2DCBA

X-ray crystal structure analysis of bovine spleen cathepsin b-ca076 complex
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
253
structure length
251
Chain Sequence
LPESFDAREQWPNCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHSNVNVEVSAEDMLTCCGGECGDGCNGGFPSGAWNFWTKKGLVSGGLYNSHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKTCEPGYSPSYKEDKHFGCSSYSVANNEKEIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVSGEIMGGHAIRILGWGVENGTPYWLVGNSWNTDWGDNGFFKILRGQDHCGIESEIVAGMPCT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Quantitative estimation of each active subsite of cathepsin B for the inhibitory activity, based on the inhibitory activitybinding mode relationship of a series of epoxysuccinyl inhibitors by X-ray crystal structure analyses of the complexes
rcsb
molecule tags Hydrolase
molecule keywords CATHEPSIN B
total genus 78
structure length 251
sequence length 253
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2006-01-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2dcbA00
1CTEA 1ICFA 1YT7A 3PDFA 1GMYA 1Q6KA 3QSDA 1EWMA 4QRVA 2FRAA 2DCCA 2G6DA 2P0RA 4DMYA 1KFXL 1PCIA 4CDEB 1MS6A 3S3RA 2YJ2A 2FYEA 4BS5A 2NQDB 3E1ZB 2DJGB 3MTNA 3D6SA 1KXRA 2AYNA 5PADA 1CB5A 3IV2A 2C0YA 1AIMA 3V6EA 1PBHA 2PNSA 2B1MA 3LFYA 3KKUA 1U9WA 4MZSA 3QJ3A 1YK8A 2CIOA 3V6CA 4OELA 1PADA 2HXZA 4PADA 3RVXA 4Q8HA 2DZYA 4QH6A 1PPNA 1K3BB 1SNKA 2PREA 3O0UA 4YYVA 2Y6EA 4CZWA 2R9NA 5K16A 2FQ9A 3OISA 4CDFB 2XU1A 1M6DA 1TL9A 3IHPA 4W5CA 1IWDA 3H6SA 3RVWA 4G54A 3KX1A 3U8EA 2FO5A 1ATKA 2BDLA 2FTDA 1Y08A 4N4ZA 4I05A 2O6XA 4BQVA 2R6NA 1DEUA 9PAPA 3I3TA 1JQPA 3C9EA 3P5WA 2R9OA 3QT4A 1PPOA 5CHVA 3PNRA 3KFQA 1ME3A 4XUIA 3ZUAA 2YJCA 2XU5A 1A6RA 1EWPA 3I06A 1KHQA 2R9MA 3NHEA 3F75A 3IMAA 2PBHA 1O0EA 1U9XA 3BCNA 1PIPA 1MHWA 2DC9A 1NL6A 3ERVA 3MHSA 2NQAA 2E02A 2WBFX 2NQGA 1AYWA 1AECA 3RVVA 1QXPA 1U9QX 3CBJA 2JQGR 1PE6A 5JH3A 3S3QA 1YALA 2FT2A 3P5XA 2BDZA 2H7JA 4BPVA 4BSQA 1QMYA 2DJFB 1CV8A 2AUXA 2E03A 4CDDB 1U9VA 3BPMA 2G8JA 4KLBA 4RY2A 3OF8A 3H8CA 2ARYA 3P5UA 1KFUL 3WXGA 2AS8A 3M99A 1CVZA 3N3GA 4YYWA 4N8WA 3OVZA 4QRXA 1NB3A 2AU1A 3AI8A 1EWLA 2AUZA 1NB5A 8PCHA 1HUCB 2DC6A 1EWOA 3F5VA 2HHNA 1XKGA 1FH0A 1TLOA 3OVXA 1MEGA 1F2CA 3HWNA 3TNXA 3H7DA 4K7CA 3K24A 2DZZA 3IOQA 2JQFR 2VHSA 2YJ8A 5J94A 3IEJA 1PXVA 4FK5A 2AIMA 1AYUA 1ME4A 3DF0A 4YVAA 3CH3X 3WXFA 3GCBA 3K9MA 4CDCB 1AU4A 2DCBA 3H8BA 2B1NA 1F29A 2G7YA 5EF4A 2ACTA 4WA6A 4YYSA 5CVNB 3BWKA 4PI3A 5A24A 3CH2X 3KWBX 3B79A 2DC8A 1ZCMA 4HWYA 2YJ9A 1CQDA 4W5BA 2G8EA 4FJCA 2XU4A 2IBIA 