3KKUA

Cruzain in complex with a non-covalent ligand
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
215
structure length
214
Chain Sequence
APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQLDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complementarity between a docking and a high-throughput screen in discovering new cruzain inhibitors.
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Hydrolase
molecule keywords Cruzipain
total genus 70
structure length 214
sequence length 215
ec nomenclature ec 3.4.22.51: Cruzipain.
pdb deposition date 2009-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3kkuA00
1TL9A 2JQFR 1QXPA 3KWZA 1CB5A 1ICFA 4X6HA 1DF0A 2FO5A 2PNSA 1CSBB 2NQDB 4MZSA 2YJCA 2E00A 4W5CA 4N8WA 4MSXA 1F29A 1M6DA 3K9MA 3BWKA 4I05A 3N3KA 1F2BA 1AYWA 4K7CA 4N79A 1YK8A 3CH3X 1NPZA 4W4UA 1CQDA 4BS6A 2R9FA 1ITOA 5CVMA 3HD3A 4YYRA 3V6CA 3DF0A 3KW9A 1A6RA 1POPA 3P5VA 1AECA 2HH5A 1U9XA 2YJ2A 4G54A 4ZUXU 1S4VA 2VHFA 2FQ9A 3C9EA 4CZWA 3KWBX 1NLJA 3CH2X 3KKUA 1VJVA 1PPOA 2ACTA 3IUTA 3TNXA 2Y6EA 2P86A 3I06A 6PADA 2AYOA 4CDEB 3RVWA 1EWLA 1QOLA 2FRAA 1JQPA 2FUDA 4AXMA 5F02A 1YT7A 1X9YA 1HUCB 1QDQA 1MIRA 2XU5A 1Y08A 2IPPB 2B1NA 1SP4B 5J94A 4XUIA 3H6SA 2ATOA 3IMAA 3HHIA 4P6EA 4BQVA 3I3TA 4I04A 3RVVA 2XU1A 3F75A 2XU4A 3QJ3A 3D6SA 1GCBA 2YJBA 4BPVA 5FPWA 2DCBA 5A24A 4OEMA 3PDFA 2FTDA 3S3RA 3KFQA 3E1ZB 3AI8A 4OELA 1PIPA 1CPJA 3KSEA 3P5UA 5CHTA 1PPDA 5PADA 1O0EA 5EF4A 2DC7A 1IWDA 1SNKA 3USVA 2E01A 3OF9A 2R9MA 2DC6A 2F1GA 1MS6A 1AU3A 2Y5BA 1PXVA 7PCKA 2DCCA 1MEMA 4AXLA 1CTEA 1AYVA 4QH6A 4I07A 3CBKA 5JA7A 4QRXA 4WA6A 2DC8A 2H7JA 2NQIA 1KFXL 1YALA 4CDCB 2WBFX 2DZZA 3LXSA 3H7DA 9PAPA 4RY2A 2HHNA 3N4CA 4YYQA 4YYWA 3PW3A 2ARYA 2VHSA 2G8EA 3MHHA 2AUZA 5CVNB 3H8CA 2PADA 1DEUA 3BC3A 2E02A 1CJLA 1ZCMA 2XU3A 1KFUL 3O0UA 1GMYA 1GECE 4QRGA 4X6JA 4CDDB 1BGOA 3WXGA 2P7UA 1YVBA 8PCHA 2IBIA 2DCAA 1THEA 1PCIA 2YJ8A 3O1GA 1ATKA 1Y4HA 2F7DA 1QMYA 1CS8A 4YYUA 1KXRA 3BCNA 1PPPA 2DJGB 3IHPA 1GLOA 4YYSA 3K24A 3HWNA 2HXZA 1PE6A 5CVOB 4PADA 2FYEA 1U5IA 4PP1A 1EWPA 5K16A 1EF7A 3P5WA 1STFE 3BPMA 3LFYA 1KHPA 2AUXA 2BDZA 2P0RA 3F5VA 2DC9A 4PI3A 2E03A 4N4ZA 3BOWA 3MORA 2AIMA 1VSNA 1TU6A 2G7YA 2G6DA 3M99A 1AU0A 1BQIA 1ME4A 2R9NA 2OULA 3H89A 4CDFB 2R6NA 1ZIVA 1KHQA 5JH3A 2NQGA 1NB5A 3MHSA 1PADA 4KLBA 1EWOA 1AYUA 1Q6KA 3N3GA 2DCDA 2AYNA 1AU2A 3QSDA 4P6GA 1F2CA 4DMYA 1BY8A 3OF8A 4Q8GA 2GHUA 2PBHA 1PBHA 2CIOA 2JQGR 1AU4A 2AS8A 4YV8A 3B79A 2FT2A 2R9CA 2AU1A 2HD5A 2AVWA 1K3BB 1ME3A 2OZ2A 4FIPA 