2DCBA

X-ray crystal structure analysis of bovine spleen cathepsin b-ca076 complex
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
253
structure length
251
Chain Sequence
LPESFDAREQWPNCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHSNVNVEVSAEDMLTCCGGECGDGCNGGFPSGAWNFWTKKGLVSGGLYNSHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKTCEPGYSPSYKEDKHFGCSSYSVANNEKEIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVSGEIMGGHAIRILGWGVENGTPYWLVGNSWNTDWGDNGFFKILRGQDHCGIESEIVAGMPCT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CATHEPSIN B
publication title Quantitative estimation of each active subsite of cathepsin B for the inhibitory activity, based on the inhibitory activitybinding mode relationship of a series of epoxysuccinyl inhibitors by X-ray crystal structure analyses of the complexes
rcsb
total genus 78
structure length 251
sequence length 253
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2006-01-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2dcbA00
1F2CA 1PPPA 2P86A 2HXZA 3IEJA 1MHWA 3M99A 1AU4A 3LXSA 3S3RA 4WA6A 3KWBX 1PPNA 2DJFB 1TLOA 3K8UA 2G6DA 1CJLA 1NLJA 4XR7A 2E00A 3HWNA 5FPWA 3KX1A 1U9QX 6PADA 1POPA 4BPVA 1PPDA 4PI3A 3F75A 4W5CA 4YYUA 3H6SA 2DC7A 3PBHA 2YJBA 3AI8A 4DMXA 3MORA 1QMYA 3HD3A 4YYVA 4CDDB 1NB5A 1ITOA 2AIMA 1F29A 2PADA 1CPJA 3MHHA 3KW9A 2R9NA 3O0UA 3BPFA 4QRVA 2IBIA 1PXVA 1YK8A 3KSEA 3H89A 3DF0A 2R6NA 3BPMA 3MHSA 4QBBA 3ZUAA 2OULA 2AYOA 2ARYA 2BDZA 4YVAA 3P5UA 3CH2X 1AECA 5CVMA 1Y08A 3BOWA 4YYSA 3QSDA 4OEMA 4BS5A 1YT7A 2FTDA 1TL9A 2B1MA 5F02A 1AYVA 1CS8A 4PADA 4CZWA 4P6GA 3USVA 9PAPA 4X6JA 2VHFA 4BQVA 3H8BA 4QRXA 4BS6A 4YYWA 3RVVA 2FQ9A 1MS6A 3HHIA 2AUZA 1STFE 4G54A 4DMYA 4YYRA 2R9CA 2P7UA 3K24A 2P0RA 5JH3A 1CV8A 2XU4A 4HWYA 1CB5A 1NB3A 4QRGA 2JQFR 1GCBA 2C0YA 3OF9A 3N3KA 3RVXA 4PP2E 5PADA 3PDFA 1MDWA 3V6EA 1K3BB 1BQIA 1ME3A 4FIPA 2AS8A 1X9YA 3KFQA 4Q8GA 1EWLA 3K9MA 2CB5A 1U9WA 3WXFA 1MEGA 2AU1A 1U9XA 4CDFB 2PBHA 4N79A 1ZIVA 2H7JA 3P5WA 4Q8HA 4P6EA 2ATOA 1ME4A 2E03A 1AYUA 3P5XA 4I05A 4MZSA 5EF4A 1EWOA 4X6HA 2R9FA 2DZYA 3IV2A 1EWPA 2OP3A 5JA7A 3GCBA 1GLOA 2E02A 1VJVA 2DCBA 1PBHA 3N3GA 1ZCMA 1KHPA 1BP4A 1PPOA 4AXMA 4QH6A 1VSNA 1QXPA 7PCKA 1IWDA 2DC6A 1KHQA 5CVNB 4PP1A 3S3QA 1KFUL 1CTEA 2F1GA 3QJ3A 4CDEB 1THEA 2AVWA 2G8JA 2ACTA 1CVZA 3PNRA 2R9MA 3E1ZB 1KXRA 1BGOA 1O0EA 3RVWA 1CQDA 2G7YA 2JQGR 2AYNA 1EWMA 2O6XA 2YJ8A 4I07A 3WXGA 3F5VA 3KWZA 1F2AA 1GECE 1GMYA 2OZ2A 4CDCB 1YVBA 1F2BA 1MIRA 2XU5A 3BCNA 3TNXA 1TU6A 3NHEA 4I04A 2DJGB 5EGWA 1M6DA 3MTNA 1NQCA 2XU1A 