AXMA 1MEGA 3GCBA 3E1ZB 1FH0A 1EWMA 3H6SA 1YT7A 1CJLA 2AUZA 3H7DA 4XR7A 2O6XA 4FIPA 1AU2A 3QSDA 1CB5A 1CQDA 4X6JA 4DMXA 2FQ9A 1AU0A 4OELA 1BY8A 3LXSA 1QDQA 3F75A 3LFYA 3WXFA 3I06A 3S3RA 1QXPA 5CVNB 1U9VA 4YV8A 1U9WA 3BPFA 2ACTA 4CDCB 1AU3A 1MEMA 4QBBA 2YJBA 2HXZA 4MSXA 2GFOA 1GECE 1AYVA 2G7YA 1STFE 3WXEA 5JA7A 2P86A 3BOWA 2E00A 5EF4A 3BPMA 2JQGR 3IMAA 4QRVA 1ICFA 3CBJA 2YJ2A 2R9OA 3U8EA 2YJ8A 2CIOA 2BDZA 4W5BA 3ERVA 3N3KA 1U5IA 3MTNA 1CS8A 2HHNA 2PREA 1U9XA 1KHQA 2F1GA 5FPWA 3PBHA 1O0EA 1DF0A 5PADA 1PPNA 2NQDB 2G6DA 1ME3A 2NQGA 1QMYA 3IV2A 3S3QA 2ATOA 3K8UA 1TL9A 4N8WA 1F2CA 1PCIA 3RVWA 3HWNA 2NQIA 8PCHA 4N4ZA 2E02A 3KSEA 3K24A 1YVBA 1S4VA 4PI3A 3PNRA 4BS6A 2R9CA 1EF7A 2FO5A 3BCNA 4P6GA 1KFUL 4QRXA 1Y4HA 2AYNA 3F5VA 3H8BA 2FRAA 1KFXL 4CDFB 4QH6A 2AYOA 4YYSA 4I04A 1ATKA 2DCDA 1X9YA 3KW9A 4I05A 2R6NA 3WXGA 1PBHA 4I07A 2C0YA 4YYQA 3OVXA 3IUTA 4MZOA 1AIMA 3USVA 2FT2A 3KX1A 4YYRA 4XUIA 2DC8A 3M99A 4W4UA 2G8JA 3PW3A 2DJFB 1MS6A 1AECA 4PP2E 2PNSA 4X6HA 1XKGA 1Q6KA 3V6EA 3O1GA 2P7UA 2OP3A 4ZUXU 5J94A 3HD3A 3I3TA 3N3GA 3KKUA 1VJVA 2PADA 2R9FA 4Q8HA 5A24A 3OVZA 3OF8A 1BQIA 3P5UA 4BS5A 2IBIA 2F7DA 2CB5A 4YYVA 1M6DA 3IOQA 3CH2X 3NHEA 1POPA 4PADA 5EGWA 1ITOA
chains in the Genus database with same CATH superfamily
2Z84A 1GCBA 1NQCA 4PP1A 2E01A 1NLJA 3PHWA 4FJCA 1MHWA 3HHIA 2J7QC 1EWPA 3IEJA 3DF0A 3ZUAA 5JH3A 4BOZA 2YJCA 1YALA 3IHPA 3P5XA 2VHSA 7PCKA 4BOQA 1THEA 4OW0A 2AVWA 3PRMA 3RVVA 1F2AA 2DZYA 2HD5A 3OISA 5E6JA 1CSBB 2ARYA 2NQAA 2B1MA 2E03A 1VSNA 1CPJA 2H7JA 3CBKA 4RF0A 6PADA 4K7CA 4KLBA 3PSEA 5CHTA 4D8IA 3H89A 2GHUA 2OULA 4HXDB 4Q8GA 3PRPA 3BC3A 2P0RA 3QT4A 2G8EA 3BWKA 4HWYA 2WBFX 5F02A 3IFUA 4BOSA 3RVXA 1ME4A 1BP4A 1JQPA 5CVOB 3HHAA 4BSQA 2J7QA 2XU1A 5EZSA 1AU4A 5CVMA 1TU6A 2BDLA 3MHSA 1KHPA 1HUCB 4YYUA 1NB5A 4BOPA 3RNVA 2DCBA 1CVZA 4BPVA 4RKXA 3V6CA 4IUMA 1DEUA 2DZZA 2IPPB 2JQFR 3TMPA 1NL6A 2AIMA 4G54A 1PIPA 1EWOA 2B1NA 3MHHA 2Y6EA 4N79A 4QRGA 1PPOA 2DC6A 1ZIVA 4MZSA 2XU3A 4P16A 1CTEA 1PADA 3C9EA 4AXLA 1EWLA 1TLOA 4WA6A 1F29A 2DCCA 1K3BB 3N4CA 2DCAA 4YYWA 4CDDB 1PPPA 1GLOA 1MDWA 4PT5A 2DJGB 1SNKA 2XU5A 3H8CA 2YJ9A 3B21A 4A5UA 2BU3A 2FRQA 4IP3A 3QJ3A 3MJ5A 3B79A 2R9MA 1NB3A 1ZCMA 4CDEB 3MORA 1NPZA 3CH3X 4YVAA 3O0UA 4BQVA 2HH5A 2FUDA 3KWBX 1PPDA 4P6EA 5CHVA 2OZ2A 