3BPFA

Crystal structure of falcipain-2 with its inhibitor, e64
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
241
structure length
236
Chain Sequence
QMNYEEVIKKYRGEENFDHAAYDWRLHSGVTPVKDQKNCGSCWAFSSIGSVESQYAIRKNKLITLSEQELVDCSFKNYGCNGGLINNAFEDMIELGGICPDGDYPYVSDAPNLCNIDRCTEKYGIKNYLSVPDNKLKEALRFLGPISISVAVSDDFAFYKEGIFDGECGDQLNHAVMLVGFGMKEIVNGEKHYYYIIKNSWGQQWGERGFINIETDESGLMRKCGLGTDAFIPLIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cysteine protease falcipain-2
publication title Structures of falcipain-2 and falcipain-3 bound to small molecule inhibitors: implications for substrate specificity.
pubmed doi rcsb
total genus 62
structure length 236
sequence length 241
chains with identical sequence B, C, D
ec nomenclature ec 3.4.22.-:
pdb deposition date 2007-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3bpfA00
4Q8GA 3I06A 1AU0A 3E1ZB 2NQDB 1QOLA 1PPDA 2FYEA 2NQAA 4PP1A 4OELA 1BGOA 4CDCB 3KFQA 1YVBA 1KHPA 1PPOA 1MEGA 3V6CA 3OISA 2ACTA 2OP3A 4CDFB 2WBFX 4CDEB 1BQIA 3BPMA 4DMXA 4P6GA 3U8EA 1SP4B 2G6DA 2F7DA 1YK7A 1ITOA 1AYWA 2H7JA 2P0RA 5FPWA 3B79A 3BC3A 9PAPA 5CVOB 3CH2X 2AIMA 2IBIA 4RY2A 1PADA 4OEMA 3RVWA 2DCBA 3KWZA 1GMYA 1EWPA 4N4ZA 4FJCA 2HH5A 4YYQA 1MIRA 3S3RA 4QH6A 2JQFR 1AIMA 2AU1A 3OF9A 4QRVA 4AXMA 1F2AA 1POPA 1VSNA 2DJGB 2GHUA 3MHHA 2R9MA 2XU3A 2YJ8A 3V6EA 1TU6A 1CS8A 3I3TA 3CBJA 1VJVA 2FTDA 3IMAA 4QRXA 3NHEA 2DCAA 2YJ9A 1A6RA 1AU3A 2GFOA 4YYVA 2XU4A 2HD5A 3KX1A 2E01A 1KHQA 1KXRA 1ZIVA 2FUDA 1AYVA 3BPFA 4G54A 4FIPA 2G8JA 3LFYA 3IUTA 3BOWA 3P5XA 3WXGA 4MZOA 1CPJA 3IV2A 1MS6A 3N3GA 4YYRA 2DCCA 2B1NA 3TNXA 3OVXA 4PP2E 3N4CA 3BCNA 2AUXA 1NQCA 1FH0A 4HWYA 1CQDA 6PADA 3O1GA 2PREA 2NQIA 2CB5A 4YYUA 3P5UA 1AECA 1Q6KA 1NLJA 3IEJA 3WXEA 2AUZA 1Y4HA 1BY8A 2ATOA 5J94A 1PE6A 2IPPB 4YVAA 1EWLA 3PDFA 2DC6A 2HHNA 3LXSA 2OZ2A 3M99A 4YV8A 5PADA 3KSEA 4BQVA 1AU2A 2Y5BA 2DC8A 5EF4A 4AXLA 5EGWA 1ICFA 2G8EA 4BS6A 1SNKA 3H8CA 1DF0A 4X6IA 3QJ3A 2YJ2A 3D6SA 3RVVA 3H89A 3F75A 1S4VA 3AI8A 5K16A 3ZUAA 3OVZA 1F2CA 2R9CA 3MORA 1F2BA 1U9VA 4N8WA 1Y08A 2R9NA 3PNRA 2B1MA 3GCBA 3QT4A 4BS5A 5F02A 1MDWA 4CZWA 1THEA 3K9MA 1PPPA 2AS8A 2E00A 1QXPA 2FRAA 2YJCA 3N3KA 3H7DA 4BPVA 1DEUA 2G7YA 1NL6A 1U9WA 4P6EA 1PPNA 3P5WA 5CHTA 4Q8HA 1U9XA 1ZCMA 3IHPA 3P5VA 1KFXL 1AYUA 4YYWA 2AYOA 1ATKA 2F1GA 1IWDA 2Y6EA 3RVXA 2C0YA 1NPZA 3MHSA 3H6SA 3HHIA 2E03A 4N79A 1CTEA 3CBKA 5JA7A 4CDDB 1YT7A 1QDQA 2DJFB 2PBHA 4W5CA 2FO5A 1STFE 4QRGA 1PBHA 3K8UA 3USVA 1NB5A 1PCIA 3WXFA 3HHAA 2NQGA 1X9YA 3ERVA 5CVNB 4WA6A 2DZYA 4I04A 3IOQA 