3OVZA 2PREA 3C9EA 2G8EA 4N4ZA 2YJ9A 1SNKA 1QDQA 1PCIA 2NQDB 3O1GA 2NQAA 1AYWA 1EF7A 1JQPA 1AU2A 1QOLA 1KFXL 3QT4A 1U5IA 2YJ2A 4FJCA 2DZZA 3CBJA 1DF0A 1FH0A 1XKGA 1SP4B 3U8EA 2CIOA 2FRAA 5CVOB 2B1NA 3CBKA 4FK5A 2GFOA 2F7DA 2NQIA 4W4UA 2FUDA 2GHUA 3I06A 2NQGA 3OVXA 4KLBA 1YALA 3CH3X 1A6RA 1U9VA 3D6SA 3BC3A 4N8WA 2R9OA 1ATKA 3H7DA 2FRQA 1MEMA 2HH5A 5K16A 1S4VA 4YV8A 2FT2A 2DCDA 3BWKA 4W5BA 2BDLA 2WBFX 2FYEA 4XUIA 3OISA 1BY8A 2HHNA 2VHSA 2AUXA 2YJCA 3IOQA 1YK7A 3IMAA 4AXLA 2DC8A 3PW3A 4MSXA 3ERVA 2Y6EA 3KKUA 1DEUA 5CHVA 4K7CA 1AU3A 3HHAA 4RY2A 1Y4HA 3I3TA 3P5VA 4X6IA 1Q6KA 2E01A 5CHTA 1AU0A 1ICFA 3V6CA 1PE6A 2HD5A 3WXEA 4MZOA 3N4CA 2XU3A 1PADA 3OF8A 2FO5A 1NPZA 4BSQA 2DCAA 4OELA 8PCHA 2DCCA 3IUTA 2DC9A 1PIPA 3H8CA 5A24A 2IPPB 3IHPA 1AIMA 4ZUXU 3LFYA 2PNSA 5J94A 1CSBB 1HUCB 4YYQA 3B79A 2Y5BA 1NL6A
chains in the Genus database with same CATH superfamily
1F2CA 1PPPA 2P86A 2HXZA 3IEJA 1MHWA 3M99A 1AU4A 3LXSA 3S3RA 4WA6A 3KWBX 1PPNA 2DJFB 1TLOA 1UKFA 3K8UA 4ZTBA 2G6DA 4OVZA 1CJLA 1NLJA 4RNAA 4XR7A 2E00A 3HWNA 5FPWA 3KX1A 1U9QX 6PADA 3BBAA 1POPA 4BPVA 1PPDA 4PI3A 3F75A 4W5CA 4YYUA 3H6SA 2DC7A 3PBHA 2YJBA 3AI8A 3W31A 4DMXA 4PT5A 3MORA 1QMYA 3HD3A 4YYVA 3O65A 4CDDB 1NB5A 3PT2A 1ITOA 2AIMA 1F29A 4IP3A 2PADA 1CPJA 3PHUA 2Z84A 3MHHA 3KW9A 2R9NA 3O0UA 3BPFA 4QRVA 2IBIA 4RKXA 4D8BA 3BB7A 1PXVA 3RNVA 1YK8A 2BTWA 3KSEA 3H89A 3DF0A 2R6NA 3BPMA 3MHSA 4QBBA 3ZUAA 2OULA 2AYOA 2ARYA 4RF0A 2BDZA 4YVAA 3P5UA 3CH2X 1AECA 5CVMA 1Y08A 3BOWA 4YYSA 3QSDA 4GUAA 4OEMA 3BY4A 4BS5A 1YT7A 2FTDA 1TL9A 2B1MA 5F02A 1AYVA 2J7QC 1CS8A 4PADA 4CZWA 4P6GA 3USVA 9PAPA 4X6JA 5E6JA 3PHXA 2VHFA 4BQVA 3H8BA 4QRXA 4BS6A 4YYWA 3RVVA 2FQ9A 1MS6A 3HHIA 4BOZA 2AUZA 1STFE 4G54A 4DMYA 5KO3A 4YYRA 2R9CA 2P7UA 3K24A 2P0RA 5JH3A 1CV8A 2XU4A 4HWYA 1CB5A 1NB3A 4QRGA 2JQFR 1GCBA 2C0YA 3OF9A 3N3KA 3RVXA 4PP2E 5PADA 3PDFA 1MDWA 3V6EA 3IFUA 1K3BB 1BQIA 1ME3A 4FIPA 3PRPA 2AS8A 4HXDB 1X9YA 3KFQA 4OVZB 4Q8GA 1EWLA 3K9MA 2CB5A 1U9WA 3WXFA 1MEGA 2AU1A 1U9XA 4CDFB 3PRMA 2PBHA 4N79A 1ZIVA 2H7JA 2JTCA 2UZJA 3ZNHA 3P5WA 4Q8HA 4P6EA 2ATOA 1ME4A 2E03A 1AYUA 3P5XA 4BOQA 5JZEA 4I05A 4MZSA 5EF4A 1EWOA 4X6HA 2R9FA 2DZYA 3IV2A 1EWPA 2OP3A 4XZXA 5JA7A 3W30A 3GCBA 1GLOA 2BTWB 2E02A 3E9SA 3PSEA 1VJVA 2DCBA 1PBHA 3N3GA 1ZCMA 1KHPA 1BP4A 3C0RA 1PPOA 4AXMA 2HWKA 4QH6A 4D8IA 2DOSA 1VSNA 1QXPA 4D8EA 7PCKA 3MP2A 1IWDA 2DC6A 1KHQA 5CVNB 4PP1A 4REZA 3S3QA 1KFUL 2J7QA 1CTEA 2F1GA 3QJ3A 4CDEB 1THEA 2AVWA 2G8JA 2ACTA 1CVZA 3PNRA 3B21A 2R9MA 3E1ZB 1KXRA 1BGOA 1O0EA 4M0WA 3RVWA 1CQDA 2G7YA 2JQGR 2AYNA 1EWMA 