4XZXA 1PE6A 2AUXA 2R9NA 3D6SA 1BGOA 2AS8A 1AYUA 1IWDA 4RF1A 2XU4A 3W31A 1U9QX 3P5VA 3C0RA 1AYWA 3PDFA 4X6IA 1CV8A 2PBHA 4MM3B 1F2BA 3OQCA 3KWZA 3PHUA 3P5WA 2HWKA 2FTDA 4FK5A 3BBAA 2VHFA 3AI8A 4REZA 3OF9A 4DMYA 1PXVA 5K16A 1QOLA 1KXRA 3KFQA 1GMYA 4RY2A 2BTWA 1Y08A 2Y5BA 1MIRA 4OEMA 2DC7A 3TNXA 4CZWA 1A6RA 1YK8A 2DC9A 1YK7A 4W5CA 1SP4B 2FYEA 9PAPA 2AU1A 3K9MA 4AXMA 1YZBA 1MEGA 3GCBA 3E1ZB 1FH0A 3O65A 5EZQA 1EWMA 3H6SA 1YT7A 1CJLA 2AUZA 3H7DA 4XR7A 2AGAA 2O6XA 4FIPA 2DOSA 1AU2A 3QSDA 1CB5A 4M0WA 1CQDA 4X6JA 4DMXA 2FQ9A 1AU0A 4OELA 1BY8A 3LXSA 1QDQA 3F75A 3LFYA 3WXFA 3I06A 3BY4A 3S3RA 4MI7A 1QXPA 5CVNB 1U9VA 4YV8A 1U9WA 3BPFA 2ACTA 4CDCB 1AU3A 1MEMA 3E9SA 4QBBA 2YJBA 2JRIA 2HXZA 4MSXA 2GFOA 1GECE 1AYVA 2G7YA 2FE8A 2UZJA 1STFE 3WXEA 5JA7A 2P86A 3MTVA 4OVZA 3BOWA 2E00A 5EF4A 3BPMA 2JQGR 3IMAA 4QRVA 1ICFA 3CBJA 2BTWB 2YJ2A 2R9OA 3U8EA 2YJ8A 2CIOA 2BDZA 4W5BA 3ERVA 3N3KA 1U5IA 3MTNA 1CS8A 2HHNA 2PREA 1U9XA 1KHQA 2F1GA 5FPWA 3PBHA 1O0EA 1DF0A 5PADA 1PPNA 2NQDB 2G6DA 1ME3A 2NQGA 1QMYA 3IV2A 3S3QA 2ATOA 3K8UA 1TL9A 4BOUA 4N8WA 1F2CA 1PCIA 3RVWA 3HWNA 2NQIA 1DKIA 8PCHA 4N4ZA 3W30A 2E02A 3KSEA 4ZTBA 3K24A 1YVBA 3PHXA 1S4VA 4PI3A 3PNRA 4BS6A 3BB7A 2R9CA 1EF7A 2FO5A 3BCNA 4P6GA 3ZNHA 1KFUL 4QRXA 1Y4HA 2AYNA 3F5VA 3H8BA 2FRAA 1KFXL 4CDFB 4QH6A 2AYOA 4YYSA 4I04A 1ATKA 2DCDA 3PT2A 1X9YA 3TRKA 4D8BA 3KW9A 4I05A 2R6NA 2JTCA 3WXGA 1PBHA 4WURA 4I07A 2C0YA 4YYQA 3OVXA 3IUTA 4OVZB 4MZOA 1AIMA 3USVA 2FT2A 3KX1A 4YYRA 4XUIA 2DC8A 3M99A 4W4UA 2G8JA 3PW3A 1UKFA 2DJFB 1MS6A 1AECA 4PP2E 2PNSA 5JZEA 4RNAA 4X6HA 4D8EA 1XKGA 1Q6KA 3V6EA 3O1GA 2P7UA 2OP3A 4ZUXU 5J94A 3HD3A 3I3TA 3N3GA 3KKUA 1VJVA 4GUAA 2PADA 2R9FA 4Q8HA 5A24A 3OVZA 3OF8A 3MP2A 1BQIA 3P5UA 4BS5A 5KO3A 2IBIA 2F7DA 2CB5A 1PVJA 4YYVA 1M6DA 3IOQA 3CH2X 3NHEA 4R3DA 1POPA 4PADA 5EGWA 1ITOA
chains in the Genus database with same CATH topology
1GCBA 1NQCA 4PP1A 2E01A 1NLJA 4FJCA 1MHWA 3HHIA 1EWPA 3IEJA 3DF0A 3ZUAA 5JH3A 2YJCA 1YALA 3IHPA 3P5XA 2VHSA 7PCKA 1THEA 2AVWA 3RVVA 1F2AA 2DZYA 2HD5A 3OISA 1CSBB 2ARYA 2NQAA 2B1MA 2E03A 1VSNA 1CPJA 2H7JA 3CBKA 6PADA 4K7CA 4KLBA 5CHTA 3H89A 2GHUA 2OULA 4Q8GA 3BC3A 2P0RA 3QT4A 2G8EA 3BWKA 4HWYA 2WBFX 5F02A 3RVXA 1ME4A 1BP4A 1JQPA 5CVOB 3HHAA 4BSQA 2XU1A 1AU4A 5CVMA 1E2TA 1TU6A 2BDLA 3MHSA 1KHPA 