1AU4A 5CVMA 5A24A 2FT2A 4XUIA 1CJLA 2XU5A 2YJBA 2O6XA 2P86A 4I05A 1GECE 2XU1A 2DCDA 3KW9A 3HD3A 4PI3A 1JQPA 2BDLA 1YALA 3DF0A 4K7CA 3BWKA 2PNSA 3QSDA 3PBHA 2CIOA 2AYNA 1MEMA 3MTNA 5CHVA 1CVZA 2E02A 3F5VA 1M6DA 1TLOA 1CB5A 1EWMA 2P7UA 2HXZA 4YYSA 3KKUA 4BSQA 3C9EA 4XR7A 3CH3X 4FK5A 2AVWA 4DMYA 2FRQA 3PW3A 2ARYA 1NB3A 2VHFA 1EWOA 2R9FA 2DZZA 1MHWA 1BP4A 1EF7A 4PADA 4X6HA 4KLBA 2DC7A 2FQ9A 1XKGA 4MSXA 4W5BA 2BDZA 3KWBX 2JQGR 2PADA 1ME3A 1CV8A 4QBBA 1HUCB 1PXVA 1PIPA 2VHSA 1U5IA 2DC9A 1O0EA 1K3BB 1TL9A 2R6NA 5JH3A 4ZUXU 3HWNA 1YK8A 4X6JA 4W4UA 1GLOA 1KFUL 3OF8A 4I07A 1QMYA 3H8BA 4MZSA 1U9QX 3O0UA 1CSBB 7PCKA 8PCHA 3S3QA 1ME4A 2R9OA 2OULA 3K24A 1GCBA 1F29A
chains in the Genus database with same CATH superfamily
4Q8GA 3I06A 1AU0A 3E1ZB 2NQDB 5EZQA 1QOLA 1PPDA 2FYEA 2NQAA 4PP1A 4OELA 1BGOA 4CDCB 3KFQA 1YVBA 2BTWB 1KHPA 1PPOA 1MEGA 3V6CA 4BOQA 3OISA 2ACTA 4M0WA 2OP3A 4CDFB 2WBFX 3PRMA 3C0RA 4CDEB 1BQIA 3BPMA 4DMXA 4P6GA 3U8EA 5KO3A 1SP4B 4OW0A 4IP3A 2G6DA 2F7DA 1YK7A 1ITOA 1AYWA 2H7JA 2P0RA 5FPWA 3B79A 3BC3A 9PAPA 5CVOB 3CH2X 2AIMA 4XZXA 2IBIA 4RY2A 1PADA 4OEMA 3RVWA 2DCBA 3KWZA 1GMYA 1EWPA 4N4ZA 4BOUA 3PHXA 2HH5A 4FJCA 4YYQA 1MIRA 3S3RA 4QH6A 2JQFR 2JTCA 1AIMA 2AU1A 3OF9A 4QRVA 4AXMA 1F2AA 1POPA 1VSNA 2DJGB 2GHUA 3MHHA 2R9MA 2XU3A 2YJ8A 4HXDB 3V6EA 1TU6A 1CS8A 3I3TA 3CBJA 3PSEA 1VJVA 2FTDA 3IMAA 4QRXA 3NHEA 2DCAA 2YJ9A 1A6RA 1AU3A 3BBAA 1DKIA 2AGAA 2GFOA 4YYVA 2XU4A 2HD5A 3KX1A 2E01A 1KHQA 1KXRA 1ZIVA 2FUDA 1AYVA 3BPFA 4G54A 4FIPA 2G8JA 2FE8A 4GUAA 3LFYA 3IUTA 3BOWA 3P5XA 3WXGA 4MZOA 1CPJA 2BTWA 3IV2A 1MS6A 3N3GA 4YYRA 3OQCA 2DCCA 2B1NA 3TNXA 3OVXA 4PP2E 3N4CA 3BCNA 2AUXA 1NQCA 3ZNHA 1FH0A 4HWYA 1CQDA 6PADA 3O1GA 2PREA 2NQIA 2CB5A 4YYUA 3P5UA 1AECA 1Q6KA 1NLJA 3IEJA 3BB7A 3WXEA 2AUZA 1Y4HA 4BOSA 5E6JA 1BY8A 2ATOA 3PHWA 5J94A 1PE6A 2IPPB 4YVAA 1EWLA 3PDFA 2DC6A 2HHNA 3IFUA 4RKXA 3LXSA 2OZ2A 4IUMA 3PHUA 3M99A 4YV8A 4D8EA 5PADA 3KSEA 4BQVA 1AU2A 2Y5BA 2DC8A 5EF4A 4AXLA 5EGWA 1ICFA 2G8EA 4BS6A 1SNKA 3PT2A 3H8CA 1DF0A 4X6IA 3QJ3A 2YJ2A 3D6SA 3PRPA 3RVVA 3H89A 3F75A 1S4VA 3AI8A 3B21A 5K16A 3ZUAA 3OVZA 1F2CA 2R9CA 3MORA 1F2BA 1U9VA 4A5UA 4N8WA 1Y08A 4RF1A 2Z84A 2R9NA 3PNRA 4MM3B 2B1MA 3TMPA 3GCBA 3QT4A 4BS5A 5F02A 1MDWA 4CZWA 1PVJA 4RF0A 1THEA 3K9MA 3BY4A 1PPPA 2AS8A 2E00A 1QXPA 2FRAA 2YJCA 3N3KA 3H7DA 2J7QC 4BPVA 1DEUA 2G7YA 1NL6A 1U9WA 4P6EA 1PPNA 4BOZA 4R3DA 3P5WA 5CHTA 3E9SA 4Q8HA 1U9XA 1ZCMA 3IHPA 3P5VA 1KFXL 1AYUA 4YYWA 2AYOA 3O65A 1ATKA 1IWDA 2F1GA 2Y6EA 4MI7A 3RVXA 2C0YA 1NPZA 3MHSA 3H6SA 3HHIA 