2O6XA 2YJ8A 4I07A 3WXGA 3F5VA 3KWZA 1F2AA 1GECE 1GMYA 2OZ2A 4CDCB 1YVBA 1F2BA 1MIRA 2XU5A 3BCNA 3TNXA 1TU6A 3NHEA 4IUMA 4I04A 2DJGB 4A5UA 1YZBA 5EGWA 1M6DA 3MTNA 1NQCA 2XU1A 3OVZA 2PREA 3C9EA 2G8EA 5EZQA 4N4ZA 2YJ9A 1SNKA 1QDQA 2AGAA 1PCIA 2NQDB 3O1GA 2NQAA 1AYWA 1EF7A 1JQPA 3PHWA 5EZSA 1AU2A 1QOLA 1KFXL 3QT4A 1U5IA 2YJ2A 4FJCA 4BOUA 2DZZA 3CBJA 1DF0A 1FH0A 1XKGA 4BOPA 1SP4B 3U8EA 2CIOA 2FRAA 5CVOB 2B1NA 3CBKA 4FK5A 2GFOA 2F7DA 2NQIA 3MTVA 4W4UA 4RF1A 2FUDA 2GHUA 3I06A 2NQGA 3OVXA 4KLBA 1YALA 3CH3X 1A6RA 1U9VA 3D6SA 3BC3A 4N8WA 4R3DA 2R9OA 1ATKA 3H7DA 2FRQA 1MEMA 2HH5A 5K16A 1S4VA 4YV8A 2FT2A 2DCDA 3BWKA 4W5BA 2BDLA 2WBFX 2FYEA 4XUIA 3OISA 1BY8A 2HHNA 2VHSA 2AUXA 2YJCA 3TRKA 3IOQA 2BU3A 1YK7A 3IMAA 4AXLA 2DC8A 3PW3A 4MSXA 3ERVA 2Y6EA 3KKUA 1DEUA 5CHVA 4K7CA 2JRIA 1AU3A 3MJ5A 3HHAA 4RY2A 1Y4HA 3I3TA 3P5VA 4X6IA 4OW0A 1Q6KA 2E01A 4BOSA 5CHTA 1AU0A 1ICFA 3V6CA 1PE6A 2HD5A 3TMPA 3WXEA 4MZOA 3N4CA 2XU3A 1PADA 3OF8A 2FO5A 1NPZA 4BSQA 2DCAA 4OELA 2FE8A 8PCHA 4MM3B 1PVJA 2DCCA 3IUTA 1DKIA 2DC9A 1PIPA 3H8CA 5A24A 2IPPB 3IHPA 1AIMA 4ZUXU 3LFYA 2PNSA 5J94A 4MI7A 1CSBB 1HUCB 4WURA 4YYQA 3B79A 2Y5BA 3OQCA 1NL6A 4P16A
chains in the Genus database with same CATH topology
1F2CA 1PPPA 2P86A 2HXZA 3IEJA 1MHWA 3M99A 1W4TA 1AU4A 3LXSA 3S3RA 4WA6A 3KWBX 2VFCA 1PPNA 2DJFB 1TLOA 3K8UA 2G6DA 1CJLA 1NLJA 4XR7A 2E00A 3HWNA 5FPWA 3KX1A 1U9QX 6PADA 1POPA 4BPVA 1PPDA 4PI3A 3F75A 4W5CA 4YYUA 3H6SA 2DC7A 3PBHA 2YJBA 3AI8A 4DMXA 3MORA 1QMYA 3HD3A 4YYVA 4CDDB 1NB5A 1ITOA 2AIMA 1F29A 1W6FA 2PADA 1CPJA 3MHHA 3KW9A 2R9NA 3O0UA 3BPFA 4QRVA 2IBIA 1PXVA 1YK8A 3KSEA 3H89A 3DF0A 2R6NA 3BPMA 3MHSA 4QBBA 3ZUAA 2OULA 2AYOA 2ARYA 2VFBA 2BDZA 4YVAA 3P5UA 3CH2X 1AECA 5CVMA 1Y08A 3BOWA 4YYSA 3QSDA 4OEMA 4BS5A 4NV7A 1YT7A 2FTDA 1TL9A 2B1MA 5F02A 1AYVA 1CS8A 4PADA 4CZWA 4P6GA 3USVA 9PAPA 4X6JA 2VHFA 4BQVA 3H8BA 4QRXA 4BS6A 4YYWA 3RVVA 2FQ9A 1MS6A 3HHIA 2AUZA 1STFE 4G54A 4DMYA 4YYRA 2R9CA 2P7UA 3K24A 2P0RA 5JH3A 1CV8A 2XU4A 4HWYA 1CB5A 1NB3A 4QRGA 2JQFR 1GCBA 2C0YA 3OF9A 3N3KA 3RVXA 4PP2E 5PADA 3PDFA 1MDWA 3V6EA 1K3BB 1BQIA 1ME3A 4FIPA 2AS8A 3D9WA 1X9YA 3KFQA 4Q8GA 1EWLA 3K9MA 2CB5A 1U9WA 3WXFA 1MEGA 2AU1A 1U9XA 4CDFB 2PBHA 4N79A 1ZIVA 2H7JA 3P5WA 4Q8HA 4P6EA 2ATOA 1ME4A 2E03A 1AYUA 3P5XA 4I05A 4MZSA 5EF4A 1EWOA 4X6HA 2R9FA 2DZYA 3IV2A 1EWPA 2OP3A 5JA7A 3GCBA 1GLOA 2E02A 1GX3A 1VJVA 2DCBA 1PBHA 3N3GA 1ZCMA 1KHPA 1W5RA 1BP4A 1PPOA 4AXMA 4GUZA 4QH6A 1VSNA 1QXPA 7PCKA 1IWDA 2DC6A 1KHQA 5CVNB 4PP1A 3S3QA 1KFUL 1CTEA 2F1GA 3QJ3A 4CDEB 1THEA 2AVWA 2G8JA 2ACTA 1CVZA 