1HUCB 4YYUA 1NB5A 2DCBA 1CVZA 4BPVA 3V6CA 1DEUA 2DZZA 2IPPB 2JQFR 1NL6A 2AIMA 4G54A 1PIPA 1EWOA 2B1NA 3MHHA 4B55A 2Y6EA 4N79A 4QRGA 1PPOA 2DC6A 1ZIVA 4MZSA 1W4TA 2XU3A 1CTEA 1PADA 3C9EA 4AXLA 1EWLA 1TLOA 4WA6A 1F29A 2DCCA 1K3BB 3N4CA 2DCAA 2BSZA 4YYWA 4CDDB 1PPPA 1GLOA 1MDWA 2DJGB 1SNKA 2XU5A 3H8CA 2YJ9A 2FRQA 3QJ3A 3B79A 2R9MA 1NB3A 1ZCMA 4CDEB 3MORA 1NPZA 3CH3X 4YVAA 3O0UA 4BQVA 2HH5A 2FUDA 3KWBX 1PPDA 4P6EA 5CHVA 2OZ2A 1PE6A 2AUXA 2R9NA 3D6SA 1BGOA 3LTWA 2AS8A 1AYUA 1IWDA 2XU4A 1U9QX 3P5VA 1AYWA 3PDFA 4X6IA 1CV8A 2PBHA 1F2BA 3KWZA 3P5WA 2FTDA 4FK5A 2VHFA 3AI8A 3OF9A 4DMYA 1PXVA 5K16A 1QOLA 1KXRA 3KFQA 1GMYA 4RY2A 1Y08A 2Y5BA 1MIRA 4OEMA 2DC7A 3TNXA 4CZWA 1A6RA 1YK8A 2DC9A 1YK7A 4W5CA 1SP4B 4GUZA 2FYEA 9PAPA 2AU1A 3K9MA 4AXMA 1MEGA 2VFCA 3GCBA 3E1ZB 1FH0A 1EWMA 3H6SA 1YT7A 1CJLA 2AUZA 3H7DA 4XR7A 2O6XA 4FIPA 1AU2A 3QSDA 1CB5A 1W5RA 1CQDA 4X6JA 4DMXA 2FQ9A 1AU0A 4OELA 1BY8A 3LXSA 1QDQA 3F75A 3LFYA 3WXFA 3I06A 3S3RA 1QXPA 3D9WA 5CVNB 1U9VA 4YV8A 1U9WA 3BPFA 2ACTA 4CDCB 1AU3A 4BGFA 1MEMA 4QBBA 2YJBA 2HXZA 4MSXA 2GFOA 1GECE 1AYVA 2G7YA 1W6FA 1STFE 3WXEA 5JA7A 2P86A 3BOWA 2E00A 5EF4A 3BPMA 2JQGR 3IMAA 4QRVA 1ICFA 3CBJA 2YJ2A 2R9OA 3U8EA 2YJ8A 2CIOA 2BDZA 4W5BA 3ERVA 3N3KA 1U5IA 3MTNA 1CS8A 2HHNA 2PREA 1U9XA 1KHQA 2F1GA 5FPWA 3PBHA 1O0EA 1DF0A 5PADA 1PPNA 4NV7A 2NQDB 2G6DA 1ME3A 2NQGA 1QMYA 3IV2A 3S3QA 2ATOA 2VFBA 3K8UA 1TL9A 4N8WA 1F2CA 1PCIA 3RVWA 3HWNA 2NQIA 8PCHA 4N4ZA 2E02A 3KSEA 3K24A 1YVBA 1S4VA 4PI3A 3PNRA 4BS6A 2R9CA 1EF7A 2FO5A 3BCNA 4P6GA 1KFUL 4QRXA 1Y4HA 2AYNA 3F5VA 3H8BA 2FRAA 1KFXL 4CDFB 4QH6A 2AYOA 4YYSA 4I04A 1ATKA 2DCDA 1X9YA 3KW9A 4I05A 2R6NA 3WXGA 1PBHA 4I07A 2C0YA 4YYQA 3OVXA 3IUTA 4MZOA 1AIMA 3USVA 2FT2A 3KX1A 4YYRA 4XUIA 2DC8A 3M99A 4W4UA 2G8JA 4NV8A 3PW3A 2DJFB 1MS6A 1AECA 4PP2E 2PNSA 4X6HA 1XKGA 1Q6KA 3V6EA 4C5PA 3O1GA 2P7UA 2OP3A 4ZUXU 5J94A 3HD3A 3I3TA 3N3GA 3KKUA 1VJVA 2PADA 2R9FA 4Q8HA 5A24A 3OVZA 3OF8A 1BQIA 3P5UA 4BS5A 2IBIA 2F7DA 2CB5A 4YYVA 1M6DA 3IOQA 3CH2X 3NHEA 1GX3A 1POPA 4PADA 5EGWA 1ITOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GCB A;  1NQC A;  4PP1 A;  2E01 A;  1NLJ A;  4FJC A;  1MHW A;  3HHI A;  1EWP A;  3IEJ A;  3DF0 A;  3ZUA A;  5JH3 A;  2YJC A;  1YAL A;  3IHP A;  3P5X A;  2VHS A;  7PCK A;  1THE A;  2AVW