4YV8A 3IUTA 1QOLA 3BC3A 2VHFA 3P5VA 3PBHA 4DMXA 1F2AA 2F7DA 4AXLA 1U5IA 2PADA 2ATOA 2FRQA 4FIPA 1YVBA 4X6IA 2DCDA 2AYOA 1AU2A 1KHPA 1BQIA 1STFE 1GCBA 2HH5A 5CHTA 3BPFA 4PP2E 4P6EA 1NPZA 7PCKA 3KW9A 5EGWA 1BP4A 1S4VA 3MORA 1YK7A 4PP1A 2R9FA 3HHIA 4I07A 4QRGA 5CVOB 4I04A 2F1GA 2OZ2A 4AXMA 1MIRA 2E01A 4YYUA 4N79A 6PADA 1EF7A 2AVWA 4MSXA 1POPA 1Y4HA 1BGOA 1MDWA 1X9YA 2DCAA 3HD3A 3N3KA 4P6GA 1THEA 1NLJA 1CS8A 3PW3A 2OULA 3OF9A 2GHUA 1MEMA 4MZOA 3HHAA 1AYVA 3O1GA 1VJVA 2HD5A 2R9CA 2OP3A 2FUDA 4W4UA 4YYRA 3BOWA 5F02A 1GECE 4X6HA 3K8UA 2CB5A 1CPJA 1BY8A 4BS6A 2GFOA 2P86A 1PPDA 3LXSA 1QDQA 1CJLA 3MHHA 2P7UA 3CBKA 3N4CA 4ZUXU 2YJBA 1TU6A 4XR7A 3KSEA 1SP4B 1DF0A 1CSBB 5JA7A 3KWZA 1NQCA 1ZIVA 3USVA 2Y5BA 4OEMA 1F2BA 3H89A 4QBBA 2E00A 2XU3A 4Q8GA 3WXEA 1GLOA 1VSNA 1ITOA 2IPPB 1PPPA 4X6JA 5FPWA 4YYQA 1AU3A 2DC7A 5CVMA 1AU0A 2NQIA
chains in the Genus database with same CATH superfamily
1CTEA 1ICFA 1YT7A 3PDFA 1GMYA 1Q6KA 3QSDA 1EWMA 3PHWA 4QRVA 4HXDB 2FRAA 3PT2A 2DCCA 2G6DA 2P0RA 4DMYA 1KFXL 1PCIA 4CDEB 1MS6A 4P16A 4RNAA 3S3RA 2YJ2A 2FYEA 4BS5A 2NQDB 3E1ZB 2DJGB 2Z84A 3MTNA 4RF1A 3D6SA 1KXRA 2AYNA 5PADA 1CB5A 3IV2A 2C0YA 1AIMA 3PRMA 3V6EA 2AGAA 1PBHA 2PNSA 2BU3A 2B1MA 3LFYA 3KKUA 1U9WA 4MZSA 3QJ3A 1YK8A 1DKIA 2CIOA 3V6CA 4OELA 1PADA 2HXZA 4PADA 3RVXA 4Q8HA 2DZYA 4QH6A 1PPNA 2HWKA 1K3BB 1SNKA 2PREA 2FE8A 3O0UA 4YYVA 2Y6EA 4CZWA 2R9NA 5K16A 4D8BA 2BTWA 2FQ9A 3OISA 4CDFB 2XU1A 1M6DA 1TL9A 3BBAA 3IHPA 4W5CA 1IWDA 3H6SA 3RVWA 4G54A 4OVZB 3KX1A 3U8EA 2FO5A 1ATKA 2BDLA 2FTDA 1Y08A 4N4ZA 4I05A 2O6XA 4BQVA 5EZSA 2R6NA 1DEUA 9PAPA 3I3TA 4REZA 1JQPA 3C9EA 3P5WA 2R9OA 5EZQA 3QT4A 1PPOA 3PSEA 5CHVA 3PNRA 3KFQA 1ME3A 4M0WA 4XUIA 3ZUAA 2YJCA 2XU5A 1A6RA 1EWPA 3I06A 1KHQA 2JRIA 5E6JA 4XZXA 2R9MA 3NHEA 3F75A 3PRPA 3W31A 3IMAA 2PBHA 1O0EA 1U9XA 3BCNA 1PIPA 1MHWA 2DC9A 1NL6A 1UKFA 4BOZA 3ERVA 3MHSA 2NQAA 2E02A 3BB7A 2J7QC 2WBFX 3ZNHA 2UZJA 2NQGA 1AYWA 1AECA 3RVVA 3C0RA 1QXPA 1U9QX 3CBJA 2JQGR 1PE6A 5JH3A 3S3QA 1YALA 2FT2A 3P5XA 2BDZA 4WURA 2H7JA 4BPVA 4BSQA 1QMYA 2DJFB 1CV8A 2AUXA 2E03A 4CDDB 1U9VA 3BPMA 2G8JA 4KLBA 4RF0A 4RY2A 3OF8A 3H8CA 2ARYA 3P5UA 3BY4A 1KFUL 3RNVA 3WXGA 2AS8A 3O65A 4RKXA 3M99A 1CVZA 4BOUA 3N3GA 4YYWA 4N8WA 3OVZA 4QRXA 1NB3A 2AU1A 3AI8A 1EWLA 2AUZA 1NB5A 8PCHA 1HUCB 2DC6A 1EWOA 3F5VA 2HHNA 1XKGA 2J7QA 3PHUA 1FH0A 1TLOA 3OVXA 5JZEA 1MEGA 1F2CA 3HWNA 3TNXA 3H7DA 4K7CA 3K24A 2DZZA 3IOQA 2JQFR 2VHSA 2YJ8A 4OW0A 5J94A 3IEJA 1PXVA 4FK5A 2AIMA 1AYUA 1ME4A 3DF0A 3IFUA 4YVAA 3CH3X 3WXFA 3GCBA 3K9MA 4CDCB 1AU4A 2DCBA 3H8BA 2B1NA 1F29A 2G7YA 