2E03A 4N79A 1CTEA 3CBKA 2J7QA 5JA7A 4CDDB 1YT7A 1QDQA 2DJFB 2PBHA 4W5CA 2FO5A 1STFE 3TRKA 4QRGA 1PBHA 3K8UA 4OVZB 3USVA 1NB5A 1PCIA 3WXFA 3HHAA 2HWKA 5EZSA 2NQGA 1X9YA 3ERVA 5CVNB 4WA6A 4ZTBA 2DZYA 4I04A 3IOQA 1AU4A 5CVMA 5A24A 4RNAA 4REZA 2BU3A 2FT2A 4XUIA 1CJLA 1YZBA 2XU5A 2YJBA 4P16A 2O6XA 2P86A 4I05A 1GECE 2XU1A 2DCDA 3KW9A 3HD3A 3MTVA 4PI3A 3MP2A 1JQPA 2JRIA 2BDLA 1YALA 3DF0A 3MJ5A 4K7CA 4D8IA 3BWKA 2PNSA 3QSDA 3PBHA 2CIOA 2AYNA 1MEMA 3MTNA 5CHVA 1CVZA 2E02A 3F5VA 1M6DA 1TLOA 1CB5A 1EWMA 2P7UA 1UKFA 2HXZA 4YYSA 3KKUA 4BSQA 3C9EA 4XR7A 3CH3X 4FK5A 4BOPA 2AVWA 4DMYA 3W31A 2FRQA 3PW3A 2ARYA 1NB3A 5JZEA 2VHFA 1EWOA 2R9FA 2DZZA 1MHWA 1BP4A 1EF7A 4PADA 4X6HA 4KLBA 2DC7A 2FQ9A 4D8BA 1XKGA 4MSXA 3RNVA 4W5BA 2BDZA 3KWBX 2JQGR 2PADA 1ME3A 1CV8A 4QBBA 1HUCB 1PXVA 1PIPA 2VHSA 1U5IA 4OVZA 2DC9A 1O0EA 1K3BB 1TL9A 2R6NA 5JH3A 4ZUXU 3HWNA 1YK8A 4X6JA 4W4UA 1GLOA 1KFUL 3OF8A 4I07A 1QMYA 3H8BA 4MZSA 2UZJA 1U9QX 3O0UA 1CSBB 2DOSA 7PCKA 4PT5A 8PCHA 3S3QA 1ME4A 3W30A 2R9OA 2OULA 3K24A 1GCBA 4WURA 1F29A
chains in the Genus database with same CATH topology
4Q8GA 3I06A 1AU0A 3E1ZB 2NQDB 1QOLA 1PPDA 3LTWA 2FYEA 2NQAA 4PP1A 4OELA 1BGOA 4CDCB 3KFQA 1YVBA 1KHPA 1PPOA 1MEGA 3V6CA 3OISA 2ACTA 2OP3A 4CDFB 2WBFX 4CDEB 1BQIA 3BPMA 4DMXA 4P6GA 1W4TA 3U8EA 1SP4B 2G6DA 2F7DA 1YK7A 1ITOA 1AYWA 2H7JA 2P0RA 5FPWA 3B79A 3BC3A 9PAPA 1E2TA 3CH2X 5CVOB 2AIMA 2IBIA 4RY2A 1PADA 4OEMA 3RVWA 2DCBA 3KWZA 1GMYA 1EWPA 4N4ZA 4FJCA 2HH5A 4YYQA 1MIRA 3S3RA 4QH6A 4B55A 2JQFR 1AIMA 2AU1A 3OF9A 4QRVA 4AXMA 1F2AA 1POPA 1VSNA 4GUZA 2DJGB 2GHUA 3MHHA 2R9MA 2XU3A 2YJ8A 1W5RA 3V6EA 1TU6A 1CS8A 3I3TA 3CBJA 2VFCA 1VJVA 2FTDA 3IMAA 4QRXA 3NHEA 2DCAA 2YJ9A 1A6RA 4NV7A 1AU3A 4BGFA 2GFOA 4YYVA 2XU4A 2HD5A 3KX1A 2E01A 1KHQA 1KXRA 1ZIVA 2FUDA 1AYVA 3BPFA 4G54A 4FIPA 2G8JA 3LFYA 3IUTA 3BOWA 3P5XA 3WXGA 4MZOA 1CPJA 3IV2A 1MS6A 3N3GA 4YYRA 2DCCA 2B1NA 3TNXA 3OVXA 4PP2E 3N4CA 3BCNA 2AUXA 1NQCA 1FH0A 4HWYA 1CQDA 6PADA 3O1GA 2PREA 2NQIA 2CB5A 4YYUA 3P5UA 1AECA 1Q6KA 1NLJA 3IEJA 3WXEA 2AUZA 1Y4HA 1BY8A 2ATOA 5J94A 1PE6A 2IPPB 4YVAA 1EWLA 3PDFA 2DC6A 2HHNA 3LXSA 2OZ2A 3M99A 4YV8A 5PADA 3KSEA 4BQVA 1AU2A 2Y5BA 2DC8A 5EF4A 4AXLA 5EGWA 1ICFA 2G8EA 4BS6A 1SNKA 3H8CA 1DF0A 4X6IA 3QJ3A 2YJ2A 3D6SA 3RVVA 3H89A 3F75A 1S4VA 3AI8A 5K16A 3ZUAA 3OVZA 1F2CA 2R9CA 3MORA 1F2BA 4NV8A 4C5PA 1U9VA 4N8WA 1Y08A 2R9NA 3PNRA 2B1MA 3GCBA 3QT4A 4BS5A 5F02A 1MDWA 4CZWA 1THEA 3K9MA 1PPPA 2AS8A 2E00A 1QXPA 2FRAA 2YJCA 3N3KA 3H7DA 4BPVA 1DEUA 2G7YA 1NL6A 1U9WA 4P6EA 1PPNA 3P5WA 5CHTA 4Q8HA 