3BPFA

Crystal structure of falcipain-2 with its inhibitor, e64
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
241
structure length
236
Chain Sequence
QMNYEEVIKKYRGEENFDHAAYDWRLHSGVTPVKDQKNCGSCWAFSSIGSVESQYAIRKNKLITLSEQELVDCSFKNYGCNGGLINNAFEDMIELGGICPDGDYPYVSDAPNLCNIDRCTEKYGIKNYLSVPDNKLKEALRFLGPISISVAVSDDFAFYKEGIFDGECGDQLNHAVMLVGFGMKEIVNGEKHYYYIIKNSWGQQWGERGFINIETDESGLMRKCGLGTDAFIPLIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine protease falcipain-2
publication title Structures of falcipain-2 and falcipain-3 bound to small molecule inhibitors: implications for substrate specificity.
pubmed doi rcsb
molecule tags Hydrolase
total genus 62
structure length 236
sequence length 241
chains with identical sequence B, C, D
ec nomenclature ec 3.4.22.-:
pdb deposition date 2007-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3bpfA00
2XU3A 3V6CA 1YT7A 1PPNA 4DMYA 2P86A 4HWYA 2E02A 2HD5A 3O0UA 3IV2A 5CVOB 2B1MA 5PADA 5CVNB 5CVMA 1AU3A 1U9WA 4QRGA 2NQIA 4CDEB 3GCBA 2YJCA 3DF0A 4PI3A 1QDQA 4QRVA 4MSXA 1CPJA 1MDWA 1BP4A 1EWLA 2P0RA 1TL9A 1QOLA 4X6HA 4I05A 1BGOA 2DCAA 5A24A 3OVZA 3OISA 9PAPA 1Y4HA 1GMYA 1MEGA 4G54A 3KX1A 1YK8A 1ATKA 4FK5A 1NL6A 2PNSA 3P5UA 3PBHA 4YVAA 2JQGR 3MORA 2HXZA 2R9MA 3BWKA 3KKUA 2NQGA 1ITOA 1CQDA 4XR7A 1AU4A 1CJLA 1ME3A 4QRXA 2ATOA 1U5IA 4YYWA 2E00A 1HUCB 3KWZA 2DJGB 1PIPA 1QXPA 2OZ2A 1STFE 3WXEA 1AYVA 1F2BA 1EWPA 4MZOA 3IMAA 4CDDB 4XUIA 4ZUXU 2XU5A 3M99A 3QJ3A 2FT2A 5F02A 3LFYA 2AVWA 2FTDA 3QT4A 1AYUA 4YYQA 8PCHA 1AU0A 1GECE 3IHPA 1GCBA 3BCNA 4MZSA 1FH0A 2DC9A 3BPFA 2VHSA 4DMXA 2CB5A 3B79A 1EF7A 4P6EA 3MTNA 3HWNA 1NB3A 1CS8A 1U9QX 3ZUAA 1TLOA 2G7YA 4PADA 2ACTA 1Y08A 4Q8HA 4WA6A 4W5BA 3NHEA 4FJCA 3H7DA 3IUTA 4QBBA 3HHAA 4OEMA 2HH5A 2AS8A 4X6JA 1MIRA 3O1GA 2DC6A 3RVXA 1KXRA 4QH6A 3HHIA 1PPDA 1POPA 1A6RA 1AU2A 2C0YA 3KFQA 3IEJA 1CTEA 3E1ZB 5EF4A 2DC7A 7PCKA 2Y5BA 1CV8A 1PPOA 3P5WA 2FO5A 1BY8A 4N79A 2BDZA 4PP1A 1NPZA 2NQDB 4P6GA 6PADA 1AIMA 1S4VA 1U9XA 3C9EA 2G8EA 3I06A 4BQVA 2WBFX 2VHFA 2AYNA 1F2AA 3I3TA 3TNXA 3MHSA 3RVVA 4I07A 3K24A 2FRQA 1X9YA 1PADA 4PP2E 3WXFA 4AXMA 4AXLA 2DC8A 