4MZOA 4YYVA 2C0YA 4XR7A 4X6IA 2NQAA 2YJ9A 3HHAA 3WXFA 2BDLA 2CB5A 2B1MA 2OP3A 1BP4A 3V6EA 3S3QA 1YK7A 1XKGA 3OVZA 3P5XA 4W5BA 1TLOA 3IV2A 3PNRA 2FRQA 3OISA 2G8JA 1MDWA 3WXEA 1PPNA 3U8EA 1CV8A 3PBHA 4YVAA 1NQCA 3QT4A 3H8BA 3OVXA 1MEGA 4QRVA 3RVXA 1AIMA 1MHWA 3IEJA 4FJCA 1NB3A 3NHEA 3K8UA 2DZYA 3IOQA 4QBBA 3CBJA 3GCBA 3KX1A 5CHVA 2PREA 1U9QX 3MTNA 1U9WA 3ZUAA 4BSQA 1FH0A 1NL6A 5EGWA 4DMXA 4PP2E 4BS5A 3BPFA 2DJFB 2R9OA 3ERVA 1EWMA 1F2AA 2GFOA 4FK5A 2O6XA 1U9VA 1CVZA 4Q8HA 4HWYA
chains in the Genus database with same CATH superfamily
1TL9A 2JQFR 1QXPA 3KWZA 1CB5A 1ICFA 4X6HA 1DF0A 4REZA 2FE8A 2FO5A 2PNSA 1CSBB 3PHUA 2NQDB 4MZSA 2YJCA 2E00A 5EZQA 4W5CA 4N8WA 1DKIA 4MSXA 1F29A 1M6DA 3K9MA 3E9SA 3BWKA 4OVZB 4I05A 4D8BA 3N3KA 1F2BA 1AYWA 4K7CA 4N79A 4IP3A 3RNVA 1YK8A 4OW0A 3CH3X 1NPZA 4W4UA 1CQDA 4BS6A 2R9FA 1ITOA 4RF1A 5CVMA 3HD3A 3MJ5A 2Z84A 4YYRA 3V6CA 3DF0A 2BU3A 3KW9A 1A6RA 1POPA 3P5VA 1AECA 2HH5A 1U9XA 2YJ2A 4G54A 4ZUXU 1S4VA 2VHFA 2FQ9A 3C9EA 4CZWA 3KWBX 1NLJA 3CH2X 3KKUA 1VJVA 1PPOA 2ACTA 3PT2A 3IUTA 3TNXA 2Y6EA 1UKFA 2P86A 3I06A 5KO3A 6PADA 2AYOA 4RF0A 4CDEB 3RVWA 1EWLA 1QOLA 2FRAA 3PSEA 4MI7A 1JQPA 2FUDA 4AXMA 5F02A 1YT7A 1X9YA 1HUCB 1QDQA 1YZBA 5EZSA 4D8IA 3MP2A 1MIRA 2XU5A 1Y08A 2IPPB 2B1NA 1SP4B 4XUIA 5J94A 3H6SA 2ATOA 3O65A 3BB7A 3IMAA 4WURA 3HHIA 4P6EA 4BQVA 3I3TA 4I04A 3RVVA 2XU1A 3F75A 2XU4A 3PHWA 3QJ3A 3D6SA 4BOQA 1GCBA 2YJBA 4BPVA 5FPWA 2DCBA 5A24A 4PT5A 4OEMA 3PDFA 2FTDA 3S3RA 3KFQA 3E1ZB 3AI8A 3C0RA 4OELA 1PIPA 1CPJA 3KSEA 3P5UA 5CHTA 1PPDA 5PADA 1O0EA 5EF4A 4XZXA 2DC7A 1IWDA 1SNKA 3USVA 3W31A 2E01A 3OF9A 2R9MA 2DC6A 2F1GA 1MS6A 1AU3A 2Y5BA 3TRKA 4D8EA 1PXVA 3B21A 7PCKA 2DCCA 1MEMA 4AXLA 1CTEA 1AYVA 4QH6A 4I07A 3CBKA 4M0WA 5JA7A 4QRXA 4WA6A 2DC8A 2H7JA 2NQIA 1KFXL 1YALA 4CDCB 2WBFX 2DZZA 3LXSA 4BOZA 3H7DA 9PAPA 4RY2A 2HHNA 3N4CA 4YYQA 4YYWA 3PW3A 2ARYA 2VHSA 2G8EA 3MHHA 2AUZA 5CVNB 3H8CA 2PADA 1DEUA 3BC3A 2E02A 1CJLA 1ZCMA 2XU3A 1KFUL 3O0UA 1GMYA 1GECE 4QRGA 4X6JA 4CDDB 1BGOA 3WXGA 2P7UA 1YVBA 8PCHA 2IBIA 2DCAA 1THEA 1PCIA 2YJ8A 3O1GA 1ATKA 2J7QC 1Y4HA 2F7DA 1QMYA 1CS8A 2BTWB 2J7QA 4YYUA 1KXRA 3BCNA 1PPPA 2DJGB 3IHPA 3BY4A 1GLOA 4YYSA 3K24A 3HWNA 2HXZA 1PE6A 4PADA 4PP1A 2FYEA 1U5IA 5CVOB 1EWPA 5K16A 1EF7A 3P5WA 1STFE 2JTCA 4A5UA 3BPMA 3LFYA 4IUMA 1KHPA 4MM3B 2AUXA 2BDZA 2P0RA 3F5VA 2DC9A 4PI3A 2E03A 4N4ZA 3BOWA 3MORA 2AIMA 1VSNA 4HXDB 1TU6A 4BOUA 2G7YA 2G6DA 3M99A 1AU0A 1BQIA 1ME4A 2R9NA 2OULA 3IFUA 3H89A 4CDFB 2R6NA 5E6JA 1ZIVA 3PHXA 4OVZA 2UZJA 4ZTBA 