3PNRA 2R9MA 3E1ZB 1KXRA 1BGOA 1O0EA 3RVWA 1CQDA 2G7YA 2JQGR 2AYNA 1EWMA 2O6XA 2YJ8A 4I07A 3WXGA 3F5VA 3KWZA 1F2AA 1GECE 1GMYA 2OZ2A 4CDCB 1YVBA 1F2BA 1MIRA 2XU5A 3BCNA 3TNXA 1TU6A 3NHEA 4I04A 2DJGB 5EGWA 1M6DA 3MTNA 1NQCA 2XU1A 3OVZA 2PREA 3C9EA 2G8EA 4N4ZA 2YJ9A 1SNKA 1QDQA 4B55A 1PCIA 2NQDB 3O1GA 2NQAA 1E2TA 4NV8A 1AYWA 1EF7A 1JQPA 1AU2A 1QOLA 1KFXL 3QT4A 1U5IA 2YJ2A 4FJCA 2DZZA 3CBJA 1DF0A 1FH0A 1XKGA 1SP4B 3U8EA 2CIOA 2FRAA 5CVOB 2B1NA 3CBKA 4FK5A 2GFOA 2F7DA 2NQIA 4W4UA 4C5PA 2FUDA 2GHUA 3I06A 2NQGA 3OVXA 4KLBA 1YALA 3CH3X 1A6RA 1U9VA 3D6SA 3BC3A 4N8WA 2R9OA 1ATKA 3H7DA 2FRQA 1MEMA 2HH5A 5K16A 1S4VA 4YV8A 2FT2A 2DCDA 3BWKA 4W5BA 2BDLA 2WBFX 2FYEA 4XUIA 3OISA 1BY8A 2HHNA 2VHSA 2AUXA 2YJCA 4BGFA 3IOQA 1YK7A 3IMAA 4AXLA 2DC8A 3PW3A 4MSXA 3ERVA 2Y6EA 3KKUA 1DEUA 5CHVA 4K7CA 1AU3A 3LTWA 3HHAA 4RY2A 1Y4HA 3I3TA 3P5VA 4X6IA 1Q6KA 2E01A 5CHTA 1AU0A 1ICFA 3V6CA 1PE6A 2HD5A 3WXEA 4MZOA 3N4CA 2XU3A 1PADA 3OF8A 2FO5A 1NPZA 4BSQA 2DCAA 2BSZA 4OELA 8PCHA 2DCCA 3IUTA 2DC9A 1PIPA 3H8CA 5A24A 2IPPB 3IHPA 1AIMA 4ZUXU 3LFYA 2PNSA 5J94A 1CSBB 1HUCB 4YYQA 3B79A 2Y5BA 1NL6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F2C A;  1PPP A;  2P86 A;  2HXZ A;  3IEJ A;  1MHW A;  3M99 A;  1AU4 A;  3LXS A;  3S3R A;  4WA6 A;  3KWB X;  1PPN A;  2DJF B;  1TLO A;  3K8U A;  2G6D A;  1CJL A;  1NLJ A;  4XR7 A;  2E00 A;  3HWN A;  5FPW A;  3KX1 A;  1U9Q X;  6PAD A;  1POP A;  4BPV A;  1PPD A;  4PI3 A;  3F75 A;  4W5C A;  4YYU A;  3H6S A;  2DC7 A;  3PBH A;  2YJB A;  3AI8 A;  4DMX A;  3MOR A;  1QMY A;  3HD3 A;  4YYV A;  4CDD B;  1NB5 A;  1ITO A;  2AIM A;  1F29 A;  2PAD A;  1CPJ A;  3MHH A;  3KW9 A;  2R9N A;  3O0U A;  3BPF A;  4QRV A;  2IBI A;  1PXV A;  1YK8 A;  3KSE A;  3H89 A;  3DF0 A;  2R6N A;  3BPM A;  3MHS A;  4QBB A;  3ZUA A;  2OUL A;  2AYO A;  2ARY A;  2BDZ A;  4YVA A;  3P5U A;  3CH2 X;  1AEC A;  5CVM A;  1Y08 A;  3BOW A;  4YYS A;  3QSD A;  4OEM A;  4BS5 A;  1YT7 A;  2FTD A;  1TL9 A;  2B1M A;  5F02 A;  1AYV A;  1CS8 A;  4PAD A;  4CZW A;  4P6G A;  3USV A;  9PAP A;  4X6J A;  2VHF A;  4BQV A;  3H8B A;  4QRX A;  4BS6 A;  4YYW A;  3RVV A;  2FQ9 A;  1MS6 A;  3HHI A;  2AUZ A;  1STF E;  4G54 A;  4DMY A;  4YYR A;  2R9C A;  2P7U A;  3K24 A;  2P0R A;  5JH3 A;  1CV8 A;  2XU4 A;  4HWY A;  1CB5 A;  1NB3 A;  4QRG A;  2JQF R;  1GCB A;  2C0Y A;  3OF9 A;  3N3K A;  3RVX A;  4PP2 E;  5PAD A;  3PDF A;  1MDW A;  3V6E A;  1K3B B;  1BQI A;  1ME3 A;  4FIP A;  2AS8 A;  1X9Y A;  3KFQ A;  4Q8G A;  1EWL A;  3K9M A;  2CB5 A;  1U9W A;  3WXF A;  1MEG A;  2AU1 A;  1U9X A;  