1U9XA 1ZCMA 3IHPA 3P5VA 2VFBA 1KFXL 1AYUA 4YYWA 2AYOA 1ATKA 2F1GA 1IWDA 2Y6EA 3RVXA 2C0YA 1NPZA 3MHSA 3H6SA 3HHIA 2E03A 4N79A 1CTEA 3CBKA 5JA7A 4CDDB 1YT7A 1QDQA 2DJFB 2PBHA 4W5CA 2FO5A 1STFE 4QRGA 1PBHA 3K8UA 3USVA 1NB5A 1W6FA 1PCIA 3WXFA 3HHAA 2NQGA 1X9YA 3ERVA 5CVNB 4WA6A 2DZYA 4I04A 3IOQA 1AU4A 5CVMA 5A24A 2FT2A 4XUIA 1CJLA 1GX3A 2XU5A 2YJBA 2O6XA 2P86A 4I05A 1GECE 2XU1A 2DCDA 3KW9A 3HD3A 4PI3A 1JQPA 2BDLA 1YALA 3DF0A 4K7CA 3BWKA 2PNSA 3QSDA 3PBHA 2CIOA 2AYNA 1MEMA 3MTNA 5CHVA 1CVZA 2E02A 3F5VA 1M6DA 1TLOA 1CB5A 1EWMA 2P7UA 2HXZA 4YYSA 3KKUA 4BSQA 3C9EA 4XR7A 3CH3X 4FK5A 2AVWA 4DMYA 2FRQA 3PW3A 2ARYA 1NB3A 2VHFA 1EWOA 2R9FA 2DZZA 1MHWA 1BP4A 1EF7A 4PADA 4X6HA 4KLBA 3D9WA 2DC7A 2BSZA 2FQ9A 1XKGA 4MSXA 4W5BA 2BDZA 3KWBX 2JQGR 2PADA 1ME3A 1CV8A 4QBBA 1HUCB 1PXVA 1PIPA 2VHSA 1U5IA 2DC9A 1O0EA 1K3BB 1TL9A 2R6NA 5JH3A 4ZUXU 3HWNA 1YK8A 4X6JA 4W4UA 1GLOA 1KFUL 3OF8A 4I07A 1QMYA 3H8BA 4MZSA 1U9QX 3O0UA 1CSBB 7PCKA 8PCHA 3S3QA 1ME4A 2R9OA 2OULA 3K24A 1GCBA 1F29A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q8G A;  3I06 A;  1AU0 A;  3E1Z B;  2NQD B;  1QOL A;  1PPD A;  2FYE A;  2NQA A;  4PP1 A;  4OEL A;  1BGO A;  4CDC B;  3KFQ A;  1YVB A;  1KHP A;  1PPO A;  1MEG A;  3V6C A;  3OIS A;  2ACT A;  2OP3 A;  4CDF B;  2WBF X;  4CDE B;  1BQI A;  3BPM A;  4DMX A;  4P6G A;  3U8E A;  1SP4 B;  2G6D A;  2F7D A;  1YK7 A;  1ITO A;  1AYW A;  2H7J A;  2P0R A;  5FPW A;  3B79 A;  3BC3 A;  9PAP A;  5CVO B;  3CH2 X;  2AIM A;  2IBI A;  4RY2 A;  1PAD A;  4OEM A;  3RVW A;  2DCB A;  3KWZ A;  1GMY A;  1EWP A;  4N4Z A;  4FJC A;  2HH5 A;  4YYQ A;  1MIR A;  3S3R A;  4QH6 A;  2JQF R;  1AIM A;  2AU1 A;  3OF9 A;  4QRV A;  4AXM A;  1F2A A;  1POP A;  1VSN A;  2DJG B;  2GHU A;  3MHH A;  2R9M A;  2XU3 A;  2YJ8 A;  3V6E A;  1TU6 A;  1CS8 A;  3I3T A;  3CBJ A;  1VJV A;  2FTD A;  3IMA A;  4QRX A;  3NHE A;  2DCA A;  2YJ9 A;  1A6R A;  1AU3 A;  2GFO A;  4YYV A;  2XU4 A;  2HD5 A;  3KX1 A;  2E01 A;  1KHQ A;  1KXR A;  1ZIV A;  2FUD A;  1AYV A;  3BPF A;  4G54 A;  4FIP A;  2G8J A;  3LFY A;  3IUT A;  3BOW A;  3P5X A;  3WXG A;  4MZO A;  1CPJ A;  3IV2 A;  1MS6 A;  3N3G A;  4YYR A;  2DCC A;  2B1N A;  3TNX A;  3OVX A;  4PP2 E;  3N4C A;  3BCN A;  2AUX A;  1NQC A;  1FH0 A;  4HWY A;  1CQD A;  6PAD A;  3O1G A;  2PRE A;  2NQI A;  2CB5 A;  4YYU A;  3P5U A;  1AEC A;  1Q6K A;  1NLJ A;  3IEJ A;  3WXE A;  2AUZ A;  1Y4H A;  1BY8 A;  2ATO A;  5J94 A;  1PE6 A;  2IPP B;  4YVA A;  1EWL A;  3PDF A;  2DC6 A;  2HHN A;  3LXS A;  2OZ2 A;  3M99 A;  4YV8 A;  5PAD A;  