1KHQA 5JH3A 2DOSA 2NQGA 1NB5A 3MHSA 1PADA 4KLBA 1EWOA 1AYUA 1Q6KA 3N3GA 4GUAA 2DCDA 4RNAA 4P16A 2BTWA 2AYNA 1AU2A 3QSDA 4P6GA 1F2CA 4DMYA 1BY8A 3OF8A 4Q8GA 2GHUA 2PBHA 2HWKA 1PBHA 2CIOA 2JQGR 1AU4A 2AS8A 4YV8A 3B79A 2FT2A 3PRPA 2R9CA 2AU1A 3ZNHA 2HD5A 2AVWA 1K3BB 3BBAA 1ME3A 2OZ2A 3PRMA 4FIPA 4RKXA 4MZOA 4YYVA 2C0YA 4R3DA 4BOSA 4XR7A 2JRIA 4X6IA 2NQAA 2YJ9A 3HHAA 3OQCA 3WXFA 2BDLA 2CB5A 3W30A 2B1MA 2OP3A 1BP4A 3MTVA 3V6EA 3S3QA 1YK7A 1XKGA 3OVZA 3P5XA 4W5BA 1TLOA 3IV2A 3PNRA 2FRQA 2AGAA 3OISA 2G8JA 1MDWA 3WXEA 1PPNA 3U8EA 1CV8A 3PBHA 4YVAA 3QT4A 1NQCA 3H8BA 3OVXA 1MEGA 4QRVA 3RVXA 1AIMA 1MHWA 3IEJA 4FJCA 1NB3A 3NHEA 4BOPA 3K8UA 2DZYA 3IOQA 4QBBA 3CBJA 3GCBA 3TMPA 3KX1A 5CHVA 2PREA 1U9QX 3MTNA 1U9WA 5JZEA 3ZUAA 4BSQA 1FH0A 1NL6A 5EGWA 4DMXA 4PP2E 4BS5A 3BPFA 2DJFB 2R9OA 3ERVA 1EWMA 1F2AA 1PVJA 2GFOA 4FK5A 2O6XA 1U9VA 1CVZA 4Q8HA 4HWYA
chains in the Genus database with same CATH topology
1TL9A 2JQFR 1QXPA 3KWZA 1CB5A 1E2TA 1ICFA 4X6HA 1DF0A 2FO5A 2PNSA 1CSBB 2NQDB 4MZSA 2YJCA 2E00A 4W5CA 4N8WA 4MSXA 1F29A 1M6DA 3K9MA 3BWKA 4I05A 3D9WA 3N3KA 1F2BA 1AYWA 4K7CA 4N79A 1YK8A 3CH3X 1NPZA 4W4UA 1CQDA 4BS6A 2R9FA 1ITOA 5CVMA 3HD3A 4YYRA 3V6CA 3DF0A 3KW9A 4C5PA 1A6RA 1POPA 3P5VA 1AECA 2HH5A 1U9XA 2YJ2A 4G54A 4ZUXU 1S4VA 2VHFA 2FQ9A 3C9EA 4CZWA 3KWBX 1NLJA 3CH2X 3KKUA 1VJVA 1PPOA 2ACTA 3IUTA 3TNXA 2Y6EA 2P86A 3I06A 6PADA 2AYOA 4CDEB 3RVWA 1EWLA 1QOLA 2FRAA 1JQPA 2FUDA 4AXMA 5F02A 1YT7A 1X9YA 1HUCB 1QDQA 1MIRA 2XU5A 1Y08A 2IPPB 2B1NA 1SP4B 5J94A 4XUIA 3H6SA 2ATOA 3IMAA 3HHIA 4P6EA 4BQVA 3I3TA 4I04A 3RVVA 2XU1A 3F75A 2XU4A 3QJ3A 3D6SA 1GCBA 2YJBA 4BPVA 5FPWA 1W5RA 2DCBA 5A24A 4OEMA 3PDFA 2FTDA 3S3RA 3KFQA 3E1ZB 3AI8A 4OELA 1PIPA 1CPJA 3KSEA 3P5UA 5CHTA 1PPDA 5PADA 1O0EA 5EF4A 2DC7A 1IWDA 1SNKA 3USVA 2E01A 3OF9A 2R9MA 2DC6A 2F1GA 1MS6A 1AU3A 2Y5BA 1PXVA 7PCKA 2DCCA 1MEMA 4AXLA 1CTEA 1AYVA 4QH6A 4I07A 3CBKA 5JA7A 4QRXA 4WA6A 4NV8A 2DC8A 2H7JA 2NQIA 1KFXL 1YALA 4CDCB 2WBFX 2DZZA 2VFBA 3LXSA 3H7DA 9PAPA 4RY2A 2HHNA 3N4CA 4YYQA 4YYWA 3PW3A 2ARYA 2VHSA 2G8EA 3MHHA 2AUZA 5CVNB 3H8CA 2PADA 1DEUA 3BC3A 2E02A 1CJLA 1GX3A 1ZCMA 2XU3A 1KFUL 3O0UA 1GMYA 1GECE 4QRGA 4X6JA 4CDDB 1BGOA 3WXGA 2P7UA 1YVBA 4NV7A 8PCHA 2IBIA 2DCAA 1THEA 2BSZA 1PCIA 2YJ8A 3O1GA 1ATKA 1Y4HA 2F7DA 1QMYA 1CS8A 4YYUA 1KXRA 3BCNA 4B55A 1W4TA 1PPPA 2DJGB 3IHPA 2VFCA 1GLOA 4YYSA 3K24A 3HWNA 2HXZA 1PE6A 5CVOB 4PADA 2FYEA 1U5IA 4PP1A 1EWPA 5K16A 1EF7A 3P5WA 1STFE 3BPMA 3LFYA 1KHPA 2AUXA 2BDZA 2P0RA 3F5VA 2DC9A 4PI3A 2E03A 