4CDF B;  2PBH A;  4N79 A;  1ZIV A;  2H7J A;  3P5W A;  4Q8H A;  4P6E A;  2ATO A;  1ME4 A;  2E03 A;  1AYU A;  3P5X A;  4I05 A;  4MZS A;  5EF4 A;  1EWO A;  4X6H A;  2R9F A;  2DZY A;  3IV2 A;  1EWP A;  2OP3 A;  5JA7 A;  3GCB A;  1GLO A;  2E02 A;  1VJV A;  2DCB A;  1PBH A;  3N3G A;  1ZCM A;  1KHP A;  1BP4 A;  1PPO A;  4AXM A;  4QH6 A;  1VSN A;  1QXP A;  7PCK A;  1IWD A;  2DC6 A;  1KHQ A;  5CVN B;  4PP1 A;  3S3Q A;  1KFU L;  1CTE A;  2F1G A;  3QJ3 A;  4CDE B;  1THE A;  2AVW A;  2G8J A;  2ACT A;  1CVZ A;  3PNR A;  2R9M A;  3E1Z B;  1KXR A;  1BGO A;  1O0E A;  3RVW A;  1CQD A;  2G7Y A;  2JQG R;  2AYN A;  1EWM A;  2O6X A;  2YJ8 A;  4I07 A;  3WXG A;  3F5V A;  3KWZ A;  1F2A A;  1GEC E;  1GMY A;  2OZ2 A;  4CDC B;  1YVB A;  1F2B A;  1MIR A;  2XU5 A;  3BCN A;  3TNX A;  1TU6 A;  3NHE A;  4I04 A;  2DJG B;  5EGW A;  1M6D A;  3MTN A;  1NQC A;  2XU1 A;  3OVZ A;  2PRE A;  3C9E A;  2G8E A;  4N4Z A;  2YJ9 A;  1SNK A;  1QDQ A;  1PCI A;  2NQD B;  3O1G A;  2NQA A;  1AYW A;  1EF7 A;  1JQP A;  1AU2 A;  1QOL A;  1KFX L;  3QT4 A;  1U5I A;  2YJ2 A;  4FJC A;  2DZZ A;  3CBJ A;  1DF0 A;  1FH0 A;  1XKG A;  1SP4 B;  3U8E A;  2CIO A;  2FRA A;  5CVO B;  2B1N A;  3CBK A;  4FK5 A;  2GFO A;  2F7D A;  2NQI A;  4W4U A;  2FUD A;  2GHU A;  3I06 A;  2NQG A;  3OVX A;  4KLB A;  1YAL A;  3CH3 X;  1A6R A;  1U9V A;  3D6S A;  3BC3 A;  4N8W A;  2R9O A;  1ATK A;  3H7D A;  2FRQ A;  1MEM A;  2HH5 A;  5K16 A;  1S4V A;  4YV8 A;  2FT2 A;  2DCD A;  3BWK A;  4W5B A;  2BDL A;  2WBF X;  2FYE A;  4XUI A;  3OIS A;  1BY8 A;  2HHN A;  2VHS A;  2AUX A;  2YJC A;  3IOQ A;  1YK7 A;  3IMA A;  4AXL A;  2DC8 A;  3PW3 A;  4MSX A;  3ERV A;  2Y6E A;  3KKU A;  1DEU A;  5CHV A;  4K7C A;  1AU3 A;  3HHA A;  4RY2 A;  1Y4H A;  3I3T A;  3P5V A;  4X6I A;  1Q6K A;  2E01 A;  5CHT A;  1AU0 A;  1ICF A;  3V6C A;  1PE6 A;  2HD5 A;  3WXE A;  4MZO A;  3N4C A;  2XU3 A;  1PAD A;  3OF8 A;  2FO5 A;  1NPZ A;  4BSQ A;  2DCA A;  4OEL A;  8PCH A;  2DCC A;  3IUT A;  2DC9 A;  1PIP A;  3H8C A;  5A24 A;  2IPP B;  3IHP A;  1AIM A;  4ZUX U;  3LFY A;  2PNS A;  5J94 A;  1CSB B;  1HUC B;  4YYQ A;  3B79 A;  2Y5B A;  1NL6 A; 
#chains in the Genus database with same CATH topology