3KSE A;  4BQV A;  1AU2 A;  2Y5B A;  2DC8 A;  5EF4 A;  4AXL A;  5EGW A;  1ICF A;  2G8E A;  4BS6 A;  1SNK A;  3H8C A;  1DF0 A;  4X6I A;  3QJ3 A;  2YJ2 A;  3D6S A;  3RVV A;  3H89 A;  3F75 A;  1S4V A;  3AI8 A;  5K16 A;  3ZUA A;  3OVZ A;  1F2C A;  2R9C A;  3MOR A;  1F2B A;  1U9V A;  4N8W A;  1Y08 A;  2R9N A;  3PNR A;  2B1M A;  3GCB A;  3QT4 A;  4BS5 A;  5F02 A;  1MDW A;  4CZW A;  1THE A;  3K9M A;  1PPP A;  2AS8 A;  2E00 A;  1QXP A;  2FRA A;  2YJC A;  3N3K A;  3H7D A;  4BPV A;  1DEU A;  2G7Y A;  1NL6 A;  1U9W A;  4P6E A;  1PPN A;  3P5W A;  5CHT A;  4Q8H A;  1U9X A;  1ZCM A;  3IHP A;  3P5V A;  1KFX L;  1AYU A;  4YYW A;  2AYO A;  1ATK A;  2F1G A;  1IWD A;  2Y6E A;  3RVX A;  2C0Y A;  1NPZ A;  3MHS A;  3H6S A;  3HHI A;  2E03 A;  4N79 A;  1CTE A;  3CBK A;  5JA7 A;  4CDD B;  1YT7 A;  1QDQ A;  2DJF B;  2PBH A;  4W5C A;  2FO5 A;  1STF E;  4QRG A;  1PBH A;  3K8U A;  3USV A;  1NB5 A;  1PCI A;  3WXF A;  3HHA A;  2NQG A;  1X9Y A;  3ERV A;  5CVN B;  4WA6 A;  2DZY A;  4I04 A;  3IOQ A;  1AU4 A;  5CVM A;  5A24 A;  2FT2 A;  4XUI A;  1CJL A;  2XU5 A;  2YJB A;  2O6X A;  2P86 A;  4I05 A;  1GEC E;  2XU1 A;  2DCD A;  3KW9 A;  3HD3 A;  4PI3 A;  1JQP A;  2BDL A;  1YAL A;  3DF0 A;  4K7C A;  3BWK A;  2PNS A;  3QSD A;  3PBH A;  2CIO A;  2AYN A;  1MEM A;  3MTN A;  5CHV A;  1CVZ A;  2E02 A;  3F5V A;  1M6D A;  1TLO A;  1CB5 A;  1EWM A;  2P7U A;  2HXZ A;  4YYS A;  3KKU A;  4BSQ A;  3C9E A;  4XR7 A;  3CH3 X;  4FK5 A;  2AVW A;  4DMY A;  2FRQ A;  3PW3 A;  2ARY A;  1NB3 A;  2VHF A;  1EWO A;  2R9F A;  2DZZ A;  1MHW A;  1BP4 A;  1EF7 A;  4PAD A;  4X6H A;  4KLB A;  2DC7 A;  2FQ9 A;  1XKG A;  4MSX A;  4W5B A;  2BDZ A;  3KWB X;  2JQG R;  2PAD A;  1ME3 A;  1CV8 A;  4QBB A;  1HUC B;  1PXV A;  1PIP A;  2VHS A;  1U5I A;  2DC9 A;  1O0E A;  1K3B B;  1TL9 A;  2R6N A;  5JH3 A;  4ZUX U;  3HWN A;  1YK8 A;  4X6J A;  4W4U A;  1GLO A;  1KFU L;  3OF8 A;  4I07 A;  1QMY A;  3H8B A;  4MZS A;  1U9Q X;  3O0U A;  1CSB B;  7PCK A;  8PCH A;  3S3Q A;  1ME4 A;  2R9O A;  2OUL A;  3K24 A;  1GCB A;  1F29 A; 
#chains in the Genus database with same CATH topology
 4Q8G A;  3I06 A;  1AU0 A;  3E1Z B;  2NQD B;  5EZQ A;  1QOL A;  1PPD A;  2FYE A;  2NQA A;  4PP1 A;  4OEL A;  1BGO A;  4CDC B;  3KFQ A;  1YVB A;  2BTW B;  1KHP A;  1PPO A;  1MEG A;  3V6C A;  4BOQ A;  3OIS A;  2ACT A;  4M0W A;  2OP3 A;  4CDF B;  2WBF X;  3PRM A;  3C0R A;  4CDE B;  1BQI A;  3BPM A;  4DMX A;  4P6G A;  3U8E A;  5KO3 A;  1SP4 B;  4OW0 A;  4IP3 A;  2G6D A;  2F7D A;  1YK7 A;  1ITO A;  1AYW A;  2H7J