4N4ZA 3BOWA 3MORA 2AIMA 1VSNA 1TU6A 2G7YA 2G6DA 3M99A 1AU0A 1BQIA 1ME4A 2R9NA 2OULA 3H89A 4CDFB 2R6NA 1ZIVA 1KHQA 5JH3A 2NQGA 1NB5A 3MHSA 1PADA 4KLBA 1EWOA 1AYUA 1Q6KA 3N3GA 2DCDA 3LTWA 2AYNA 1AU2A 3QSDA 4P6GA 1F2CA 4DMYA 1BY8A 3OF8A 4Q8GA 2GHUA 2PBHA 1PBHA 2CIOA 2JQGR 1AU4A 2AS8A 4YV8A 3B79A 2FT2A 2R9CA 4BGFA 2AU1A 2HD5A 2AVWA 1K3BB 1ME3A 2OZ2A 4FIPA 4MZOA 4YYVA 2C0YA 4XR7A 4X6IA 2NQAA 2YJ9A 3HHAA 1W6FA 3WXFA 2BDLA 2CB5A 2B1MA 2OP3A 1BP4A 3V6EA 3S3QA 1YK7A 1XKGA 3OVZA 3P5XA 4W5BA 1TLOA 3IV2A 3PNRA 2FRQA 3OISA 2G8JA 1MDWA 3WXEA 1PPNA 3U8EA 1CV8A 3PBHA 4YVAA 1NQCA 3QT4A 3H8BA 3OVXA 1MEGA 4QRVA 3RVXA 1AIMA 1MHWA 3IEJA 4FJCA 1NB3A 3NHEA 3K8UA 4GUZA 2DZYA 3IOQA 4QBBA 3CBJA 3GCBA 3KX1A 5CHVA 2PREA 1U9QX 3MTNA 1U9WA 3ZUAA 4BSQA 1FH0A 1NL6A 5EGWA 4DMXA 4PP2E 4BS5A 3BPFA 2DJFB 2R9OA 3ERVA 1EWMA 1F2AA 2GFOA 4FK5A 2O6XA 1U9VA 1CVZA 4Q8HA 4HWYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TL9 A;  2JQF R;  1QXP A;  3KWZ A;  1CB5 A;  1ICF A;  4X6H A;  1DF0 A;  2FO5 A;  2PNS A;  1CSB B;  2NQD B;  4MZS A;  2YJC A;  2E00 A;  4W5C A;  4N8W A;  4MSX A;  1F29 A;  1M6D A;  3K9M A;  3BWK A;  4I05 A;  3N3K A;  1F2B A;  1AYW A;  4K7C A;  4N79 A;  1YK8 A;  3CH3 X;  1NPZ A;  4W4U A;  1CQD A;  4BS6 A;  2R9F A;  1ITO A;  5CVM A;  3HD3 A;  4YYR A;  3V6C A;  3DF0 A;  3KW9 A;  1A6R A;  1POP A;  3P5V A;  1AEC A;  2HH5 A;  1U9X A;  2YJ2 A;  4G54 A;  4ZUX U;  1S4V A;  2VHF A;  2FQ9 A;  3C9E A;  4CZW A;  3KWB X;  1NLJ A;  3CH2 X;  3KKU A;  1VJV A;  1PPO A;  2ACT A;  3IUT A;  3TNX A;  2Y6E A;  2P86 A;  3I06 A;  6PAD A;  2AYO A;  4CDE B;  3RVW A;  1EWL A;  1QOL A;  2FRA A;  1JQP A;  2FUD A;  4AXM A;  5F02 A;  1YT7 A;  1X9Y A;  1HUC B;  1QDQ A;  1MIR A;  2XU5 A;  1Y08 A;  2IPP B;  2B1N A;  1SP4 B;  5J94 A;  4XUI A;  3H6S A;  2ATO A;  3IMA A;  3HHI A;  4P6E A;  4BQV A;  3I3T A;  4I04 A;  3RVV A;  2XU1 A;  3F75 A;  2XU4 A;  3QJ3 A;  3D6S A;  1GCB A;  2YJB A;  4BPV A;  5FPW A;  2DCB A;  5A24 A;  4OEM A;  3PDF A;  2FTD A;  3S3R A;  3KFQ A;  3E1Z B;  3AI8 A;  4OEL A;  1PIP A;  1CPJ A;  3KSE A;  3P5U A;  5CHT A;  1PPD A;  5PAD A;  1O0E A;  5EF4 A;  2DC7 A;  1IWD A;  1SNK A;  3USV A;  2E01 A;  3OF9 A;  2R9M A;  2DC6 A;  2F1G A;  1MS6 A;  1AU3 A;  2Y5B A;  1PXV A;  7PCK A;  2DCC A;  1MEM A;  4AXL A;  1CTE A;  1AYV A;  4QH6 A;  4I07 A;  3CBK A;  5JA7 A;  4QRX A;  4WA6 A;  2DC8 A;  2H7J A;  2NQI A;  1KFX L;  1YAL A;  4CDC B;  2WBF X;  2DZZ A;  3LXS A;  3H7D A;  9PAP A;  4RY2 A;  2HHN A;  3N4C A;  4YYQ A;  4YYW