2JQFR 3KW9A 5EGWA 3S3QA 4KLBA 3IOQA 1AECA 2ARYA 2GHUA 1KFUL 3K9MA 1ME4A 4YYVA 5CHTA 2E01A 1KHQA 3N4CA 3OVXA 3P5VA 3CH2X 2FRAA 2DJFB 2IPPB 1CSBB 4N4ZA 1F2CA 2DCDA 1M6DA 1Q6KA 1CVZA 2R9OA 5CHVA 4CDCB 2H7JA 3USVA 4YYUA 1NQCA 2HHNA 2NQAA 1JQPA 1IWDA 3P5XA 1K3BB 1EWOA 3OF9A 1PXVA 2AIMA 4BPVA 1GLOA 3F75A 1BQIA 2R9FA 3PNRA 2B1NA 3N3GA 2YJ2A 1YVBA 3HD3A 2Y6EA 1SNKA 2CIOA 4OELA 3F5VA 5FPWA 2XU4A 1MS6A 3KSEA 2AU1A 2YJBA 2YJ9A 1NLJA 1TU6A 2PBHA 3OF8A 3CBJA 4BS5A 2XU1A 2DZYA 2F1GA 3H6SA 1DF0A 3S3RA 3CH3X 1PE6A 2OULA 3H89A 1ZCMA 2G6DA 3PW3A 4YYRA 1U9VA 4YV8A 5K16A 2AUZA 4X6IA 2BDLA 3H8BA 4Q8GA 3V6EA 3CBKA 3AI8A 2AUXA 3N3KA 2R6NA 2P7UA 2YJ8A 2DZZA 1YK7A 2O6XA 3U8EA 5J94A 5JH3A 4CZWA 4W5CA 1QMYA 1AYWA 2DCBA 4YYSA 1MHWA 1SP4B 2FQ9A 3BC3A 3K8UA 4CDFB 3QSDA 4BSQA 4BS6A 1KHPA 2E03A 3H8CA 2IBIA 1NB5A 2G8JA 1VJVA 3BPMA 4K7CA 1YALA 2PREA 4N8WA 1EWMA 2R9CA 1XKGA 1F29A 4RY2A 1MEMA 1PCIA 2PADA 3MHHA 3WXGA 5JA7A 2FUDA 3D6SA 3BOWA 2GFOA 2OP3A 1VSNA 2R9NA 1O0EA 1PBHA 2DCCA 3ERVA 1DEUA 2F7DA 1KFXL 3LXSA 1ICFA 1PPPA 1ZIVA 2AYOA 1THEA 4FIPA 3KWBX 3RVWA 3PDFA 2FYEA 4I04A 1CB5A 4W4UA
chains in the Genus database with same CATH superfamily
2XU3A 3V6CA 4BOZA 1YT7A 1PPNA 4DMYA 2P86A 4HWYA 2E02A 2HD5A 3O0UA 3IV2A 5CVOB 2B1MA 5PADA 5CVNB 5CVMA 4D8EA 1AU3A 1U9WA 4QRGA 2NQIA 4CDEB 1UKFA 3GCBA 4OVZB 2YJCA 3DF0A 4PI3A 4P16A 1QDQA 4QRVA 4MSXA 1CPJA 1MDWA 3W31A 1BP4A 1EWLA 2P0RA 4RNAA 1TL9A 1QOLA 4X6HA 4I05A 1BGOA 4PT5A 2DCAA 5A24A 3OVZA 3OISA 9PAPA 1Y4HA 4D8IA 1GMYA 1MEGA 3B21A 4G54A 3KX1A 1YK8A 1ATKA 4FK5A 3E9SA 1NL6A 2PNSA 3P5UA 3PBHA 4REZA 4YVAA 2JQGR 3MORA 2HXZA 2R9MA 3BWKA 3KKUA 2NQGA 1ITOA 4XZXA 1CQDA 4XR7A 1AU4A 1CJLA 1ME3A 3OQCA 4QRXA 2ATOA 1U5IA 4YYWA 2E00A 1HUCB 1PVJA 3KWZA 3C0RA 2DJGB 1PIPA 1QXPA 2OZ2A 1STFE 3WXEA 1AYVA 1F2BA 1EWPA 4MZOA 4D8BA 3IMAA 4CDDB 4XUIA 4ZUXU 2XU5A 3M99A 3PSEA 2FT2A 3QJ3A 5F02A 3LFYA 2AVWA 2FTDA 3QT4A 1AYUA 4YYQA 8PCHA 1AU0A 1GECE 3BBAA 3IHPA 1GCBA 3BCNA 4MZSA 1FH0A 2DC9A 3BPFA 2VHSA 4DMXA 2CB5A 3B79A 1EF7A 4P6EA 3MTNA 3HWNA 1NB3A 1CS8A 1U9QX 3ZUAA 1TLOA 2J7QC 2G7YA 4PADA 2ACTA 1Y08A 2HWKA 4Q8HA 3IFUA 4WA6A 4W5BA 