5EF4A 3MP2A 2ACTA 4WA6A 4YYSA 5CVNB 3BWKA 4PI3A 5A24A 3CH2X 2DOSA 3B79A 3KWBX 2DC8A 1ZCMA 4HWYA 4MM3B 4R3DA 2YJ9A 1CQDA 4W5BA 2G8EA 4FJCA 2XU4A 2IBIA 4YV8A 4OVZA 3IUTA 1QOLA 3BC3A 2VHFA 3P5VA 4IUMA 3PBHA 4DMXA 1F2AA 2F7DA 4AXLA 1U5IA 2PADA 2ATOA 2BTWB 2FRQA 4FIPA 1YVBA 3MTVA 4X6IA 2DCDA 2AYOA 1AU2A 3TMPA 3W30A 1KHPA 1BQIA 1STFE 1GCBA 2HH5A 5CHTA 3BPFA 4PP2E 4P6EA 3B21A 4MI7A 1YZBA 3TRKA 1NPZA 5KO3A 7PCKA 3KW9A 5EGWA 1BP4A 1S4VA 3MORA 1YK7A 4PP1A 4A5UA 2R9FA 3HHIA 3MJ5A 4I07A 4QRGA 5CVOB 4I04A 2F1GA 2OZ2A 4AXMA 1MIRA 2E01A 3OQCA 4YYUA 4N79A 4GUAA 6PADA 3E9SA 1EF7A 2AVWA 4MSXA 1POPA 1Y4HA 1BGOA 1MDWA 4BOQA 1X9YA 2DCAA 3HD3A 3N3KA 4P6GA 1THEA 1NLJA 1CS8A 3PW3A 2OULA 4MZOA 3OF9A 2GHUA 1MEMA 4IP3A 3HHAA 1AYVA 3O1GA 1VJVA 4PT5A 2HD5A 2R9CA 2OP3A 2FUDA 4W4UA 4YYRA 1PVJA 3BOWA 5F02A 1GECE 4X6HA 3K8UA 2CB5A 2JTCA 1CPJA 1BY8A 4BOPA 4BS6A 2GFOA 2P86A 1PPDA 3LXSA 1QDQA 4BOSA 1CJLA 3MHHA 2P7UA 3CBKA 3N4CA 3PHXA 4ZUXU 2YJBA 1TU6A 4XR7A 3KSEA 1DF0A 1SP4B 1CSBB 5JA7A 3KWZA 1NQCA 4D8EA 1ZIVA 3USVA 2Y5BA 4OEMA 1F2BA 3H89A 4QBBA 2E00A 2XU3A 4Q8GA 3WXEA 1GLOA 1VSNA 1ITOA 2IPPB 1PPPA 4X6JA 5FPWA 4YYQA 4ZTBA 1AU3A 2DC7A 5CVMA 4D8IA 1AU0A 2NQIA
chains in the Genus database with same CATH topology
1CTEA 1ICFA 1YT7A 3PDFA 1GMYA 1Q6KA 3QSDA 1EWMA 4QRVA 2FRAA 2DCCA 2G6DA 2P0RA 2VFCA 4DMYA 1KFXL 1PCIA 4CDEB 1MS6A 3S3RA 2YJ2A 2FYEA 4BS5A 2NQDB 3E1ZB 2DJGB 3MTNA 3D6SA 1KXRA 2AYNA 5PADA 1CB5A 3IV2A 2C0YA 1AIMA 3V6EA 1PBHA 2PNSA 2B1MA 3LFYA 3KKUA 1U9WA 4MZSA 3QJ3A 1YK8A 2CIOA 3V6CA 4OELA 1PADA 2HXZA 4PADA 3RVXA 4Q8HA 2DZYA 4QH6A 1PPNA 1K3BB 1SNKA 2PREA 3O0UA 4YYVA 2Y6EA 4CZWA 2R9NA 5K16A 2FQ9A 3OISA 4CDFB 2XU1A 1M6DA 1TL9A 3IHPA 4W5CA 1IWDA 3H6SA 3RVWA 4G54A 4C5PA 3KX1A 3U8EA 2FO5A 1ATKA 2BDLA 2FTDA 1Y08A 4N4ZA 4I05A 2O6XA 4BQVA 2R6NA 1DEUA 9PAPA 3I3TA 1JQPA 3C9EA 3P5WA 2R9OA 3QT4A 1PPOA 5CHVA 3PNRA 3KFQA 1ME3A 4XUIA 3ZUAA 2YJCA 2XU5A 1A6RA 1EWPA 3I06A 1KHQA 2R9MA 3NHEA 3F75A 3IMAA 2PBHA 1O0EA 1U9XA 3BCNA 1PIPA 1MHWA 2DC9A 1NL6A 4B55A 3ERVA 3MHSA 2NQAA 2E02A 4NV8A 2WBFX 2NQGA 1AYWA 1AECA 3RVVA 1QXPA 1U9QX 3CBJA 2JQGR 1PE6A 5JH3A 3S3QA 1YALA 2FT2A 3P5XA 1W4TA 2BDZA 2H7JA 4BPVA 4BSQA 1QMYA 2DJFB 1CV8A 2AUXA 2E03A 4CDDB 4GUZA 1U9VA 3BPMA 2G8JA 4KLBA 4RY2A 3LTWA 3OF8A 3H8CA 2ARYA 3P5UA 1KFUL 3WXGA 2AS8A 3M99A 1CVZA 3N3GA 4YYWA 4N8WA 3OVZA 4QRXA 1NB3A 2AU1A 3AI8A 1EWLA 2AUZA 1NB5A 8PCHA 1HUCB 2DC6A 1EWOA 3F5VA 2HHNA 1XKGA 1FH0A 1TLOA 3OVXA 1MEGA 1F2CA 3HWNA 3TNXA 3H7DA 4K7CA 3K24A 2DZZA 3IOQA 2JQFR 2VHSA 2YJ8A 5J94A 3IEJA 1PXVA 4FK5A 2AIMA 1AYUA 