A;  3RVV A;  1F2A A;  2DZY A;  2HD5 A;  3OIS A;  1CSB B;  2ARY A;  2NQA A;  2B1M A;  2E03 A;  1VSN A;  1CPJ A;  2H7J A;  3CBK A;  6PAD A;  4K7C A;  4KLB A;  5CHT A;  3H89 A;  2GHU A;  2OUL A;  4Q8G A;  3BC3 A;  2P0R A;  3QT4 A;  2G8E A;  3BWK A;  4HWY A;  2WBF X;  5F02 A;  3RVX A;  1ME4 A;  1BP4 A;  1JQP A;  5CVO B;  3HHA A;  4BSQ A;  2XU1 A;  1AU4 A;  5CVM A;  1TU6 A;  2BDL A;  3MHS A;  1KHP A;  1HUC B;  4YYU A;  1NB5 A;  2DCB A;  1CVZ A;  4BPV A;  3V6C A;  1DEU A;  2DZZ A;  2IPP B;  2JQF R;  1NL6 A;  2AIM A;  4G54 A;  1PIP A;  1EWO A;  2B1N A;  3MHH A;  2Y6E A;  4N79 A;  4QRG A;  1PPO A;  2DC6 A;  1ZIV A;  4MZS A;  2XU3 A;  1CTE A;  1PAD A;  3C9E A;  4AXL A;  1EWL A;  1TLO A;  4WA6 A;  1F29 A;  2DCC A;  1K3B B;  3N4C A;  2DCA A;  4YYW A;  4CDD B;  1PPP A;  1GLO A;  1MDW A;  2DJG B;  1SNK A;  2XU5 A;  3H8C A;  2YJ9 A;  2FRQ A;  3QJ3 A;  3B79 A;  2R9M A;  1NB3 A;  1ZCM A;  4CDE B;  3MOR A;  1NPZ A;  3CH3 X;  4YVA A;  3O0U A;  4BQV A;  2HH5 A;  2FUD A;  3KWB X;  1PPD A;  4P6E A;  5CHV A;  2OZ2 A;  1PE6 A;  2AUX A;  2R9N A;  3D6S A;  1BGO A;  2AS8 A;  1AYU A;  1IWD A;  2XU4 A;  1U9Q X;  3P5V A;  1AYW A;  3PDF A;  4X6I A;  1CV8 A;  2PBH A;  1F2B A;  3KWZ A;  3P5W A;  2FTD A;  4FK5 A;  2VHF A;  3AI8 A;  3OF9 A;  4DMY A;  1PXV A;  5K16 A;  1QOL A;  1KXR A;  3KFQ A;  1GMY A;  4RY2 A;  1Y08 A;  2Y5B A;  1MIR A;  4OEM A;  2DC7 A;  3TNX A;  4CZW A;  1A6R A;  1YK8 A;  2DC9 A;  1YK7 A;  4W5C A;  1SP4 B;  2FYE A;  9PAP A;  2AU1 A;  3K9M A;  4AXM A;  1MEG A;  3GCB A;  3E1Z B;  1FH0 A;  1EWM A;  3H6S A;  1YT7 A;  1CJL A;  2AUZ A;  3H7D A;  4XR7 A;  2O6X A;  4FIP A;  1AU2 A;  3QSD A;  1CB5 A;  1CQD A;  4X6J A;  4DMX A;  2FQ9 A;  1AU0 A;  4OEL A;  1BY8 A;  3LXS A;  1QDQ A;  3F75 A;  3LFY A;  3WXF A;  3I06 A;  3S3R A;  1QXP A;  5CVN B;  1U9V A;  4YV8 A;  1U9W A;  3BPF A;  2ACT A;  4CDC B;  1AU3 A;  1MEM A;  4QBB A;  2YJB A;  2HXZ A;  4MSX A;  2GFO A;  1GEC E;  1AYV A;  2G7Y A;  1STF E;  3WXE A;  5JA7 A;  2P86 A;  3BOW A;  2E00 A;  5EF4 A;  3BPM A;  2JQG R;  3IMA A;  4QRV A;  1ICF A;  3CBJ A;  2YJ2 A;  2R9O A;  3U8E A;  2YJ8 A;  2CIO A;  2BDZ A;  4W5B A;  3ERV A;  3N3K A;  1U5I A;  3MTN A;  1CS8 A;  2HHN A;  2PRE A;  1U9X A;  1KHQ A;  2F1G A;  5FPW A;  3PBH A;  1O0E A;  1DF0 