3NHEA 4FJCA 3H7DA 3IUTA 4QBBA 3HHAA 4OEMA 2HH5A 2AS8A 2BTWA 4X6JA 1MIRA 3O1GA 2DC6A 3RVXA 1KXRA 4QH6A 3HHIA 1PPDA 1YZBA 1POPA 1A6RA 1AU2A 2C0YA 3KFQA 3IEJA 1CTEA 3E1ZB 5EF4A 2DC7A 7PCKA 2Y5BA 1CV8A 1PPOA 3P5WA 2FO5A 1BY8A 4N79A 2BDZA 4PP1A 1NPZA 2NQDB 4GUAA 4P6GA 6PADA 5JZEA 1AIMA 1S4VA 1U9XA 3MJ5A 3RNVA 3C9EA 2G8EA 3I06A 2JRIA 4BQVA 2WBFX 2VHFA 5EZSA 2AYNA 1F2AA 3I3TA 3TNXA 3MHSA 3RVVA 4I07A 3K24A 2FRQA 4ZTBA 1X9YA 1PADA 4BOUA 4PP2E 3BY4A 3PRPA 3WXFA 4AXMA 4AXLA 3TMPA 2DC8A 2JQFR 3KW9A 5EGWA 3S3QA 4KLBA 3IOQA 1DKIA 3PRMA 1AECA 2ARYA 2GHUA 1KFUL 4OW0A 3K9MA 1ME4A 4YYVA 5CHTA 2E01A 4A5UA 5KO3A 3ZNHA 1KHQA 3N4CA 3OVXA 3P5VA 5E6JA 3CH2X 2FRAA 2DJFB 2AGAA 2IPPB 2BU3A 4WURA 1CSBB 4N4ZA 1F2CA 2DCDA 1M6DA 1Q6KA 1CVZA 2R9OA 5CHVA 4CDCB 2H7JA 3USVA 4YYUA 1NQCA 3O65A 2HHNA 2NQAA 3PHUA 1JQPA 1IWDA 3P5XA 1K3BB 1EWOA 3OF9A 1PXVA 2AIMA 4BPVA 1GLOA 3F75A 1BQIA 2R9FA 3PNRA 2BTWB 2B1NA 3N3GA 2YJ2A 1YVBA 3HD3A 2Y6EA 1SNKA 2CIOA 4OELA 3F5VA 4RKXA 5FPWA 2UZJA 4M0WA 4BOQA 2XU4A 3PHWA 1MS6A 3KSEA 2AU1A 2YJBA 2YJ9A 1NLJA 1TU6A 2PBHA 3OF8A 4BOPA 3CBJA 4BS5A 4OVZA 2XU1A 4HXDB 2Z84A 2DZYA 2F1GA 3H6SA 1DF0A 3S3RA 3CH3X 1PE6A 2OULA 3H89A 4IUMA 1ZCMA 2G6DA 3PW3A 4YYRA 1U9VA 4YV8A 5K16A 2AUZA 4X6IA 5EZQA 2BDLA 3H8BA 4Q8GA 3V6EA 3CBKA 3AI8A 2AUXA 3N3KA 2R6NA 2P7UA 2YJ8A 2DZZA 1YK7A 2O6XA 3U8EA 5J94A 5JH3A 4MM3B 4CZWA 4W5CA 1QMYA 2FE8A 1AYWA 2DOSA 2DCBA 4YYSA 1MHWA 1SP4B 2FQ9A 3BC3A 3K8UA 4CDFB 3QSDA 4BSQA 4BS6A 3MTVA 1KHPA 4R3DA 2E03A 4MI7A 4BOSA 3BB7A 3H8CA 4IP3A 2IBIA 1NB5A 2G8JA 1VJVA 3BPMA 4RF1A 4K7CA 1YALA 2PREA 4N8WA 1EWMA 2R9CA 1XKGA 1F29A 4RY2A 3TRKA 1MEMA 1PCIA 2PADA 2JTCA 3PHXA 3MHHA 3WXGA 5JA7A 2FUDA 3PT2A 3D6SA 2J7QA 2GFOA 3BOWA 2OP3A 1VSNA 2R9NA 1O0EA 1PBHA 2DCCA 3ERVA 3MP2A 1DEUA 2F7DA 3W30A 1KFXL 3LXSA 1ICFA 1PPPA 1ZIVA 2AYOA 1THEA 4FIPA 3KWBX 3RVWA 3PDFA 2FYEA 4I04A 4RF0A 1CB5A 4W4UA
chains in the Genus database with same CATH topology