1E2TA 1ME4A 3DF0A 4YVAA 3CH3X 3WXFA 3GCBA 3K9MA 4CDCB 1AU4A 2DCBA 3H8BA 2B1NA 1F29A 2G7YA 5EF4A 2ACTA 4WA6A 4YYSA 5CVNB 3BWKA 4PI3A 5A24A 3CH2X 1W6FA 3KWBX 3B79A 2DC8A 1ZCMA 4HWYA 2YJ9A 1CQDA 4W5BA 2G8EA 1GX3A 4FJCA 2XU4A 2IBIA 4YV8A 3IUTA 1QOLA 3BC3A 2VHFA 3P5VA 3PBHA 4DMXA 1F2AA 2F7DA 4AXLA 1U5IA 2PADA 2ATOA 2FRQA 4FIPA 1YVBA 4X6IA 2DCDA 2AYOA 1AU2A 1KHPA 1BQIA 1STFE 1GCBA 2HH5A 5CHTA 3BPFA 4PP2E 1W5RA 4P6EA 1NPZA 7PCKA 3KW9A 5EGWA 1BP4A 1S4VA 3MORA 1YK7A 2VFBA 4PP1A 2R9FA 3HHIA 4I07A 4QRGA 5CVOB 4I04A 2F1GA 2OZ2A 4AXMA 1MIRA 2E01A 3D9WA 4NV7A 4YYUA 4N79A 6PADA 1EF7A 2AVWA 4MSXA 1POPA 1Y4HA 1BGOA 1MDWA 1X9YA 2DCAA 3HD3A 3N3KA 4P6GA 1THEA 1NLJA 1CS8A 3PW3A 2OULA 3OF9A 2GHUA 1MEMA 4MZOA 3HHAA 1AYVA 3O1GA 1VJVA 2HD5A 2R9CA 2OP3A 2FUDA 4W4UA 4YYRA 3BOWA 5F02A 1GECE 2BSZA 4X6HA 3K8UA 2CB5A 1CPJA 1BY8A 4BS6A 2GFOA 2P86A 1PPDA 3LXSA 1QDQA 1CJLA 3MHHA 2P7UA 3CBKA 3N4CA 4ZUXU 2YJBA 1TU6A 4XR7A 3KSEA 1DF0A 1SP4B 1CSBB 5JA7A 3KWZA 1NQCA 1ZIVA 3USVA 2Y5BA 4OEMA 1F2BA 3H89A 4QBBA 2E00A 2XU3A 4Q8GA 3WXEA 1GLOA 1VSNA 1ITOA 2IPPB 1PPPA 4X6JA 4BGFA 5FPWA 4YYQA 1AU3A 2DC7A 5CVMA 1AU0A 2NQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CTE A;  1ICF A;  1YT7 A;  3PDF A;  1GMY A;  1Q6K A;  3QSD A;  1EWM A;  4QRV A;  2FRA A;  2DCC A;  2G6D A;  2P0R A;  4DMY A;  1KFX L;  1PCI A;  4CDE B;  1MS6 A;  3S3R A;  2YJ2 A;  2FYE A;  4BS5 A;  2NQD B;  3E1Z B;  2DJG B;  3MTN A;  3D6S A;  1KXR A;  2AYN A;  5PAD A;  1CB5 A;  3IV2 A;  2C0Y A;  1AIM A;  3V6E A;  1PBH A;  2PNS A;  2B1M A;  3LFY A;  3KKU A;  1U9W A;  4MZS A;  3QJ3 A;  1YK8 A;  2CIO A;  3V6C A;  4OEL A;  1PAD A;  2HXZ A;  4PAD A;  3RVX A;  4Q8H A;  2DZY A;  4QH6 A;  1PPN A;  1K3B B;  1SNK A;  2PRE A;  3O0U A;  4YYV A;  2Y6E A;  4CZW A;  2R9N A;  5K16 A;  2FQ9 A;  3OIS A;  4CDF B;  2XU1 A;  1M6D A;  1TL9 A;  3IHP A;  4W5C A;  1IWD A;  3H6S A;  3RVW A;  4G54 A;  3KX1 A;  3U8E A;  2FO5 A;  1ATK A;  2BDL A;  2FTD A;  1Y08 A;  4N4Z A;  4I05 A;  2O6X A;  4BQV A;  2R6N A;  1DEU A;  9PAP A;  3I3T A;  1JQP A;  3C9E A;  3P5W A;  2R9O A;  3QT4 A;  1PPO A;  5CHV A;  3PNR A;  3KFQ A;  1ME3 A;  4XUI A;  3ZUA A;  2YJC A;  2XU5 A;  1A6R A;  1EWP A;  3I06 A;  1KHQ A;  2R9M A;  3NHE A;  3F75 A;  3IMA A;  2PBH A;  1O0E A;  1U9X A;  3BCN A;  1PIP A;  1MHW A;  2DC9 A;  1NL6 A;  3ERV A;  3MHS A;  2NQA A;  2E02 A;  2WBF X;  2NQG A;  1AYW A;  1AEC A;  3RVV A;  1QXP A;  1U9Q X;  3CBJ A;  2JQG R;  1PE6 A;  5JH3 A;  3S3Q A;  1YAL A;  2FT2 A;  3P5X A;  2BDZ A;  2H7J A;  4BPV A;  4BSQ A;  1QMY A;  2DJF B;  1CV8 