A;  5PAD A;  1PPN A;  2NQD B;  2G6D A;  1ME3 A;  2NQG A;  1QMY A;  3IV2 A;  3S3Q A;  2ATO A;  3K8U A;  1TL9 A;  4N8W A;  1F2C A;  1PCI A;  3RVW A;  3HWN A;  2NQI A;  8PCH A;  4N4Z A;  2E02 A;  3KSE A;  3K24 A;  1YVB A;  1S4V A;  4PI3 A;  3PNR A;  4BS6 A;  2R9C A;  1EF7 A;  2FO5 A;  3BCN A;  4P6G A;  1KFU L;  4QRX A;  1Y4H A;  2AYN A;  3F5V A;  3H8B A;  2FRA A;  1KFX L;  4CDF B;  4QH6 A;  2AYO A;  4YYS A;  4I04 A;  1ATK A;  2DCD A;  1X9Y A;  3KW9 A;  4I05 A;  2R6N A;  3WXG A;  1PBH A;  4I07 A;  2C0Y A;  4YYQ A;  3OVX A;  3IUT A;  4MZO A;  1AIM A;  3USV A;  2FT2 A;  3KX1 A;  4YYR A;  4XUI A;  2DC8 A;  3M99 A;  4W4U A;  2G8J A;  3PW3 A;  2DJF B;  1MS6 A;  1AEC A;  4PP2 E;  2PNS A;  4X6H A;  1XKG A;  1Q6K A;  3V6E A;  3O1G A;  2P7U A;  2OP3 A;  4ZUX U;  5J94 A;  3HD3 A;  3I3T A;  3N3G A;  3KKU A;  1VJV A;  2PAD A;  2R9F A;  4Q8H A;  5A24 A;  3OVZ A;  3OF8 A;  1BQI A;  3P5U A;  4BS5 A;  2IBI A;  2F7D A;  2CB5 A;  4YYV A;  1M6D A;  3IOQ A;  3CH2 X;  3NHE A;  1POP A;  4PAD A;  5EGW A;  1ITO A; 
#chains in the Genus database with same CATH topology
 2Z84 A;  1GCB A;  1NQC A;  4PP1 A;  2E01 A;  1NLJ A;  3PHW A;  4FJC A;  1MHW A;  3HHI A;  2J7Q C;  1EWP A;  3IEJ A;  3DF0 A;  3ZUA A;  5JH3 A;  4BOZ A;  2YJC A;  1YAL A;  3IHP A;  3P5X A;  2VHS A;  7PCK A;  4BOQ A;  1THE A;  4OW0 A;  2AVW A;  3PRM A;  3RVV A;  1F2A A;  2DZY A;  2HD5 A;  3OIS A;  5E6J A;  1CSB B;  2ARY A;  2NQA A;  2B1M A;  2E03 A;  1VSN A;  1CPJ A;  2H7J A;  3CBK A;  4RF0 A;  6PAD A;  4K7C A;  4KLB A;  3PSE A;  5CHT A;  4D8I A;  3H89 A;  2GHU A;  2OUL A;  4HXD B;  4Q8G A;  3PRP A;  3BC3 A;  2P0R A;  3QT4 A;  2G8E A;  3BWK A;  4HWY A;  2WBF X;  5F02 A;  3IFU A;  4BOS A;  3RVX A;  1ME4 A;  1BP4 A;  1JQP A;  5CVO B;  3HHA A;  4BSQ A;  2J7Q A;  2XU1 A;  5EZS A;  1AU4 A;  5CVM A;  1TU6 A;  2BDL A;  3MHS A;  1KHP A;  1HUC B;  4YYU A;  1NB5 A;  4BOP A;  3RNV A;  2DCB A;  1CVZ A;  4BPV A;  4RKX A;  3V6C A;  4IUM A;  1DEU A;  2DZZ A;  2IPP B;  2JQF R;  3TMP A;  1NL6 A;  2AIM A;  4G54 A;  1PIP A;  1EWO A;  2B1N A;  3MHH A;  2Y6E A;  4N79 A;  4QRG A;  1PPO A;  2DC6 A;  1ZIV A;  4MZS A;  2XU3 A;  4P16 A;  1CTE A;  1PAD A;  3C9E A;  4AXL A;  1EWL A;  1TLO A;  4WA6 A;  1F29 A;  2DCC A;  1K3B B;  3N4C A;  2DCA A;  