A;  3PW3 A;  2ARY A;  2VHS A;  2G8E A;  3MHH A;  2AUZ A;  5CVN B;  3H8C A;  2PAD A;  1DEU A;  3BC3 A;  2E02 A;  1CJL A;  1ZCM A;  2XU3 A;  1KFU L;  3O0U A;  1GMY A;  1GEC E;  4QRG A;  4X6J A;  4CDD B;  1BGO A;  3WXG A;  2P7U A;  1YVB A;  8PCH A;  2IBI A;  2DCA A;  1THE A;  1PCI A;  2YJ8 A;  3O1G A;  1ATK A;  1Y4H A;  2F7D A;  1QMY A;  1CS8 A;  4YYU A;  1KXR A;  3BCN A;  1PPP A;  2DJG B;  3IHP A;  1GLO A;  4YYS A;  3K24 A;  3HWN A;  2HXZ A;  1PE6 A;  5CVO B;  4PAD A;  2FYE A;  1U5I A;  4PP1 A;  1EWP A;  5K16 A;  1EF7 A;  3P5W A;  1STF E;  3BPM A;  3LFY A;  1KHP A;  2AUX A;  2BDZ A;  2P0R A;  3F5V A;  2DC9 A;  4PI3 A;  2E03 A;  4N4Z A;  3BOW A;  3MOR A;  2AIM A;  1VSN A;  1TU6 A;  2G7Y A;  2G6D A;  3M99 A;  1AU0 A;  1BQI A;  1ME4 A;  2R9N A;  2OUL A;  3H89 A;  4CDF B;  2R6N A;  1ZIV A;  1KHQ A;  5JH3 A;  2NQG A;  1NB5 A;  3MHS A;  1PAD A;  4KLB A;  1EWO A;  1AYU A;  1Q6K A;  3N3G A;  2DCD A;  2AYN A;  1AU2 A;  3QSD A;  4P6G A;  1F2C A;  4DMY A;  1BY8 A;  3OF8 A;  4Q8G A;  2GHU A;  2PBH A;  1PBH A;  2CIO A;  2JQG R;  1AU4 A;  2AS8 A;  4YV8 A;  3B79 A;  2FT2 A;  2R9C A;  2AU1 A;  2HD5 A;  2AVW A;  1K3B B;  1ME3 A;  2OZ2 A;  4FIP A;  4MZO A;  4YYV A;  2C0Y A;  4XR7 A;  4X6I A;  2NQA A;  2YJ9 A;  3HHA A;  3WXF A;  2BDL A;  2CB5 A;  2B1M A;  2OP3 A;  1BP4 A;  3V6E A;  3S3Q A;  1YK7 A;  1XKG A;  3OVZ A;  3P5X A;  4W5B A;  1TLO A;  3IV2 A;  3PNR A;  2FRQ A;  3OIS A;  2G8J A;  1MDW A;  3WXE A;  1PPN A;  3U8E A;  1CV8 A;  3PBH A;  4YVA A;  1NQC A;  3QT4 A;  3H8B A;  3OVX A;  1MEG A;  4QRV A;  3RVX A;  1AIM A;  1MHW A;  3IEJ A;  4FJC A;  1NB3 A;  3NHE A;  3K8U A;  2DZY A;  3IOQ A;  4QBB A;  3CBJ A;  3GCB A;  3KX1 A;  5CHV A;  2PRE A;  1U9Q X;  3MTN A;  1U9W A;  3ZUA A;  4BSQ A;  1FH0 A;  1NL6 A;  5EGW A;  4DMX A;  4PP2 E;  4BS5 A;  3BPF A;  2DJF B;  2R9O A;  3ERV A;  1EWM A;  1F2A A;  2GFO A;  4FK5 A;  2O6X A;  1U9V A;  1CVZ A;  4Q8H A;  4HWY A; 
#chains in the Genus database with same CATH topology
 1TL9 A;  2JQF R;  1QXP A;  3KWZ A;  1CB5 A;  1ICF A;  4X6H A;  1DF0 A;  4REZ A;  2FE8 A;  2FO5 A;  2PNS A;  1CSB B;  3PHU A;  2NQD B;  4MZS A;  2YJC A;  2E00 A;  5EZQ A;  4W5C A;  4N8W A;  1DKI A;  4MSX A;  1F29 A;  1M6D A;  3K9M A;  3E9S A;  3BWK A;  4OVZ B;  4I05 A;  4D8B A;  3N3K A;  1F2B A;  1AYW A;  4K7C A;  4N79 A;  4IP3 A;  3RNV A;  1YK8 A;  4OW0 A;  3CH3 X;  1NPZ A;  4W4U A;  1CQD A;  4BS6 A;  2R9F A;  1ITO A;  4RF1 A;  5CVM A;  3HD3 A;  3MJ5 A;  2Z84 A;  4YYR A;  3V6C A;  