A;  2AUX A;  2E03 A;  4CDD B;  1U9V A;  3BPM A;  2G8J A;  4KLB A;  4RY2 A;  3OF8 A;  3H8C A;  2ARY A;  3P5U A;  1KFU L;  3WXG A;  2AS8 A;  3M99 A;  1CVZ A;  3N3G A;  4YYW A;  4N8W A;  3OVZ A;  4QRX A;  1NB3 A;  2AU1 A;  3AI8 A;  1EWL A;  2AUZ A;  1NB5 A;  8PCH A;  1HUC B;  2DC6 A;  1EWO A;  3F5V A;  2HHN A;  1XKG A;  1FH0 A;  1TLO A;  3OVX A;  1MEG A;  1F2C A;  3HWN A;  3TNX A;  3H7D A;  4K7C A;  3K24 A;  2DZZ A;  3IOQ A;  2JQF R;  2VHS A;  2YJ8 A;  5J94 A;  3IEJ A;  1PXV A;  4FK5 A;  2AIM A;  1AYU A;  1ME4 A;  3DF0 A;  4YVA A;  3CH3 X;  3WXF A;  3GCB A;  3K9M A;  4CDC B;  1AU4 A;  2DCB A;  3H8B A;  2B1N A;  1F29 A;  2G7Y A;  5EF4 A;  2ACT A;  4WA6 A;  4YYS A;  5CVN B;  3BWK A;  4PI3 A;  5A24 A;  3CH2 X;  3KWB X;  3B79 A;  2DC8 A;  1ZCM A;  4HWY A;  2YJ9 A;  1CQD A;  4W5B A;  2G8E A;  4FJC A;  2XU4 A;  2IBI A;  4YV8 A;  3IUT A;  1QOL A;  3BC3 A;  2VHF A;  3P5V A;  3PBH A;  4DMX A;  1F2A A;  2F7D A;  4AXL A;  1U5I A;  2PAD A;  2ATO A;  2FRQ A;  4FIP A;  1YVB A;  4X6I A;  2DCD A;  2AYO A;  1AU2 A;  1KHP A;  1BQI A;  1STF E;  1GCB A;  2HH5 A;  5CHT A;  3BPF A;  4PP2 E;  4P6E A;  1NPZ A;  7PCK A;  3KW9 A;  5EGW A;  1BP4 A;  1S4V A;  3MOR A;  1YK7 A;  4PP1 A;  2R9F A;  3HHI A;  4I07 A;  4QRG A;  5CVO B;  4I04 A;  2F1G A;  2OZ2 A;  4AXM A;  1MIR A;  2E01 A;  4YYU A;  4N79 A;  6PAD A;  1EF7 A;  2AVW A;  4MSX A;  1POP A;  1Y4H A;  1BGO A;  1MDW A;  1X9Y A;  2DCA A;  3HD3 A;  3N3K A;  4P6G A;  1THE A;  1NLJ A;  1CS8 A;  3PW3 A;  2OUL A;  3OF9 A;  2GHU A;  1MEM A;  4MZO A;  3HHA A;  1AYV A;  3O1G A;  1VJV A;  2HD5 A;  2R9C A;  2OP3 A;  2FUD A;  4W4U A;  4YYR A;  3BOW A;  5F02 A;  1GEC E;  4X6H A;  3K8U A;  2CB5 A;  1CPJ A;  1BY8 A;  4BS6 A;  2GFO A;  2P86 A;  1PPD A;  3LXS A;  1QDQ A;  1CJL A;  3MHH A;  2P7U A;  3CBK A;  3N4C A;  4ZUX U;  2YJB A;  1TU6 A;  4XR7 A;  3KSE A;  1SP4 B;  1DF0 A;  1CSB B;  5JA7 A;  3KWZ A;  1NQC A;  1ZIV A;  3USV A;  2Y5B A;  4OEM A;  1F2B A;  3H89 A;  4QBB A;  2E00 A;  2XU3 A;  4Q8G A;  3WXE A;  1GLO A;  1VSN A;  1ITO A;  2IPP B;  1PPP A;  4X6J A;  5FPW A;  4YYQ A;  1AU3 A;  2DC7 A;  5CVM A;  1AU0 A;  2NQI A; 
#chains in the Genus database with same CATH topology