4YYW A;  4CDD B;  1PPP A;  1GLO A;  1MDW A;  4PT5 A;  2DJG B;  1SNK A;  2XU5 A;  3H8C A;  2YJ9 A;  3B21 A;  4A5U A;  2BU3 A;  2FRQ A;  4IP3 A;  3QJ3 A;  3MJ5 A;  3B79 A;  2R9M A;  1NB3 A;  1ZCM A;  4CDE B;  3MOR A;  1NPZ A;  3CH3 X;  4YVA A;  3O0U A;  4BQV A;  2HH5 A;  2FUD A;  3KWB X;  1PPD A;  4P6E A;  5CHV A;  2OZ2 A;  4XZX A;  1PE6 A;  2AUX A;  2R9N A;  3D6S A;  1BGO A;  2AS8 A;  1AYU A;  1IWD A;  4RF1 A;  2XU4 A;  3W31 A;  1U9Q X;  3P5V A;  3C0R A;  1AYW A;  3PDF A;  4X6I A;  1CV8 A;  2PBH A;  4MM3 B;  1F2B A;  3OQC A;  3KWZ A;  3PHU A;  3P5W A;  2HWK A;  2FTD A;  4FK5 A;  3BBA A;  2VHF A;  3AI8 A;  4REZ A;  3OF9 A;  4DMY A;  1PXV A;  5K16 A;  1QOL A;  1KXR A;  3KFQ A;  1GMY A;  4RY2 A;  2BTW A;  1Y08 A;  2Y5B A;  1MIR A;  4OEM A;  2DC7 A;  3TNX A;  4CZW A;  1A6R A;  1YK8 A;  2DC9 A;  1YK7 A;  4W5C A;  1SP4 B;  2FYE A;  9PAP A;  2AU1 A;  3K9M A;  4AXM A;  1YZB A;  1MEG A;  3GCB A;  3E1Z B;  1FH0 A;  3O65 A;  5EZQ A;  1EWM A;  3H6S A;  1YT7 A;  1CJL A;  2AUZ A;  3H7D A;  4XR7 A;  2AGA A;  2O6X A;  4FIP A;  2DOS A;  1AU2 A;  3QSD A;  1CB5 A;  4M0W A;  1CQD A;  4X6J A;  4DMX A;  2FQ9 A;  1AU0 A;  4OEL A;  1BY8 A;  3LXS A;  1QDQ A;  3F75 A;  3LFY A;  3WXF A;  3I06 A;  3BY4 A;  3S3R A;  4MI7 A;  1QXP A;  5CVN B;  1U9V A;  4YV8 A;  1U9W A;  3BPF A;  2ACT A;  4CDC B;  1AU3 A;  1MEM A;  3E9S A;  4QBB A;  2YJB A;  2JRI A;  2HXZ A;  4MSX A;  2GFO A;  1GEC E;  1AYV A;  2G7Y A;  2FE8 A;  2UZJ A;  1STF E;  3WXE A;  5JA7 A;  2P86 A;  3MTV A;  4OVZ A;  3BOW A;  2E00 A;  5EF4 A;  3BPM A;  2JQG R;  3IMA A;  4QRV A;  1ICF A;  3CBJ A;  2BTW B;  2YJ2 A;  2R9O A;  3U8E A;  2YJ8 A;  2CIO A;  2BDZ A;  4W5B A;  3ERV A;  3N3K A;  1U5I A;  3MTN A;  1CS8 A;  2HHN A;  2PRE A;  1U9X A;  1KHQ A;  2F1G A;  5FPW A;  3PBH A;  1O0E A;  1DF0 A;  5PAD A;  1PPN A;  2NQD B;  2G6D A;  1ME3 A;  2NQG A;  1QMY A;  3IV2 A;  3S3Q A;  2ATO A;  3K8U A;  1TL9 A;  4BOU A;  4N8W A;  1F2C A;  1PCI A;  3RVW A;  3HWN A;  2NQI A;  1DKI A;  8PCH A;  4N4Z A;  3W30 A;  2E02 A;  3KSE A;  4ZTB A;  3K24 A;  1YVB A;  3PHX A;  1S4V A;  4PI3 A;  3PNR A;  4BS6 A;  3BB7 A;  2R9C A;  1EF7 A;  2FO5 A;  3BCN A;  4P6G A;  3ZNH A;  1KFU L;  4QRX A;  1Y4H A;  2AYN A;  3F5V A;  3H8B A;  2FRA A;  1KFX L;  4CDF B;  4QH6 