3DF0 A;  2BU3 A;  3KW9 A;  1A6R A;  1POP A;  3P5V A;  1AEC A;  2HH5 A;  1U9X A;  2YJ2 A;  4G54 A;  4ZUX U;  1S4V A;  2VHF A;  2FQ9 A;  3C9E A;  4CZW A;  3KWB X;  1NLJ A;  3CH2 X;  3KKU A;  1VJV A;  1PPO A;  2ACT A;  3PT2 A;  3IUT A;  3TNX A;  2Y6E A;  1UKF A;  2P86 A;  3I06 A;  5KO3 A;  6PAD A;  2AYO A;  4RF0 A;  4CDE B;  3RVW A;  1EWL A;  1QOL A;  2FRA A;  3PSE A;  4MI7 A;  1JQP A;  2FUD A;  4AXM A;  5F02 A;  1YT7 A;  1X9Y A;  1HUC B;  1QDQ A;  1YZB A;  5EZS A;  4D8I A;  3MP2 A;  1MIR A;  2XU5 A;  1Y08 A;  2IPP B;  2B1N A;  1SP4 B;  4XUI A;  5J94 A;  3H6S A;  2ATO A;  3O65 A;  3BB7 A;  3IMA A;  4WUR A;  3HHI A;  4P6E A;  4BQV A;  3I3T A;  4I04 A;  3RVV A;  2XU1 A;  3F75 A;  2XU4 A;  3PHW A;  3QJ3 A;  3D6S A;  4BOQ A;  1GCB A;  2YJB A;  4BPV A;  5FPW A;  2DCB A;  5A24 A;  4PT5 A;  4OEM A;  3PDF A;  2FTD A;  3S3R A;  3KFQ A;  3E1Z B;  3AI8 A;  3C0R A;  4OEL A;  1PIP A;  1CPJ A;  3KSE A;  3P5U A;  5CHT A;  1PPD A;  5PAD A;  1O0E A;  5EF4 A;  4XZX A;  2DC7 A;  1IWD A;  1SNK A;  3USV A;  3W31 A;  2E01 A;  3OF9 A;  2R9M A;  2DC6 A;  2F1G A;  1MS6 A;  1AU3 A;  2Y5B A;  3TRK A;  4D8E A;  1PXV A;  3B21 A;  7PCK A;  2DCC A;  1MEM A;  4AXL A;  1CTE A;  1AYV A;  4QH6 A;  4I07 A;  3CBK A;  4M0W A;  5JA7 A;  4QRX A;  4WA6 A;  2DC8 A;  2H7J A;  2NQI A;  1KFX L;  1YAL A;  4CDC B;  2WBF X;  2DZZ A;  3LXS A;  4BOZ A;  3H7D A;  9PAP A;  4RY2 A;  2HHN A;  3N4C A;  4YYQ A;  4YYW A;  3PW3 A;  2ARY A;  2VHS A;  2G8E A;  3MHH A;  2AUZ A;  5CVN B;  3H8C A;  2PAD A;  1DEU A;  3BC3 A;  2E02 A;  1CJL A;  1ZCM A;  2XU3 A;  1KFU L;  3O0U A;  1GMY A;  1GEC E;  4QRG A;  4X6J A;  4CDD B;  1BGO A;  3WXG A;  2P7U A;  1YVB A;  8PCH A;  2IBI A;  2DCA A;  1THE A;  1PCI A;  2YJ8 A;  3O1G A;  1ATK A;  2J7Q C;  1Y4H A;  2F7D A;  1QMY A;  1CS8 A;  2BTW B;  2J7Q A;  4YYU A;  1KXR A;  3BCN A;  1PPP A;  2DJG B;  3IHP A;  3BY4 A;  1GLO A;  4YYS A;  3K24 A;  3HWN A;  2HXZ A;  1PE6 A;  4PAD A;  4PP1 A;  2FYE A;  1U5I A;  5CVO B;  1EWP A;  5K16 A;  1EF7 A;  3P5W A;  1STF E;  2JTC A;  4A5U A;  3BPM A;  3LFY A;  4IUM A;  1KHP A;  4MM3 B;  2AUX A;  2BDZ A;  2P0R A;  3F5V A;  2DC9 A;  4PI3 A;  2E03 A;  4N4Z A;  3BOW A;  3MOR A;  2AIM A;  1VSN A;  4HXD B;  1TU6 A;  4BOU A;  2G7Y A;  2G6D A;  3M99 A;  1AU0 A;  1BQI A;  1ME4 A;  2R9N A;  2OUL A;  3IFU A;  3H89 A;  4CDF B;  2R6N A;  5E6J A;  1ZIV A;  3PHX A;  4OVZ A;  2UZJ A;  4ZTB A;  1KHQ A;  5JH3 A;  2DOS A;  2NQG A;  1NB5 A;  3MHS A;  1PAD A;  4KLB A;  1EWO A;  1AYU