 1CTE A;  1ICF A;  1YT7 A;  3PDF A;  1GMY A;  1Q6K A;  3QSD A;  1EWM A;  3PHW A;  4QRV A;  4HXD B;  2FRA A;  3PT2 A;  2DCC A;  2G6D A;  2P0R A;  4DMY A;  1KFX L;  1PCI A;  4CDE B;  1MS6 A;  4P16 A;  4RNA A;  3S3R A;  2YJ2 A;  2FYE A;  4BS5 A;  2NQD B;  3E1Z B;  2DJG B;  2Z84 A;  3MTN A;  4RF1 A;  3D6S A;  1KXR A;  2AYN A;  5PAD A;  1CB5 A;  3IV2 A;  2C0Y A;  1AIM A;  3PRM A;  3V6E A;  2AGA A;  1PBH A;  2PNS A;  2BU3 A;  2B1M A;  3LFY A;  3KKU A;  1U9W A;  4MZS A;  3QJ3 A;  1YK8 A;  1DKI A;  2CIO A;  3V6C A;  4OEL A;  1PAD A;  2HXZ A;  4PAD A;  3RVX A;  4Q8H A;  2DZY A;  4QH6 A;  1PPN A;  2HWK A;  1K3B B;  1SNK A;  2PRE A;  2FE8 A;  3O0U A;  4YYV A;  2Y6E A;  4CZW A;  2R9N A;  5K16 A;  4D8B A;  2BTW A;  2FQ9 A;  3OIS A;  4CDF B;  2XU1 A;  1M6D A;  1TL9 A;  3BBA A;  3IHP A;  4W5C A;  1IWD A;  3H6S A;  3RVW A;  4G54 A;  4OVZ B;  3KX1 A;  3U8E A;  2FO5 A;  1ATK A;  2BDL A;  2FTD A;  1Y08 A;  4N4Z A;  4I05 A;  2O6X A;  4BQV A;  5EZS A;  2R6N A;  1DEU A;  9PAP A;  3I3T A;  4REZ A;  1JQP A;  3C9E A;  3P5W A;  2R9O A;  5EZQ A;  3QT4 A;  1PPO A;  3PSE A;  5CHV A;  3PNR A;  3KFQ A;  1ME3 A;  4M0W A;  4XUI A;  3ZUA A;  2YJC A;  2XU5 A;  1A6R A;  1EWP A;  3I06 A;  1KHQ A;  2JRI A;  5E6J A;  4XZX A;  2R9M A;  3NHE A;  3F75 A;  3PRP A;  3W31 A;  3IMA A;  2PBH A;  1O0E A;  1U9X A;  3BCN A;  1PIP A;  1MHW A;  2DC9 A;  1NL6 A;  1UKF A;  4BOZ A;  3ERV A;  3MHS A;  2NQA A;  2E02 A;  3BB7 A;  2J7Q C;  2WBF X;  3ZNH A;  2UZJ A;  2NQG A;  1AYW A;  1AEC A;  3RVV A;  3C0R A;  1QXP A;  1U9Q X;  3CBJ A;  2JQG R;  1PE6 A;  5JH3 A;  3S3Q A;  1YAL A;  2FT2 A;  3P5X A;  2BDZ A;  4WUR A;  2H7J A;  4BPV A;  4BSQ A;  1QMY A;  2DJF B;  1CV8 A;  2AUX A;  2E03 A;  4CDD B;  1U9V A;  3BPM A;  2G8J A;  4KLB A;  4RF0 A;  4RY2 A;  3OF8 A;  3H8C A;  2ARY A;  3P5U A;  3BY4 A;  1KFU L;  3RNV A;  3WXG A;  2AS8 A;  3O65 A;  4RKX A;  3M99 A;  1CVZ A;  4BOU A;  3N3G A;  4YYW A;  4N8W A;  3OVZ A;  4QRX A;  1NB3 A;  2AU1 A;  3AI8 A;  1EWL A;  2AUZ A;  1NB5 A;  8PCH A;  1HUC B;  2DC6 A;  1EWO A;  3F5V A;  2HHN A;  1XKG A;  2J7Q A;  3PHU A;  1FH0 A;  1TLO A;  3OVX A;  5JZE A;  1MEG A;  1F2C A;  3HWN A;  3TNX A;  3H7D A;  4K7C A;  3K24 A;  2DZZ A;  3IOQ A;  2JQF R;  2VHS A;  2YJ8 A;  4OW0 A;  5J94 A;  3IEJ A;  1PXV A;  4FK5 A;  2AIM A;  1AYU A;  1ME4 A;  3DF0 A;  3IFU A;  4YVA A;  3CH3 X;  3WXF A;  3GCB A;  3K9M A;  4CDC B;  1AU4 A;  2DCB A;  3H8B A;  2B1N A;  1F29 A;  2G7Y A;  5EF4 A;  3MP2 A;  2ACT A;  4WA6 A;  4YYS A;  5CVN B;  3BWK A;  4PI3 A;  5A24 A;  3CH2 X;  2DOS A;  3B79 A;  3KWB X;  2DC8 A;  1ZCM A;  4HWY A;  4MM3 B;  4R3D A;  2YJ9 A;  1CQD A;  4W5B A;  2G8E A;  4FJC A;  2XU4 A;  2IBI A;  4YV8 A;  4OVZ A;  3IUT A;  1QOL A;  3BC3 A;  2VHF A;  3P5V A;  4IUM A;  3PBH A;  4DMX A;  1F2A A;  2F7D A;  4AXL A;  1U5I A;  2PAD A;  2ATO A;  2BTW B;  2FRQ A;  4FIP A;  1YVB A;  3MTV A;  4X6I A;  2DCD