A;  2AYO A;  4YYS A;  4I04 A;  1ATK A;  2DCD A;  3PT2 A;  1X9Y A;  3TRK A;  4D8B A;  3KW9 A;  4I05 A;  2R6N A;  2JTC A;  3WXG A;  1PBH A;  4WUR A;  4I07 A;  2C0Y A;  4YYQ A;  3OVX A;  3IUT A;  4OVZ B;  4MZO A;  1AIM A;  3USV A;  2FT2 A;  3KX1 A;  4YYR A;  4XUI A;  2DC8 A;  3M99 A;  4W4U A;  2G8J A;  3PW3 A;  1UKF A;  2DJF B;  1MS6 A;  1AEC A;  4PP2 E;  2PNS A;  5JZE A;  4RNA A;  4X6H A;  4D8E A;  1XKG A;  1Q6K A;  3V6E A;  3O1G A;  2P7U A;  2OP3 A;  4ZUX U;  5J94 A;  3HD3 A;  3I3T A;  3N3G A;  3KKU A;  1VJV A;  4GUA A;  2PAD A;  2R9F A;  4Q8H A;  5A24 A;  3OVZ A;  3OF8 A;  3MP2 A;  1BQI A;  3P5U A;  4BS5 A;  5KO3 A;  2IBI A;  2F7D A;  2CB5 A;  1PVJ A;  4YYV A;  1M6D A;  3IOQ A;  3CH2 X;  3NHE A;  4R3D A;  1POP A;  4PAD A;  5EGW A;  1ITO A; 
#chains in the Genus database with same CATH homology
 1GCB A;  1NQC A;  4PP1 A;  2E01 A;  1NLJ A;  4FJC A;  1MHW A;  3HHI A;  1EWP A;  3IEJ A;  3DF0 A;  3ZUA A;  5JH3 A;  2YJC A;  1YAL A;  3IHP A;  3P5X A;  2VHS A;  7PCK A;  1THE A;  2AVW A;  3RVV A;  1F2A A;  2DZY A;  2HD5 A;  3OIS A;  1CSB B;  2ARY A;  2NQA A;  2B1M A;  2E03 A;  1VSN A;  1CPJ A;  2H7J A;  3CBK A;  6PAD A;  4K7C A;  4KLB A;  5CHT A;  3H89 A;  2GHU A;  2OUL A;  4Q8G A;  3BC3 A;  2P0R A;  3QT4 A;  2G8E A;  3BWK A;  4HWY A;  2WBF X;  5F02 A;  3RVX A;  1ME4 A;  1BP4 A;  1JQP A;  5CVO B;  3HHA A;  4BSQ A;  2XU1 A;  1AU4 A;  5CVM A;  1E2T A;  1TU6 A;  2BDL A;  3MHS A;  1KHP A;  1HUC B;  4YYU A;  1NB5 A;  2DCB A;  1CVZ A;  4BPV A;  3V6C A;  1DEU A;  2DZZ A;  2IPP B;  2JQF R;  1NL6 A;  2AIM A;  4G54 A;  1PIP A;  1EWO A;  2B1N A;  3MHH A;  4B55 A;  2Y6E A;  4N79 A;  4QRG A;  1PPO A;  2DC6 A;  1ZIV A;  4MZS A;  1W4T A;  2XU3 A;  1CTE A;  1PAD A;  3C9E A;  4AXL A;  1EWL A;  1TLO A;  4WA6 A;  1F29 A;  2DCC A;  1K3B B;  3N4C A;  2DCA A;  2BSZ A;  4YYW A;  4CDD B;  1PPP A;  1GLO A;  1MDW A;  2DJG B;  1SNK A;  2XU5 A;  3H8C A;  2YJ9 A;  2FRQ A;  3QJ3 A;  3B79 A;  2R9M A;  1NB3 A;  1ZCM A;  4CDE B;  3MOR A;  1NPZ A;  3CH3 X;  4YVA A;  3O0U A;  4BQV A;  2HH5 A;  2FUD A;  3KWB X;  1PPD A;  4P6E A;  5CHV A;  2OZ2 A;  1PE6 A;  2AUX A;  2R9N A;  3D6S A;  1BGO A;  3LTW A;  2AS8 A;  1AYU A;  1IWD A;  2XU4 A;  1U9Q X;  3P5V A;  1AYW A;  3PDF A;  4X6I A;  1CV8 A;  2PBH A;  