A;  1Q6K A;  3N3G A;  4GUA A;  2DCD A;  4RNA A;  4P16 A;  2BTW A;  2AYN A;  1AU2 A;  3QSD A;  4P6G A;  1F2C A;  4DMY A;  1BY8 A;  3OF8 A;  4Q8G A;  2GHU A;  2PBH A;  2HWK A;  1PBH A;  2CIO A;  2JQG R;  1AU4 A;  2AS8 A;  4YV8 A;  3B79 A;  2FT2 A;  3PRP A;  2R9C A;  2AU1 A;  3ZNH A;  2HD5 A;  2AVW A;  1K3B B;  3BBA A;  1ME3 A;  2OZ2 A;  3PRM A;  4FIP A;  4RKX A;  4MZO A;  4YYV A;  2C0Y A;  4R3D A;  4BOS A;  4XR7 A;  2JRI A;  4X6I A;  2NQA A;  2YJ9 A;  3HHA A;  3OQC A;  3WXF A;  2BDL A;  2CB5 A;  3W30 A;  2B1M A;  2OP3 A;  1BP4 A;  3MTV A;  3V6E A;  3S3Q A;  1YK7 A;  1XKG A;  3OVZ A;  3P5X A;  4W5B A;  1TLO A;  3IV2 A;  3PNR A;  2FRQ A;  2AGA A;  3OIS A;  2G8J A;  1MDW A;  3WXE A;  1PPN A;  3U8E A;  1CV8 A;  3PBH A;  4YVA A;  3QT4 A;  1NQC A;  3H8B A;  3OVX A;  1MEG A;  4QRV A;  3RVX A;  1AIM A;  1MHW A;  3IEJ A;  4FJC A;  1NB3 A;  3NHE A;  4BOP A;  3K8U A;  2DZY A;  3IOQ A;  4QBB A;  3CBJ A;  3GCB A;  3TMP A;  3KX1 A;  5CHV A;  2PRE A;  1U9Q X;  3MTN A;  1U9W A;  5JZE A;  3ZUA A;  4BSQ A;  1FH0 A;  1NL6 A;  5EGW A;  4DMX A;  4PP2 E;  4BS5 A;  3BPF A;  2DJF B;  2R9O A;  3ERV A;  1EWM A;  1F2A A;  1PVJ A;  2GFO A;  4FK5 A;  2O6X A;  1U9V A;  1CVZ A;  4Q8H A;  4HWY A; 
#chains in the Genus database with same CATH homology
 1TL9 A;  2JQF R;  1QXP A;  3KWZ A;  1CB5 A;  1E2T A;  1ICF A;  4X6H A;  1DF0 A;  2FO5 A;  2PNS A;  1CSB B;  2NQD B;  4MZS A;  2YJC A;  2E00 A;  4W5C A;  4N8W A;  4MSX A;  1F29 A;  1M6D A;  3K9M A;  3BWK A;  4I05 A;  3D9W A;  3N3K A;  1F2B A;  1AYW A;  4K7C A;  4N79 A;  1YK8 A;  3CH3 X;  1NPZ A;  4W4U A;  1CQD A;  4BS6 A;  2R9F A;  1ITO A;  5CVM A;  3HD3 A;  4YYR A;  3V6C A;  3DF0 A;  3KW9 A;  4C5P A;  1A6R A;  1POP A;  3P5V A;  1AEC A;  2HH5 A;  1U9X A;  2YJ2 A;  4G54 A;  4ZUX U;  1S4V A;  2VHF A;  2FQ9 A;  3C9E A;  4CZW A;  3KWB X;  1NLJ A;  3CH2 X;  3KKU A;  1VJV A;  1PPO A;  2ACT A;  3IUT A;  3TNX A;  2Y6E A;  2P86 A;  3I06 A;  6PAD A;  2AYO A;  4CDE B;  3RVW A;  1EWL A;  1QOL A;  2FRA A;  1JQP A;  2FUD A;  4AXM A;  5F02 A;  1YT7 A;  1X9Y A;  1HUC B;  1QDQ A;  1MIR A;  2XU5 A;  1Y08 A;  2IPP B;  2B1N A;  1SP4 B;  5J94 A;  4XUI A;  3H6S A;  2ATO A;  3IMA A;  3HHI A;  4P6E A;  4BQV A;  3I3T A;  4I04 A;  3RVV A;  2XU1 A;  3F75 A;  2XU4 A;  3QJ3 A;  3D6S A;  1GCB A;  2YJB A;  4BPV A;  5FPW A;  1W5R A;  2DCB A;  5A24 A;  4OEM A;  3PDF A;  2FTD A;  3S3R A;  3KFQ A;  3E1Z B;  3AI8 A;  4OEL A;  1PIP A;  1CPJ A;  3KSE A;  3P5U A;  5CHT A;  1PPD A;  5PAD A;  