A;  2AYO A;  1AU2 A;  3TMP A;  3W30 A;  1KHP A;  1BQI A;  1STF E;  1GCB A;  2HH5 A;  5CHT A;  3BPF A;  4PP2 E;  4P6E A;  3B21 A;  4MI7 A;  1YZB A;  3TRK A;  1NPZ A;  5KO3 A;  7PCK A;  3KW9 A;  5EGW A;  1BP4 A;  1S4V A;  3MOR A;  1YK7 A;  4PP1 A;  4A5U A;  2R9F A;  3HHI A;  3MJ5 A;  4I07 A;  4QRG A;  5CVO B;  4I04 A;  2F1G A;  2OZ2 A;  4AXM A;  1MIR A;  2E01 A;  3OQC A;  4YYU A;  4N79 A;  4GUA A;  6PAD A;  3E9S A;  1EF7 A;  2AVW A;  4MSX A;  1POP A;  1Y4H A;  1BGO A;  1MDW A;  4BOQ A;  1X9Y A;  2DCA A;  3HD3 A;  3N3K A;  4P6G A;  1THE A;  1NLJ A;  1CS8 A;  3PW3 A;  2OUL A;  4MZO A;  3OF9 A;  2GHU A;  1MEM A;  4IP3 A;  3HHA A;  1AYV A;  3O1G A;  1VJV A;  4PT5 A;  2HD5 A;  2R9C A;  2OP3 A;  2FUD A;  4W4U A;  4YYR A;  1PVJ A;  3BOW A;  5F02 A;  1GEC E;  4X6H A;  3K8U A;  2CB5 A;  2JTC A;  1CPJ A;  1BY8 A;  4BOP A;  4BS6 A;  2GFO A;  2P86 A;  1PPD A;  3LXS A;  1QDQ A;  4BOS A;  1CJL A;  3MHH A;  2P7U A;  3CBK A;  3N4C A;  3PHX A;  4ZUX U;  2YJB A;  1TU6 A;  4XR7 A;  3KSE A;  1DF0 A;  1SP4 B;  1CSB B;  5JA7 A;  3KWZ A;  1NQC A;  4D8E A;  1ZIV A;  3USV A;  2Y5B A;  4OEM A;  1F2B A;  3H89 A;  4QBB A;  2E00 A;  2XU3 A;  4Q8G A;  3WXE A;  1GLO A;  1VSN A;  1ITO A;  2IPP B;  1PPP A;  4X6J A;  5FPW A;  4YYQ A;  4ZTB A;  1AU3 A;  2DC7 A;  5CVM A;  4D8I A;  1AU0 A;  2NQI A; 
#chains in the Genus database with same CATH homology
 1CTE A;  1ICF A;  1YT7 A;  3PDF A;  1GMY A;  1Q6K A;  3QSD A;  1EWM A;  4QRV A;  2FRA A;  2DCC A;  2G6D A;  2P0R A;  2VFC A;  4DMY A;  1KFX L;  1PCI A;  4CDE B;  1MS6 A;  3S3R A;  2YJ2 A;  2FYE A;  4BS5 A;  2NQD B;  3E1Z B;  2DJG B;  3MTN A;  3D6S A;  1KXR A;  2AYN A;  5PAD A;  1CB5 A;  3IV2 A;  2C0Y A;  1AIM A;  3V6E A;  1PBH A;  2PNS A;  2B1M A;  3LFY A;  3KKU A;  1U9W A;  4MZS A;  3QJ3 A;  1YK8 A;  2CIO A;  3V6C A;  4OEL A;  1PAD A;  2HXZ A;  4PAD A;  3RVX A;  4Q8H A;  2DZY A;  4QH6 A;  1PPN A;  1K3B B;  1SNK A;  2PRE A;  3O0U A;  4YYV A;  2Y6E A;  4CZW A;  2R9N A;  5K16 A;  2FQ9 A;  3OIS A;  4CDF B;  2XU1 A;  1M6D A;  1TL9 A;  3IHP A;  4W5C A;  1IWD A;  3H6S A;  3RVW A;  4G54 A;  4C5P A;  3KX1 A;  3U8E A;  2FO5 A;  1ATK A;  2BDL A;  2FTD A;  1Y08 A;  4N4Z A;  4I05 A;  2O6X A;  4BQV A;  2R6N A;  1DEU A;  9PAP A;  3I3T A;  1JQP A;  3C9E A;  3P5W A;  2R9O A;  3QT4 A;  1PPO A;  5CHV A;  3PNR A;  3KFQ A;  1ME3 A;  4XUI A;  3ZUA A;  2YJC A;  2XU5 A;  1A6R A;  1EWP A;  3I06 A;  1KHQ A;  2R9M A;  3NHE A;  3F75 A;  3IMA A;  2PBH A;  1O0E A;  1U9X A;  3BCN A;  1PIP A;  1MHW A;  2DC9 A;  1NL6 A;  4B55 A;  3ERV