1F2B A;  3KWZ A;  3P5W A;  2FTD A;  4FK5 A;  2VHF A;  3AI8 A;  3OF9 A;  4DMY A;  1PXV A;  5K16 A;  1QOL A;  1KXR A;  3KFQ A;  1GMY A;  4RY2 A;  1Y08 A;  2Y5B A;  1MIR A;  4OEM A;  2DC7 A;  3TNX A;  4CZW A;  1A6R A;  1YK8 A;  2DC9 A;  1YK7 A;  4W5C A;  1SP4 B;  4GUZ A;  2FYE A;  9PAP A;  2AU1 A;  3K9M A;  4AXM A;  1MEG A;  2VFC A;  3GCB A;  3E1Z B;  1FH0 A;  1EWM A;  3H6S A;  1YT7 A;  1CJL A;  2AUZ A;  3H7D A;  4XR7 A;  2O6X A;  4FIP A;  1AU2 A;  3QSD A;  1CB5 A;  1W5R A;  1CQD A;  4X6J A;  4DMX A;  2FQ9 A;  1AU0 A;  4OEL A;  1BY8 A;  3LXS A;  1QDQ A;  3F75 A;  3LFY A;  3WXF A;  3I06 A;  3S3R A;  1QXP A;  3D9W A;  5CVN B;  1U9V A;  4YV8 A;  1U9W A;  3BPF A;  2ACT A;  4CDC B;  1AU3 A;  4BGF A;  1MEM A;  4QBB A;  2YJB A;  2HXZ A;  4MSX A;  2GFO A;  1GEC E;  1AYV A;  2G7Y A;  1W6F A;  1STF E;  3WXE A;  5JA7 A;  2P86 A;  3BOW A;  2E00 A;  5EF4 A;  3BPM A;  2JQG R;  3IMA A;  4QRV A;  1ICF A;  3CBJ A;  2YJ2 A;  2R9O A;  3U8E A;  2YJ8 A;  2CIO A;  2BDZ A;  4W5B A;  3ERV A;  3N3K A;  1U5I A;  3MTN A;  1CS8 A;  2HHN A;  2PRE A;  1U9X A;  1KHQ A;  2F1G A;  5FPW A;  3PBH A;  1O0E A;  1DF0 A;  5PAD A;  1PPN A;  4NV7 A;  2NQD B;  2G6D A;  1ME3 A;  2NQG A;  1QMY A;  3IV2 A;  3S3Q A;  2ATO A;  2VFB A;  3K8U A;  1TL9 A;  4N8W A;  1F2C A;  1PCI A;  3RVW A;  3HWN A;  2NQI A;  8PCH A;  4N4Z A;  2E02 A;  3KSE A;  3K24 A;  1YVB A;  1S4V A;  4PI3 A;  3PNR A;  4BS6 A;  2R9C A;  1EF7 A;  2FO5 A;  3BCN A;  4P6G A;  1KFU L;  4QRX A;  1Y4H A;  2AYN A;  3F5V A;  3H8B A;  2FRA A;  1KFX L;  4CDF B;  4QH6 A;  2AYO A;  4YYS A;  4I04 A;  1ATK A;  2DCD A;  1X9Y A;  3KW9 A;  4I05 A;  2R6N A;  3WXG A;  1PBH A;  4I07 A;  2C0Y A;  4YYQ A;  3OVX A;  3IUT A;  4MZO A;  1AIM A;  3USV A;  2FT2 A;  3KX1 A;  4YYR A;  4XUI A;  2DC8 A;  3M99 A;  4W4U A;  2G8J A;  4NV8 A;  3PW3 A;  2DJF B;  1MS6 A;  1AEC A;  4PP2 E;  2PNS A;  4X6H A;  1XKG A;  1Q6K A;  3V6E A;  4C5P A;  3O1G A;  2P7U A;  2OP3 A;  4ZUX U;  5J94 A;  3HD3 A;  3I3T A;  3N3G A;  3KKU A;  1VJV A;  2PAD A;  2R9F A;  4Q8H A;  5A24 A;  3OVZ A;  3OF8 A;  1BQI A;  3P5U A;  4BS5 A;  2IBI A;  2F7D A;  2CB5 A;  4YYV A;  1M6D A;  3IOQ A;  3CH2 X;  3NHE A;  1GX3 A;  1POP A;  4PAD A;  5EGW A;  1ITO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...