2XU3A 3V6CA 1YT7A 1PPNA 4DMYA 2P86A 4HWYA 2E02A 2HD5A 3O0UA 3IV2A 5CVOB 2B1MA 5PADA 5CVNB 5CVMA 1AU3A 1U9WA 4QRGA 2NQIA 4CDEB 3GCBA 2YJCA 3DF0A 4PI3A 1QDQA 4QRVA 4MSXA 1CPJA 1MDWA 1BP4A 1EWLA 2P0RA 1TL9A 1QOLA 4X6HA 4I05A 1BGOA 2DCAA 5A24A 3OVZA 3OISA 9PAPA 1Y4HA 1GMYA 1MEGA 4G54A 3KX1A 1YK8A 1ATKA 4FK5A 1NL6A 2PNSA 3P5UA 3PBHA 4YVAA 2JQGR 3MORA 2HXZA 2R9MA 3BWKA 3LTWA 3KKUA 2NQGA 1ITOA 1CQDA 4XR7A 1AU4A 1CJLA 1ME3A 4QRXA 2ATOA 1U5IA 4YYWA 2E00A 1HUCB 3KWZA 2DJGB 1PIPA 1QXPA 2OZ2A 1STFE 3WXEA 1AYVA 1F2BA 1EWPA 4MZOA 3IMAA 4CDDB 4XUIA 4ZUXU 2XU5A 3M99A 3QJ3A 2FT2A 5F02A 3LFYA 2AVWA 2FTDA 3QT4A 1AYUA 4YYQA 8PCHA 1AU0A 1GECE 3IHPA 1GCBA 3BCNA 4MZSA 1FH0A 2DC9A 3BPFA 2VHSA 4DMXA 2CB5A 3B79A 1EF7A 4P6EA 3MTNA 3HWNA 1NB3A 1CS8A 1U9QX 3ZUAA 1TLOA 2G7YA 4PADA 2ACTA 1Y08A 4Q8HA 4WA6A 4W5BA 3NHEA 4FJCA 3H7DA 3IUTA 4QBBA 3HHAA 4OEMA 2HH5A 2AS8A 1W6FA 4X6JA 1MIRA 3O1GA 2DC6A 3RVXA 1KXRA 4QH6A 4NV7A 3HHIA 1PPDA 1POPA 1A6RA 1AU2A 2C0YA 3KFQA 3IEJA 1CTEA 3E1ZB 5EF4A 2DC7A 7PCKA 2Y5BA 1CV8A 1PPOA 4NV8A 3P5WA 2FO5A 1BY8A 4N79A 2BDZA 4PP1A 1NPZA 2NQDB 4P6GA 6PADA 1AIMA 1S4VA 1U9XA 3D9WA 3C9EA 2G8EA 3I06A 4BQVA 2WBFX 2VHFA 2AYNA 1F2AA 3I3TA 3TNXA 3MHSA 3RVVA 4I07A 3K24A 2FRQA 1X9YA 1PADA 4PP2E 1E2TA 3WXFA 4AXMA 4AXLA 2DC8A 4GUZA 2JQFR 3KW9A 5EGWA 3S3QA 4KLBA 3IOQA 1AECA 2ARYA 2GHUA 1KFUL 3K9MA 1ME4A 4YYVA 5CHTA 2E01A 1KHQA 3N4CA 3OVXA 3P5VA 3CH2X 2FRAA 2DJFB 1W4TA 2IPPB 1CSBB 4N4ZA 1F2CA 2DCDA 1M6DA 1Q6KA 1CVZA 2R9OA 5CHVA 4B55A 4CDCB 2H7JA 3USVA 4YYUA 1NQCA 2HHNA 2NQAA 1JQPA 1IWDA 2VFCA 3P5XA 1K3BB 1EWOA 3OF9A 1PXVA 2AIMA 4BPVA 1GLOA 3F75A 1BQIA 2R9FA 3PNRA 2B1NA 3N3GA 2YJ2A 1YVBA 3HD3A 2Y6EA 1SNKA 2CIOA 4OELA 3F5VA 5FPWA 2XU4A 1MS6A 3KSEA 2AU1A 2YJBA 2YJ9A 1NLJA 1TU6A 2PBHA 3OF8A 3CBJA 4BS5A 2XU1A 2DZYA 2F1GA 3H6SA 1DF0A 3S3RA 3CH3X 1PE6A 2OULA 3H89A 1ZCMA 2G6DA 3PW3A 4YYRA 1U9VA 4YV8A 5K16A 2AUZA 4X6IA 2BDLA 2VFBA 3H8BA 4Q8GA 3V6EA 4C5PA 3CBKA 3AI8A 2AUXA 3N3KA 2R6NA 2P7UA 2YJ8A 2DZZA 1YK7A 2O6XA 3U8EA 5J94A 5JH3A 4CZWA 4W5CA 1QMYA 1AYWA 2DCBA 4YYSA 4BGFA 1MHWA 1SP4B 2FQ9A 3BC3A 3K8UA 4CDFB 3QSDA 4BSQA 4BS6A 1KHPA 2E03A 3H8CA 2IBIA 1NB5A 2G8JA 1VJVA 3BPMA 4K7CA 1YALA 2PREA 4N8WA 1EWMA 2R9CA 1XKGA 1F29A 4RY2A 2BSZA 1MEMA 1GX3A 1PCIA 2PADA 3MHHA 3WXGA 5JA7A 2FUDA 3D6SA 3BOWA 2GFOA 2OP3A 1VSNA 2R9NA 1O0EA 1PBHA 2DCCA 