A;  3MHS A;  2NQA A;  2E02 A;  4NV8 A;  2WBF X;  2NQG A;  1AYW A;  1AEC A;  3RVV A;  1QXP A;  1U9Q X;  3CBJ A;  2JQG R;  1PE6 A;  5JH3 A;  3S3Q A;  1YAL A;  2FT2 A;  3P5X A;  1W4T A;  2BDZ A;  2H7J A;  4BPV A;  4BSQ A;  1QMY A;  2DJF B;  1CV8 A;  2AUX A;  2E03 A;  4CDD B;  4GUZ A;  1U9V A;  3BPM A;  2G8J A;  4KLB A;  4RY2 A;  3LTW A;  3OF8 A;  3H8C A;  2ARY A;  3P5U A;  1KFU L;  3WXG A;  2AS8 A;  3M99 A;  1CVZ A;  3N3G A;  4YYW A;  4N8W A;  3OVZ A;  4QRX A;  1NB3 A;  2AU1 A;  3AI8 A;  1EWL A;  2AUZ A;  1NB5 A;  8PCH A;  1HUC B;  2DC6 A;  1EWO A;  3F5V A;  2HHN A;  1XKG A;  1FH0 A;  1TLO A;  3OVX A;  1MEG A;  1F2C A;  3HWN A;  3TNX A;  3H7D A;  4K7C A;  3K24 A;  2DZZ A;  3IOQ A;  2JQF R;  2VHS A;  2YJ8 A;  5J94 A;  3IEJ A;  1PXV A;  4FK5 A;  2AIM A;  1AYU A;  1E2T A;  1ME4 A;  3DF0 A;  4YVA A;  3CH3 X;  3WXF A;  3GCB A;  3K9M A;  4CDC B;  1AU4 A;  2DCB A;  3H8B A;  2B1N A;  1F29 A;  2G7Y A;  5EF4 A;  2ACT A;  4WA6 A;  4YYS A;  5CVN B;  3BWK A;  4PI3 A;  5A24 A;  3CH2 X;  1W6F A;  3KWB X;  3B79 A;  2DC8 A;  1ZCM A;  4HWY A;  2YJ9 A;  1CQD A;  4W5B A;  2G8E A;  1GX3 A;  4FJC A;  2XU4 A;  2IBI A;  4YV8 A;  3IUT A;  1QOL A;  3BC3 A;  2VHF A;  3P5V A;  3PBH A;  4DMX A;  1F2A A;  2F7D A;  4AXL A;  1U5I A;  2PAD A;  2ATO A;  2FRQ A;  4FIP A;  1YVB A;  4X6I A;  2DCD A;  2AYO A;  1AU2 A;  1KHP A;  1BQI A;  1STF E;  1GCB A;  2HH5 A;  5CHT A;  3BPF A;  4PP2 E;  1W5R A;  4P6E A;  1NPZ A;  7PCK A;  3KW9 A;  5EGW A;  1BP4 A;  1S4V A;  3MOR A;  1YK7 A;  2VFB A;  4PP1 A;  2R9F A;  3HHI A;  4I07 A;  4QRG A;  5CVO B;  4I04 A;  2F1G A;  2OZ2 A;  4AXM A;  1MIR A;  2E01 A;  3D9W A;  4NV7 A;  4YYU A;  4N79 A;  6PAD A;  1EF7 A;  2AVW A;  4MSX A;  1POP A;  1Y4H A;  1BGO A;  1MDW A;  1X9Y A;  2DCA A;  3HD3 A;  3N3K A;  4P6G A;  1THE A;  1NLJ A;  1CS8 A;  3PW3 A;  2OUL A;  3OF9 A;  2GHU A;  1MEM A;  4MZO A;  3HHA A;  1AYV A;  3O1G A;  1VJV A;  2HD5 A;  2R9C A;  2OP3 A;  2FUD A;  4W4U A;  4YYR A;  3BOW A;  5F02 A;  1GEC E;  2BSZ A;  4X6H A;  3K8U A;  2CB5 A;  1CPJ A;  1BY8 A;  4BS6 A;  2GFO A;  2P86 A;  1PPD A;  3LXS A;  1QDQ A;  1CJL A;  3MHH A;  2P7U A;  3CBK A;  3N4C A;  4ZUX U;  2YJB A;  1TU6 A;  4XR7 A;  3KSE A;  1DF0 A;  1SP4 B;  1CSB B;  5JA7 A;  3KWZ A;  1NQC A;  1ZIV A;  3USV A;  2Y5B A;  4OEM A;  1F2B A;  3H89 A;  4QBB A;  2E00 A;  2XU3 A;  4Q8G A;  3WXE A;  1GLO A;  1VSN A;  1ITO A;  2IPP B;  1PPP A;  4X6J A;  4BGF A;  5FPW A;  4YYQ A;  1AU3 A;  2DC7 A;  5CVM A;  1AU0 A;  2NQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...