A;  2P0R A;  5FPW A;  3B79 A;  3BC3 A;  9PAP A;  5CVO B;  3CH2 X;  2AIM A;  4XZX A;  2IBI A;  4RY2 A;  1PAD A;  4OEM A;  3RVW A;  2DCB A;  3KWZ A;  1GMY A;  1EWP A;  4N4Z A;  4BOU A;  3PHX A;  2HH5 A;  4FJC A;  4YYQ A;  1MIR A;  3S3R A;  4QH6 A;  2JQF R;  2JTC A;  1AIM A;  2AU1 A;  3OF9 A;  4QRV A;  4AXM A;  1F2A A;  1POP A;  1VSN A;  2DJG B;  2GHU A;  3MHH A;  2R9M A;  2XU3 A;  2YJ8 A;  4HXD B;  3V6E A;  1TU6 A;  1CS8 A;  3I3T A;  3CBJ A;  3PSE A;  1VJV A;  2FTD A;  3IMA A;  4QRX A;  3NHE A;  2DCA A;  2YJ9 A;  1A6R A;  1AU3 A;  3BBA A;  1DKI A;  2AGA A;  2GFO A;  4YYV A;  2XU4 A;  2HD5 A;  3KX1 A;  2E01 A;  1KHQ A;  1KXR A;  1ZIV A;  2FUD A;  1AYV A;  3BPF A;  4G54 A;  4FIP A;  2G8J A;  2FE8 A;  4GUA A;  3LFY A;  3IUT A;  3BOW A;  3P5X A;  3WXG A;  4MZO A;  1CPJ A;  2BTW A;  3IV2 A;  1MS6 A;  3N3G A;  4YYR A;  3OQC A;  2DCC A;  2B1N A;  3TNX A;  3OVX A;  4PP2 E;  3N4C A;  3BCN A;  2AUX A;  1NQC A;  3ZNH A;  1FH0 A;  4HWY A;  1CQD A;  6PAD A;  3O1G A;  2PRE A;  2NQI A;  2CB5 A;  4YYU A;  3P5U A;  1AEC A;  1Q6K A;  1NLJ A;  3IEJ A;  3BB7 A;  3WXE A;  2AUZ A;  1Y4H A;  4BOS A;  5E6J A;  1BY8 A;  2ATO A;  3PHW A;  5J94 A;  1PE6 A;  2IPP B;  4YVA A;  1EWL A;  3PDF A;  2DC6 A;  2HHN A;  3IFU A;  4RKX A;  3LXS A;  2OZ2 A;  4IUM A;  3PHU A;  3M99 A;  4YV8 A;  4D8E A;  5PAD A;  3KSE A;  4BQV A;  1AU2 A;  2Y5B A;  2DC8 A;  5EF4 A;  4AXL A;  5EGW A;  1ICF A;  2G8E A;  4BS6 A;  1SNK A;  3PT2 A;  3H8C A;  1DF0 A;  4X6I A;  3QJ3 A;  2YJ2 A;  3D6S A;  3PRP A;  3RVV A;  3H89 A;  3F75 A;  1S4V A;  3AI8 A;  3B21 A;  5K16 A;  3ZUA A;  3OVZ A;  1F2C A;  2R9C A;  3MOR A;  1F2B A;  1U9V A;  4A5U A;  4N8W A;  1Y08 A;  4RF1 A;  2Z84 A;  2R9N A;  3PNR A;  4MM3 B;  2B1M A;  3TMP A;  3GCB A;  3QT4 A;  4BS5 A;  5F02 A;  1MDW A;  4CZW A;  1PVJ A;  4RF0 A;  1THE A;  3K9M A;  3BY4 A;  1PPP A;  2AS8 A;  2E00 A;  1QXP A;  2FRA A;  2YJC A;  3N3K A;  3H7D A;  2J7Q C;  4BPV A;  1DEU A;  2G7Y A;  1NL6 A;  1U9W A;  4P6E A;  1PPN A;  4BOZ A;  4R3D A;  3P5W A;  5CHT A;  3E9S A;  4Q8H A;  1U9X A;  1ZCM A;  3IHP A;  3P5V A;  1KFX L;  1AYU A;  4YYW A;  2AYO A;  3O65 A;  1ATK A;  1IWD A;  2F1G A;  2Y6E A;  4MI7 A;  3RVX A;  2C0Y A;  1NPZ A;  3MHS A;  3H6S A;  3HHI A;  2E03 A;  4N79 A;  1CTE A;  3CBK A;  2J7Q A;  5JA7 A;  4CDD B;  1YT7 A;  1QDQ A;  2DJF B;  2PBH A;  4W5C A;  2FO5 A;  1STF E;  3TRK A;  4QRG A;  1PBH A;  3K8U A;  4OVZ B;  3USV A;  1NB5 A;  1PCI A;  3WXF A;  3HHA A;  2HWK A;  5EZS A;  2NQG A;  1X9Y A;  3ERV A;  5CVN B;  