3ERVA 1DEUA 2F7DA 1KFXL 3LXSA 1ICFA 1PPPA 1ZIVA 2AYOA 1THEA 4FIPA 3KWBX 3RVWA 3PDFA 2FYEA 1W5RA 4I04A 1CB5A 4W4UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XU3 A;  3V6C A;  1YT7 A;  1PPN A;  4DMY A;  2P86 A;  4HWY A;  2E02 A;  2HD5 A;  3O0U A;  3IV2 A;  5CVO B;  2B1M A;  5PAD A;  5CVN B;  5CVM A;  1AU3 A;  1U9W A;  4QRG A;  2NQI A;  4CDE B;  3GCB A;  2YJC A;  3DF0 A;  4PI3 A;  1QDQ A;  4QRV A;  4MSX A;  1CPJ A;  1MDW A;  1BP4 A;  1EWL A;  2P0R A;  1TL9 A;  1QOL A;  4X6H A;  4I05 A;  1BGO A;  2DCA A;  5A24 A;  3OVZ A;  3OIS A;  9PAP A;  1Y4H A;  1GMY A;  1MEG A;  4G54 A;  3KX1 A;  1YK8 A;  1ATK A;  4FK5 A;  1NL6 A;  2PNS A;  3P5U A;  3PBH A;  4YVA A;  2JQG R;  3MOR A;  2HXZ A;  2R9M A;  3BWK A;  3KKU A;  2NQG A;  1ITO A;  1CQD A;  4XR7 A;  1AU4 A;  1CJL A;  1ME3 A;  4QRX A;  2ATO A;  1U5I A;  4YYW A;  2E00 A;  1HUC B;  3KWZ A;  2DJG B;  1PIP A;  1QXP A;  2OZ2 A;  1STF E;  3WXE A;  1AYV A;  1F2B A;  1EWP A;  4MZO A;  3IMA A;  4CDD B;  4XUI A;  4ZUX U;  2XU5 A;  3M99 A;  3QJ3 A;  2FT2 A;  5F02 A;  3LFY A;  2AVW A;  2FTD A;  3QT4 A;  1AYU A;  4YYQ A;  8PCH A;  1AU0 A;  1GEC E;  3IHP A;  1GCB A;  3BCN A;  4MZS A;  1FH0 A;  2DC9 A;  3BPF A;  2VHS A;  4DMX A;  2CB5 A;  3B79 A;  1EF7 A;  4P6E A;  3MTN A;  3HWN A;  1NB3 A;  1CS8 A;  1U9Q X;  3ZUA A;  1TLO A;  2G7Y A;  4PAD A;  2ACT A;  1Y08 A;  4Q8H A;  4WA6 A;  4W5B A;  3NHE A;  4FJC A;  3H7D A;  3IUT A;  4QBB A;  3HHA A;  4OEM A;  2HH5 A;  2AS8 A;  4X6J A;  1MIR A;  3O1G A;  2DC6 A;  3RVX A;  1KXR A;  4QH6 A;  3HHI A;  1PPD A;  1POP A;  1A6R A;  1AU2 A;  2C0Y A;  3KFQ A;  3IEJ A;  1CTE A;  3E1Z B;  5EF4 A;  2DC7 A;  7PCK A;  2Y5B A;  1CV8 A;  1PPO A;  3P5W A;  2FO5 A;  1BY8 A;  4N79 A;  2BDZ A;  4PP1 A;  1NPZ A;  2NQD B;  4P6G A;  6PAD A;  1AIM A;  1S4V A;  1U9X A;  3C9E A;  2G8E A;  3I06 A;  4BQV A;  2WBF X;  2VHF A;  2AYN A;  1F2A A;  3I3T A;  3TNX A;  3MHS A;  3RVV A;  4I07 A;  3K24 A;  2FRQ A;  1X9Y A;  1PAD A;  4PP2 E;  3WXF A;  4AXM A;  4AXL A;  2DC8 A;  2JQF R;  3KW9 A;  5EGW A;  3S3Q A;  4KLB A;  3IOQ A;  1AEC A;  2ARY A;  2GHU A;  1KFU L;  3K9M A;  