 1F2C A;  1PPP A;  2P86 A;  2HXZ A;  3IEJ A;  1MHW A;  3M99 A;  1AU4 A;  3LXS A;  3S3R A;  4WA6 A;  3KWB X;  1PPN A;  2DJF B;  1TLO A;  1UKF A;  3K8U A;  4ZTB A;  2G6D A;  4OVZ A;  1CJL A;  1NLJ A;  4RNA A;  4XR7 A;  2E00 A;  3HWN A;  5FPW A;  3KX1 A;  1U9Q X;  6PAD A;  3BBA A;  1POP A;  4BPV A;  1PPD A;  4PI3 A;  3F75 A;  4W5C A;  4YYU A;  3H6S A;  2DC7 A;  3PBH A;  2YJB A;  3AI8 A;  3W31 A;  4DMX A;  4PT5 A;  3MOR A;  1QMY A;  3HD3 A;  4YYV A;  3O65 A;  4CDD B;  1NB5 A;  3PT2 A;  1ITO A;  2AIM A;  1F29 A;  4IP3 A;  2PAD A;  1CPJ A;  3PHU A;  2Z84 A;  3MHH A;  3KW9 A;  2R9N A;  3O0U A;  3BPF A;  4QRV A;  2IBI A;  4RKX A;  4D8B A;  3BB7 A;  1PXV A;  3RNV A;  1YK8 A;  2BTW A;  3KSE A;  3H89 A;  3DF0 A;  2R6N A;  3BPM A;  3MHS A;  4QBB A;  3ZUA A;  2OUL A;  2AYO A;  2ARY A;  4RF0 A;  2BDZ A;  4YVA A;  3P5U A;  3CH2 X;  1AEC A;  5CVM A;  1Y08 A;  3BOW A;  4YYS A;  3QSD A;  4GUA A;  4OEM A;  3BY4 A;  4BS5 A;  1YT7 A;  2FTD A;  1TL9 A;  2B1M A;  5F02 A;  1AYV A;  2J7Q C;  1CS8 A;  4PAD A;  4CZW A;  4P6G A;  3USV A;  9PAP A;  4X6J A;  5E6J A;  3PHX A;  2VHF A;  4BQV A;  3H8B A;  4QRX A;  4BS6 A;  4YYW A;  3RVV A;  2FQ9 A;  1MS6 A;  3HHI A;  4BOZ A;  2AUZ A;  1STF E;  4G54 A;  4DMY A;  5KO3 A;  4YYR A;  2R9C A;  2P7U A;  3K24 A;  2P0R A;  5JH3 A;  1CV8 A;  2XU4 A;  4HWY A;  1CB5 A;  1NB3 A;  4QRG A;  2JQF R;  1GCB A;  2C0Y A;  3OF9 A;  3N3K A;  3RVX A;  4PP2 E;  5PAD A;  3PDF A;  1MDW A;  3V6E A;  3IFU A;  1K3B B;  1BQI A;  1ME3 A;  4FIP A;  3PRP A;  2AS8 A;  4HXD B;  1X9Y A;  3KFQ A;  4OVZ B;  4Q8G A;  1EWL A;  3K9M A;  2CB5 A;  1U9W A;  3WXF A;  1MEG A;  2AU1 A;  1U9X A;  4CDF B;  3PRM A;  2PBH A;  4N79 A;  1ZIV A;  2H7J A;  2JTC A;  2UZJ A;  3ZNH A;  3P5W A;  4Q8H A;  4P6E A;  2ATO A;  1ME4 A;  2E03 A;  1AYU A;  3P5X A;  4BOQ A;  5JZE A;  4I05 A;  4MZS A;  5EF4 A;  1EWO A;  4X6H A;  2R9F A;  2DZY A;  3IV2 A;  1EWP A;  2OP3 A;  4XZX A;  5JA7 A;  3W30 A;  3GCB A;  1GLO A;  2BTW B;  2E02 A;  3E9S A;  3PSE A;  1VJV A;  2DCB A;  1PBH A;  3N3G A;  1ZCM A;  1KHP A;  1BP4 A;  3C0R A;  1PPO A;  4AXM A;  2HWK A;  4QH6 A;  4D8I A;  2DOS A;  1VSN A;  1QXP A;  4D8E A;  7PCK A;  3MP2 A;  1IWD A;  2DC6 A;  1KHQ A;  5CVN B;  4PP1 A;  4REZ A;  3S3Q A;  1KFU L;  2J7Q A;  1CTE A;  2F1G A;  3QJ3 A;  4CDE B;  1THE A;  2AVW A;  2G8J A;  2ACT A;  1CVZ A;  3PNR A;  3B21 A;  2R9M A;  3E1Z B;  1KXR A;  1BGO A;  1O0E A;  4M0W A;  3RVW A;  1CQD A;  2G7Y A;  2JQG R;  2AYN A;  1EWM A;  2O6X A;  2YJ8 A;  4I07 A;  3WXG A;  3F5V A;  3KWZ A;  1F2A A;  1GEC E;  1GMY A;  2OZ2 A;  4CDC B;  1YVB A;  1F2B A;  1MIR A;  2XU5 A;  3BCN A;  3TNX A;  1TU6 A;  3NHE A;  4IUM A;  4I04 A;  2DJG B;  4A5U A;  1YZB A;  5EGW A;  1M6D A;  3MTN A;  1NQC A;  2XU1 A;  3OVZ A;  2PRE A;  3C9E A;  2G8E A;  5EZQ A;  4N4Z A;  2YJ9 A;  1SNK A;  1QDQ A;  2AGA A;  1PCI A;  2NQD B;  3O1G A;  2NQA A;  1AYW A;  1EF7 A;  