4WA6 A;  4ZTB A;  2DZY A;  4I04 A;  3IOQ A;  1AU4 A;  5CVM A;  5A24 A;  4RNA A;  4REZ A;  2BU3 A;  2FT2 A;  4XUI A;  1CJL A;  1YZB A;  2XU5 A;  2YJB A;  4P16 A;  2O6X A;  2P86 A;  4I05 A;  1GEC E;  2XU1 A;  2DCD A;  3KW9 A;  3HD3 A;  3MTV A;  4PI3 A;  3MP2 A;  1JQP A;  2JRI A;  2BDL A;  1YAL A;  3DF0 A;  3MJ5 A;  4K7C A;  4D8I A;  3BWK A;  2PNS A;  3QSD A;  3PBH A;  2CIO A;  2AYN A;  1MEM A;  3MTN A;  5CHV A;  1CVZ A;  2E02 A;  3F5V A;  1M6D A;  1TLO A;  1CB5 A;  1EWM A;  2P7U A;  1UKF A;  2HXZ A;  4YYS A;  3KKU A;  4BSQ A;  3C9E A;  4XR7 A;  3CH3 X;  4FK5 A;  4BOP A;  2AVW A;  4DMY A;  3W31 A;  2FRQ A;  3PW3 A;  2ARY A;  1NB3 A;  5JZE A;  2VHF A;  1EWO A;  2R9F A;  2DZZ A;  1MHW A;  1BP4 A;  1EF7 A;  4PAD A;  4X6H A;  4KLB A;  2DC7 A;  2FQ9 A;  4D8B A;  1XKG A;  4MSX A;  3RNV A;  4W5B A;  2BDZ A;  3KWB X;  2JQG R;  2PAD A;  1ME3 A;  1CV8 A;  4QBB A;  1HUC B;  1PXV A;  1PIP A;  2VHS A;  1U5I A;  4OVZ A;  2DC9 A;  1O0E A;  1K3B B;  1TL9 A;  2R6N A;  5JH3 A;  4ZUX U;  3HWN A;  1YK8 A;  4X6J A;  4W4U A;  1GLO A;  1KFU L;  3OF8 A;  4I07 A;  1QMY A;  3H8B A;  4MZS A;  2UZJ A;  1U9Q X;  3O0U A;  1CSB B;  2DOS A;  7PCK A;  4PT5 A;  8PCH A;  3S3Q A;  1ME4 A;  3W30 A;  2R9O A;  2OUL A;  3K24 A;  1GCB A;  4WUR A;  1F29 A; 
#chains in the Genus database with same CATH homology
 4Q8G A;  3I06 A;  1AU0 A;  3E1Z B;  2NQD B;  1QOL A;  1PPD A;  3LTW A;  2FYE A;  2NQA A;  4PP1 A;  4OEL A;  1BGO A;  4CDC B;  3KFQ A;  1YVB A;  1KHP A;  1PPO A;  1MEG A;  3V6C A;  3OIS A;  2ACT A;  2OP3 A;  4CDF B;  2WBF X;  4CDE B;  1BQI A;  3BPM A;  4DMX A;  4P6G A;  1W4T A;  3U8E A;  1SP4 B;  2G6D A;  2F7D A;  1YK7 A;  1ITO A;  1AYW A;  2H7J A;  2P0R A;  5FPW A;  3B79 A;  3BC3 A;  9PAP A;  1E2T A;  3CH2 X;  5CVO B;  2AIM A;  2IBI A;  4RY2 A;  1PAD A;  4OEM A;  3RVW A;  2DCB A;  3KWZ A;  1GMY A;  1EWP A;  4N4Z A;  4FJC A;  2HH5 A;  4YYQ A;  1MIR A;  3S3R A;  4QH6 A;  4B55 A;  2JQF R;  1AIM A;  2AU1 A;  3OF9 A;  4QRV A;  4AXM A;  1F2A A;  1POP A;  1VSN A;  4GUZ A;  2DJG B;  2GHU A;  3MHH A;  2R9M A;  2XU3 A;  2YJ8 A;  1W5R A;  3V6E A;  1TU6 A;  1CS8 A;  3I3T A;  3CBJ A;  2VFC A;  1VJV A;  2FTD A;  3IMA A;  4QRX A;  3NHE A;  2DCA A;  2YJ9 A;  1A6R A;  4NV7 A;  1AU3 A;  4BGF A;  2GFO A;  4YYV A;  2XU4 A;  2HD5 A;  3KX1 A;  2E01 A;  1KHQ A;  1KXR A;  1ZIV A;  2FUD A;  1AYV A;  3BPF A;  4G54 A;  4FIP A;  2G8J A;  3LFY A;  3IUT A;  3BOW A;  3P5X A;  3WXG A;  4MZO A;  1CPJ A;  3IV2 A;  1MS6 A;  3N3G A;  4YYR A;  2DCC A;  2B1N A;  3TNX