1ME4 A;  4YYV A;  5CHT A;  2E01 A;  1KHQ A;  3N4C A;  3OVX A;  3P5V A;  3CH2 X;  2FRA A;  2DJF B;  2IPP B;  1CSB B;  4N4Z A;  1F2C A;  2DCD A;  1M6D A;  1Q6K A;  1CVZ A;  2R9O A;  5CHV A;  4CDC B;  2H7J A;  3USV A;  4YYU A;  1NQC A;  2HHN A;  2NQA A;  1JQP A;  1IWD A;  3P5X A;  1K3B B;  1EWO A;  3OF9 A;  1PXV A;  2AIM A;  4BPV A;  1GLO A;  3F75 A;  1BQI A;  2R9F A;  3PNR A;  2B1N A;  3N3G A;  2YJ2 A;  1YVB A;  3HD3 A;  2Y6E A;  1SNK A;  2CIO A;  4OEL A;  3F5V A;  5FPW A;  2XU4 A;  1MS6 A;  3KSE A;  2AU1 A;  2YJB A;  2YJ9 A;  1NLJ A;  1TU6 A;  2PBH A;  3OF8 A;  3CBJ A;  4BS5 A;  2XU1 A;  2DZY A;  2F1G A;  3H6S A;  1DF0 A;  3S3R A;  3CH3 X;  1PE6 A;  2OUL A;  3H89 A;  1ZCM A;  2G6D A;  3PW3 A;  4YYR A;  1U9V A;  4YV8 A;  5K16 A;  2AUZ A;  4X6I A;  2BDL A;  3H8B A;  4Q8G A;  3V6E A;  3CBK A;  3AI8 A;  2AUX A;  3N3K A;  2R6N A;  2P7U A;  2YJ8 A;  2DZZ A;  1YK7 A;  2O6X A;  3U8E A;  5J94 A;  5JH3 A;  4CZW A;  4W5C A;  1QMY A;  1AYW A;  2DCB A;  4YYS A;  1MHW A;  1SP4 B;  2FQ9 A;  3BC3 A;  3K8U A;  4CDF B;  3QSD A;  4BSQ A;  4BS6 A;  1KHP A;  2E03 A;  3H8C A;  2IBI A;  1NB5 A;  2G8J A;  1VJV A;  3BPM A;  4K7C A;  1YAL A;  2PRE A;  4N8W A;  1EWM A;  2R9C A;  1XKG A;  1F29 A;  4RY2 A;  1MEM A;  1PCI A;  2PAD A;  3MHH A;  3WXG A;  5JA7 A;  2FUD A;  3D6S A;  3BOW A;  2GFO A;  2OP3 A;  1VSN A;  2R9N A;  1O0E A;  1PBH A;  2DCC A;  3ERV A;  1DEU A;  2F7D A;  1KFX L;  3LXS A;  1ICF A;  1PPP A;  1ZIV A;  2AYO A;  1THE A;  4FIP A;  3KWB X;  3RVW A;  3PDF A;  2FYE A;  4I04 A;  1CB5 A;  4W4U A; 
#chains in the Genus database with same CATH topology
 2XU3 A;  3V6C A;  4BOZ A;  1YT7 A;  1PPN A;  4DMY A;  2P86 A;  4HWY A;  2E02 A;  2HD5 A;  3O0U A;  3IV2 A;  5CVO B;  2B1M A;  5PAD A;  5CVN B;  5CVM A;  4D8E A;  1AU3 A;  1U9W A;  4QRG A;  2NQI A;  4CDE B;  1UKF A;  3GCB A;  4OVZ B;  2YJC A;  3DF0 A;  4PI3 A;  4P16 A;  1QDQ A;  4QRV A;  4MSX A;  1CPJ A;  1MDW A;  3W31 A;  1BP4 A;  1EWL A;  2P0R A;  4RNA A;  1TL9 A;  1QOL A;  4X6H A;  4I05 A;  1BGO A;  4PT5 A;  2DCA A;  5A24 A;  3OVZ A;  3OIS A;  9PAP A;  1Y4H A;  4D8I A;  1GMY A;  