1JQP A;  3PHW A;  5EZS A;  1AU2 A;  1QOL A;  1KFX L;  3QT4 A;  1U5I A;  2YJ2 A;  4FJC A;  4BOU A;  2DZZ A;  3CBJ A;  1DF0 A;  1FH0 A;  1XKG A;  4BOP A;  1SP4 B;  3U8E A;  2CIO A;  2FRA A;  5CVO B;  2B1N A;  3CBK A;  4FK5 A;  2GFO A;  2F7D A;  2NQI A;  3MTV A;  4W4U A;  4RF1 A;  2FUD A;  2GHU A;  3I06 A;  2NQG A;  3OVX A;  4KLB A;  1YAL A;  3CH3 X;  1A6R A;  1U9V A;  3D6S A;  3BC3 A;  4N8W A;  4R3D A;  2R9O A;  1ATK A;  3H7D A;  2FRQ A;  1MEM A;  2HH5 A;  5K16 A;  1S4V A;  4YV8 A;  2FT2 A;  2DCD A;  3BWK A;  4W5B A;  2BDL A;  2WBF X;  2FYE A;  4XUI A;  3OIS A;  1BY8 A;  2HHN A;  2VHS A;  2AUX A;  2YJC A;  3TRK A;  3IOQ A;  2BU3 A;  1YK7 A;  3IMA A;  4AXL A;  2DC8 A;  3PW3 A;  4MSX A;  3ERV A;  2Y6E A;  3KKU A;  1DEU A;  5CHV A;  4K7C A;  2JRI A;  1AU3 A;  3MJ5 A;  3HHA A;  4RY2 A;  1Y4H A;  3I3T A;  3P5V A;  4X6I A;  4OW0 A;  1Q6K A;  2E01 A;  4BOS A;  5CHT A;  1AU0 A;  1ICF A;  3V6C A;  1PE6 A;  2HD5 A;  3TMP A;  3WXE A;  4MZO A;  3N4C A;  2XU3 A;  1PAD A;  3OF8 A;  2FO5 A;  1NPZ A;  4BSQ A;  2DCA A;  4OEL A;  2FE8 A;  8PCH A;  4MM3 B;  1PVJ A;  2DCC A;  3IUT A;  1DKI A;  2DC9 A;  1PIP A;  3H8C A;  5A24 A;  2IPP B;  3IHP A;  1AIM A;  4ZUX U;  3LFY A;  2PNS A;  5J94 A;  4MI7 A;  1CSB B;  1HUC B;  4WUR A;  4YYQ A;  3B79 A;  2Y5B A;  3OQC A;  1NL6 A;  4P16 A; 
#chains in the Genus database with same CATH homology
 1F2C A;  1PPP A;  2P86 A;  2HXZ A;  3IEJ A;  1MHW A;  3M99 A;  1W4T A;  1AU4 A;  3LXS A;  3S3R A;  4WA6 A;  3KWB X;  2VFC A;  1PPN A;  2DJF B;  1TLO A;  3K8U A;  2G6D A;  1CJL A;  1NLJ A;  4XR7 A;  2E00 A;  3HWN A;  5FPW A;  3KX1 A;  1U9Q X;  6PAD A;  1POP A;  4BPV A;  1PPD A;  4PI3 A;  3F75 A;  4W5C A;  4YYU A;  3H6S A;  2DC7 A;  3PBH A;  2YJB A;  3AI8 A;  4DMX A;  3MOR A;  1QMY A;  3HD3 A;  4YYV A;  4CDD B;  1NB5 A;  1ITO A;  2AIM A;  1F29 A;  1W6F A;  2PAD A;  1CPJ A;  3MHH A;  3KW9 A;  2R9N A;  3O0U A;  3BPF A;  4QRV A;  2IBI A;  1PXV A;  1YK8 A;  3KSE A;  3H89 A;  3DF0 A;  2R6N A;  3BPM A;  3MHS A;  4QBB A;  3ZUA A;  2OUL A;  2AYO A;  2ARY A;  2VFB A;  2BDZ A;  4YVA A;  3P5U A;  3CH2 X;  1AEC A;  5CVM A;  1Y08 A;  3BOW A;  4YYS A;  3QSD A;  4OEM A;  4BS5 A;  4NV7 A;  1YT7 A;  2FTD A;  1TL9 A;  2B1M A;  5F02 A;  1AYV A;  1CS8 A;  4PAD A;  4CZW A;  4P6G A;  3USV A;  9PAP A;  4X6J A;  2VHF A;  4BQV A;  3H8B A;  4QRX A;  4BS6 A;  4YYW A;  3RVV A;  2FQ9 A;  1MS6 A;  3HHI A;  2AUZ A;  1STF E;  4G54 A;  4DMY A;  4YYR A;  2R9C A;  2P7U A;  3K24 A;  2P0R A;  5JH3 A;  1CV8 A;  2XU4 A;  4HWY A;  1CB5 A;  1NB3 A;  