A;  3OVX A;  4PP2 E;  3N4C A;  3BCN A;  2AUX A;  1NQC A;  1FH0 A;  4HWY A;  1CQD A;  6PAD A;  3O1G A;  2PRE A;  2NQI A;  2CB5 A;  4YYU A;  3P5U A;  1AEC A;  1Q6K A;  1NLJ A;  3IEJ A;  3WXE A;  2AUZ A;  1Y4H A;  1BY8 A;  2ATO A;  5J94 A;  1PE6 A;  2IPP B;  4YVA A;  1EWL A;  3PDF A;  2DC6 A;  2HHN A;  3LXS A;  2OZ2 A;  3M99 A;  4YV8 A;  5PAD A;  3KSE A;  4BQV A;  1AU2 A;  2Y5B A;  2DC8 A;  5EF4 A;  4AXL A;  5EGW A;  1ICF A;  2G8E A;  4BS6 A;  1SNK A;  3H8C A;  1DF0 A;  4X6I A;  3QJ3 A;  2YJ2 A;  3D6S A;  3RVV A;  3H89 A;  3F75 A;  1S4V A;  3AI8 A;  5K16 A;  3ZUA A;  3OVZ A;  1F2C A;  2R9C A;  3MOR A;  1F2B A;  4NV8 A;  4C5P A;  1U9V A;  4N8W A;  1Y08 A;  2R9N A;  3PNR A;  2B1M A;  3GCB A;  3QT4 A;  4BS5 A;  5F02 A;  1MDW A;  4CZW A;  1THE A;  3K9M A;  1PPP A;  2AS8 A;  2E00 A;  1QXP A;  2FRA A;  2YJC A;  3N3K A;  3H7D A;  4BPV A;  1DEU A;  2G7Y A;  1NL6 A;  1U9W A;  4P6E A;  1PPN A;  3P5W A;  5CHT A;  4Q8H A;  1U9X A;  1ZCM A;  3IHP A;  3P5V A;  2VFB A;  1KFX L;  1AYU A;  4YYW A;  2AYO A;  1ATK A;  2F1G A;  1IWD A;  2Y6E A;  3RVX A;  2C0Y A;  1NPZ A;  3MHS A;  3H6S A;  3HHI A;  2E03 A;  4N79 A;  1CTE A;  3CBK A;  5JA7 A;  4CDD B;  1YT7 A;  1QDQ A;  2DJF B;  2PBH A;  4W5C A;  2FO5 A;  1STF E;  4QRG A;  1PBH A;  3K8U A;  3USV A;  1NB5 A;  1W6F A;  1PCI A;  3WXF A;  3HHA A;  2NQG A;  1X9Y A;  3ERV A;  5CVN B;  4WA6 A;  2DZY A;  4I04 A;  3IOQ A;  1AU4 A;  5CVM A;  5A24 A;  2FT2 A;  4XUI A;  1CJL A;  1GX3 A;  2XU5 A;  2YJB A;  2O6X A;  2P86 A;  4I05 A;  1GEC E;  2XU1 A;  2DCD A;  3KW9 A;  3HD3 A;  4PI3 A;  1JQP A;  2BDL A;  1YAL A;  3DF0 A;  4K7C A;  3BWK A;  2PNS A;  3QSD A;  3PBH A;  2CIO A;  2AYN A;  1MEM A;  3MTN A;  5CHV A;  1CVZ A;  2E02 A;  3F5V A;  1M6D A;  1TLO A;  1CB5 A;  1EWM A;  2P7U A;  2HXZ A;  4YYS A;  3KKU A;  4BSQ A;  3C9E A;  4XR7 A;  3CH3 X;  4FK5 A;  2AVW A;  4DMY A;  2FRQ A;  3PW3 A;  2ARY A;  1NB3 A;  2VHF A;  1EWO A;  2R9F A;  2DZZ A;  1MHW A;  1BP4 A;  1EF7 A;  4PAD A;  4X6H A;  4KLB A;  3D9W A;  2DC7 A;  2BSZ A;  2FQ9 A;  1XKG A;  4MSX A;  4W5B A;  2BDZ A;  3KWB X;  2JQG R;  2PAD A;  1ME3 A;  1CV8 A;  4QBB A;  1HUC B;  1PXV A;  1PIP A;  2VHS A;  1U5I A;  2DC9 A;  1O0E A;  1K3B B;  1TL9 A;  2R6N A;  5JH3 A;  4ZUX U;  3HWN A;  1YK8 A;  4X6J A;  4W4U A;  1GLO A;  1KFU L;  3OF8 A;  4I07 A;  1QMY A;  3H8B A;  4MZS A;  1U9Q X;  3O0U A;  1CSB B;  7PCK A;  8PCH A;  3S3Q A;  1ME4 A;  2R9O A;  2OUL A;  3K24 A;  1GCB A;  1F29 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...