1MEG A;  3B21 A;  4G54 A;  3KX1 A;  1YK8 A;  1ATK A;  4FK5 A;  3E9S A;  1NL6 A;  2PNS A;  3P5U A;  3PBH A;  4REZ A;  4YVA A;  2JQG R;  3MOR A;  2HXZ A;  2R9M A;  3BWK A;  3KKU A;  2NQG A;  1ITO A;  4XZX A;  1CQD A;  4XR7 A;  1AU4 A;  1CJL A;  1ME3 A;  3OQC A;  4QRX A;  2ATO A;  1U5I A;  4YYW A;  2E00 A;  1HUC B;  1PVJ A;  3KWZ A;  3C0R A;  2DJG B;  1PIP A;  1QXP A;  2OZ2 A;  1STF E;  3WXE A;  1AYV A;  1F2B A;  1EWP A;  4MZO A;  4D8B A;  3IMA A;  4CDD B;  4XUI A;  4ZUX U;  2XU5 A;  3M99 A;  3PSE A;  2FT2 A;  3QJ3 A;  5F02 A;  3LFY A;  2AVW A;  2FTD A;  3QT4 A;  1AYU A;  4YYQ A;  8PCH A;  1AU0 A;  1GEC E;  3BBA A;  3IHP A;  1GCB A;  3BCN A;  4MZS A;  1FH0 A;  2DC9 A;  3BPF A;  2VHS A;  4DMX A;  2CB5 A;  3B79 A;  1EF7 A;  4P6E A;  3MTN A;  3HWN A;  1NB3 A;  1CS8 A;  1U9Q X;  3ZUA A;  1TLO A;  2J7Q C;  2G7Y A;  4PAD A;  2ACT A;  1Y08 A;  2HWK A;  4Q8H A;  3IFU A;  4WA6 A;  4W5B A;  3NHE A;  4FJC A;  3H7D A;  3IUT A;  4QBB A;  3HHA A;  4OEM A;  2HH5 A;  2AS8 A;  2BTW A;  4X6J A;  1MIR A;  3O1G A;  2DC6 A;  3RVX A;  1KXR A;  4QH6 A;  3HHI A;  1PPD A;  1YZB A;  1POP A;  1A6R A;  1AU2 A;  2C0Y A;  3KFQ A;  3IEJ A;  1CTE A;  3E1Z B;  5EF4 A;  2DC7 A;  7PCK A;  2Y5B A;  1CV8 A;  1PPO A;  3P5W A;  2FO5 A;  1BY8 A;  4N79 A;  2BDZ A;  4PP1 A;  1NPZ A;  2NQD B;  4GUA A;  4P6G A;  6PAD A;  5JZE A;  1AIM A;  1S4V A;  1U9X A;  3MJ5 A;  3RNV A;  3C9E A;  2G8E A;  3I06 A;  2JRI A;  4BQV A;  2WBF X;  2VHF A;  5EZS A;  2AYN A;  1F2A A;  3I3T A;  3TNX A;  3MHS A;  3RVV A;  4I07 A;  3K24 A;  2FRQ A;  4ZTB A;  1X9Y A;  1PAD A;  4BOU A;  4PP2 E;  3BY4 A;  3PRP A;  3WXF A;  4AXM A;  4AXL A;  3TMP A;  2DC8 A;  2JQF R;  3KW9 A;  5EGW A;  3S3Q A;  4KLB A;  3IOQ A;  1DKI A;  3PRM A;  1AEC A;  2ARY A;  2GHU A;  1KFU L;  4OW0 A;  3K9M A;  1ME4 A;  4YYV A;  5CHT A;  2E01 A;  4A5U A;  5KO3 A;  3ZNH A;  1KHQ A;  3N4C A;  3OVX A;  3P5V A;  5E6J A;  3CH2 X;  2FRA A;  2DJF B;  2AGA A;  2IPP B;  2BU3 A;  4WUR A;  1CSB B;  4N4Z A;  1F2C A;  2DCD A;  1M6D A;  1Q6K A;  1CVZ A;  2R9O A;  5CHV A;  4CDC B;  2H7J A;  3USV A;  4YYU A;  1NQC A;  3O65 A;  