1O0E A;  5EF4 A;  2DC7 A;  1IWD A;  1SNK A;  3USV A;  2E01 A;  3OF9 A;  2R9M A;  2DC6 A;  2F1G A;  1MS6 A;  1AU3 A;  2Y5B A;  1PXV A;  7PCK A;  2DCC A;  1MEM A;  4AXL A;  1CTE A;  1AYV A;  4QH6 A;  4I07 A;  3CBK A;  5JA7 A;  4QRX A;  4WA6 A;  4NV8 A;  2DC8 A;  2H7J A;  2NQI A;  1KFX L;  1YAL A;  4CDC B;  2WBF X;  2DZZ A;  2VFB A;  3LXS A;  3H7D A;  9PAP A;  4RY2 A;  2HHN A;  3N4C A;  4YYQ A;  4YYW A;  3PW3 A;  2ARY A;  2VHS A;  2G8E A;  3MHH A;  2AUZ A;  5CVN B;  3H8C A;  2PAD A;  1DEU A;  3BC3 A;  2E02 A;  1CJL A;  1GX3 A;  1ZCM A;  2XU3 A;  1KFU L;  3O0U A;  1GMY A;  1GEC E;  4QRG A;  4X6J A;  4CDD B;  1BGO A;  3WXG A;  2P7U A;  1YVB A;  4NV7 A;  8PCH A;  2IBI A;  2DCA A;  1THE A;  2BSZ A;  1PCI A;  2YJ8 A;  3O1G A;  1ATK A;  1Y4H A;  2F7D A;  1QMY A;  1CS8 A;  4YYU A;  1KXR A;  3BCN A;  4B55 A;  1W4T A;  1PPP A;  2DJG B;  3IHP A;  2VFC A;  1GLO A;  4YYS A;  3K24 A;  3HWN A;  2HXZ A;  1PE6 A;  5CVO B;  4PAD A;  2FYE A;  1U5I A;  4PP1 A;  1EWP A;  5K16 A;  1EF7 A;  3P5W A;  1STF E;  3BPM A;  3LFY A;  1KHP A;  2AUX A;  2BDZ A;  2P0R A;  3F5V A;  2DC9 A;  4PI3 A;  2E03 A;  4N4Z A;  3BOW A;  3MOR A;  2AIM A;  1VSN A;  1TU6 A;  2G7Y A;  2G6D A;  3M99 A;  1AU0 A;  1BQI A;  1ME4 A;  2R9N A;  2OUL A;  3H89 A;  4CDF B;  2R6N A;  1ZIV A;  1KHQ A;  5JH3 A;  2NQG A;  1NB5 A;  3MHS A;  1PAD A;  4KLB A;  1EWO A;  1AYU A;  1Q6K A;  3N3G A;  2DCD A;  3LTW A;  2AYN A;  1AU2 A;  3QSD A;  4P6G A;  1F2C A;  4DMY A;  1BY8 A;  3OF8 A;  4Q8G A;  2GHU A;  2PBH A;  1PBH A;  2CIO A;  2JQG R;  1AU4 A;  2AS8 A;  4YV8 A;  3B79 A;  2FT2 A;  2R9C A;  4BGF A;  2AU1 A;  2HD5 A;  2AVW A;  1K3B B;  1ME3 A;  2OZ2 A;  4FIP A;  4MZO A;  4YYV A;  2C0Y A;  4XR7 A;  4X6I A;  2NQA A;  2YJ9 A;  3HHA A;  1W6F A;  3WXF A;  2BDL A;  2CB5 A;  2B1M A;  2OP3 A;  1BP4 A;  3V6E A;  3S3Q A;  1YK7 A;  1XKG A;  3OVZ A;  3P5X A;  4W5B A;  1TLO A;  3IV2 A;  3PNR A;  2FRQ A;  3OIS A;  2G8J A;  1MDW A;  3WXE A;  1PPN A;  3U8E A;  1CV8 A;  3PBH A;  4YVA A;  1NQC A;  3QT4 A;  3H8B A;  3OVX A;  1MEG A;  4QRV A;  3RVX A;  1AIM A;  1MHW A;  3IEJ A;  4FJC A;  1NB3 A;  3NHE A;  3K8U A;  4GUZ A;  2DZY A;  3IOQ A;  4QBB A;  3CBJ A;  3GCB A;  3KX1 A;  5CHV A;  2PRE A;  1U9Q X;  3MTN A;  1U9W A;  3ZUA A;  4BSQ A;  1FH0 A;  1NL6 A;  5EGW A;  4DMX A;  4PP2 E;  4BS5 A;  3BPF A;  2DJF B;  2R9O A;  3ERV A;  1EWM A;  1F2A A;  2GFO A;  4FK5 A;  2O6X A;  1U9V A;  1CVZ A;  4Q8H A;  4HWY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...