4QRG A;  2JQF R;  1GCB A;  2C0Y A;  3OF9 A;  3N3K A;  3RVX A;  4PP2 E;  5PAD A;  3PDF A;  1MDW A;  3V6E A;  1K3B B;  1BQI A;  1ME3 A;  4FIP A;  2AS8 A;  3D9W A;  1X9Y A;  3KFQ A;  4Q8G A;  1EWL A;  3K9M A;  2CB5 A;  1U9W A;  3WXF A;  1MEG A;  2AU1 A;  1U9X A;  4CDF B;  2PBH A;  4N79 A;  1ZIV A;  2H7J A;  3P5W A;  4Q8H A;  4P6E A;  2ATO A;  1ME4 A;  2E03 A;  1AYU A;  3P5X A;  4I05 A;  4MZS A;  5EF4 A;  1EWO A;  4X6H A;  2R9F A;  2DZY A;  3IV2 A;  1EWP A;  2OP3 A;  5JA7 A;  3GCB A;  1GLO A;  2E02 A;  1GX3 A;  1VJV A;  2DCB A;  1PBH A;  3N3G A;  1ZCM A;  1KHP A;  1W5R A;  1BP4 A;  1PPO A;  4AXM A;  4GUZ A;  4QH6 A;  1VSN A;  1QXP A;  7PCK A;  1IWD A;  2DC6 A;  1KHQ A;  5CVN B;  4PP1 A;  3S3Q A;  1KFU L;  1CTE A;  2F1G A;  3QJ3 A;  4CDE B;  1THE A;  2AVW A;  2G8J A;  2ACT A;  1CVZ A;  3PNR A;  2R9M A;  3E1Z B;  1KXR A;  1BGO A;  1O0E A;  3RVW A;  1CQD A;  2G7Y A;  2JQG R;  2AYN A;  1EWM A;  2O6X A;  2YJ8 A;  4I07 A;  3WXG A;  3F5V A;  3KWZ A;  1F2A A;  1GEC E;  1GMY A;  2OZ2 A;  4CDC B;  1YVB A;  1F2B A;  1MIR A;  2XU5 A;  3BCN A;  3TNX A;  1TU6 A;  3NHE A;  4I04 A;  2DJG B;  5EGW A;  1M6D A;  3MTN A;  1NQC A;  2XU1 A;  3OVZ A;  2PRE A;  3C9E A;  2G8E A;  4N4Z A;  2YJ9 A;  1SNK A;  1QDQ A;  4B55 A;  1PCI A;  2NQD B;  3O1G A;  2NQA A;  1E2T A;  4NV8 A;  1AYW A;  1EF7 A;  1JQP A;  1AU2 A;  1QOL A;  1KFX L;  3QT4 A;  1U5I A;  2YJ2 A;  4FJC A;  2DZZ A;  3CBJ A;  1DF0 A;  1FH0 A;  1XKG A;  1SP4 B;  3U8E A;  2CIO A;  2FRA A;  5CVO B;  2B1N A;  3CBK A;  4FK5 A;  2GFO A;  2F7D A;  2NQI A;  4W4U A;  4C5P A;  2FUD A;  2GHU A;  3I06 A;  2NQG A;  3OVX A;  4KLB A;  1YAL A;  3CH3 X;  1A6R A;  1U9V A;  3D6S A;  3BC3 A;  4N8W A;  2R9O A;  1ATK A;  3H7D A;  2FRQ A;  1MEM A;  2HH5 A;  5K16 A;  1S4V A;  4YV8 A;  2FT2 A;  2DCD A;  3BWK A;  4W5B A;  2BDL A;  2WBF X;  2FYE A;  4XUI A;  3OIS A;  1BY8 A;  2HHN A;  2VHS A;  2AUX A;  2YJC A;  4BGF A;  3IOQ A;  1YK7 A;  3IMA A;  4AXL A;  2DC8 A;  3PW3 A;  4MSX A;  3ERV A;  2Y6E A;  3KKU A;  1DEU A;  5CHV A;  4K7C A;  1AU3 A;  3LTW A;  3HHA A;  4RY2 A;  1Y4H A;  3I3T A;  3P5V A;  4X6I A;  1Q6K A;  2E01 A;  5CHT A;  1AU0 A;  1ICF A;  3V6C A;  1PE6 A;  2HD5 A;  3WXE A;  4MZO A;  3N4C A;  2XU3 A;  1PAD A;  3OF8 A;  2FO5 A;  1NPZ A;  4BSQ A;  2DCA A;  2BSZ A;  4OEL A;  8PCH A;  2DCC A;  3IUT A;  2DC9 A;  1PIP A;  3H8C A;  5A24 A;  2IPP B;  3IHP A;  1AIM A;  4ZUX U;  3LFY A;  2PNS A;  5J94 A;  1CSB B;  1HUC B;  4YYQ A;  3B79 A;  2Y5B A;  1NL6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...