2HHN A;  2NQA A;  3PHU A;  1JQP A;  1IWD A;  3P5X A;  1K3B B;  1EWO A;  3OF9 A;  1PXV A;  2AIM A;  4BPV A;  1GLO A;  3F75 A;  1BQI A;  2R9F A;  3PNR A;  2BTW B;  2B1N A;  3N3G A;  2YJ2 A;  1YVB A;  3HD3 A;  2Y6E A;  1SNK A;  2CIO A;  4OEL A;  3F5V A;  4RKX A;  5FPW A;  2UZJ A;  4M0W A;  4BOQ A;  2XU4 A;  3PHW A;  1MS6 A;  3KSE A;  2AU1 A;  2YJB A;  2YJ9 A;  1NLJ A;  1TU6 A;  2PBH A;  3OF8 A;  4BOP A;  3CBJ A;  4BS5 A;  4OVZ A;  2XU1 A;  4HXD B;  2Z84 A;  2DZY A;  2F1G A;  3H6S A;  1DF0 A;  3S3R A;  3CH3 X;  1PE6 A;  2OUL A;  3H89 A;  4IUM A;  1ZCM A;  2G6D A;  3PW3 A;  4YYR A;  1U9V A;  4YV8 A;  5K16 A;  2AUZ A;  4X6I A;  5EZQ A;  2BDL A;  3H8B A;  4Q8G A;  3V6E A;  3CBK A;  3AI8 A;  2AUX A;  3N3K A;  2R6N A;  2P7U A;  2YJ8 A;  2DZZ A;  1YK7 A;  2O6X A;  3U8E A;  5J94 A;  5JH3 A;  4MM3 B;  4CZW A;  4W5C A;  1QMY A;  2FE8 A;  1AYW A;  2DOS A;  2DCB A;  4YYS A;  1MHW A;  1SP4 B;  2FQ9 A;  3BC3 A;  3K8U A;  4CDF B;  3QSD A;  4BSQ A;  4BS6 A;  3MTV A;  1KHP A;  4R3D A;  2E03 A;  4MI7 A;  4BOS A;  3BB7 A;  3H8C A;  4IP3 A;  2IBI A;  1NB5 A;  2G8J A;  1VJV A;  3BPM A;  4RF1 A;  4K7C A;  1YAL A;  2PRE A;  4N8W A;  1EWM A;  2R9C A;  1XKG A;  1F29 A;  4RY2 A;  3TRK A;  1MEM A;  1PCI A;  2PAD A;  2JTC A;  3PHX A;  3MHH A;  3WXG A;  5JA7 A;  2FUD A;  3PT2 A;  3D6S A;  2J7Q A;  2GFO A;  3BOW A;  2OP3 A;  1VSN A;  2R9N A;  1O0E A;  1PBH A;  2DCC A;  3ERV A;  3MP2 A;  1DEU A;  2F7D A;  3W30 A;  1KFX L;  3LXS A;  1ICF A;  1PPP A;  1ZIV A;  2AYO A;  1THE A;  4FIP A;  3KWB X;  3RVW A;  3PDF A;  2FYE A;  4I04 A;  4RF0 A;  1CB5 A;  4W4U A; 
#chains in the Genus database with same CATH homology
 2XU3 A;  3V6C A;  1YT7 A;  1PPN A;  4DMY A;  2P86 A;  4HWY A;  2E02 A;  2HD5 A;  3O0U A;  3IV2 A;  5CVO B;  2B1M A;  5PAD A;  5CVN B;  5CVM A;  1AU3 A;  1U9W A;  4QRG A;  2NQI A;  4CDE B;  3GCB A;  2YJC A;  3DF0 A;  4PI3 A;  1QDQ A;  4QRV A;  4MSX A;  1CPJ A;  1MDW A;  1BP4 A;  1EWL A;  2P0R A;  1TL9 A;  1QOL A;  4X6H A;  4I05 A;  1BGO A;  2DCA A;  5A24 A;  3OVZ A;  3OIS A;  9PAP A;  1Y4H A;  1GMY A;  1MEG A;  4G54 A;  3KX1 A;  1YK8 A;  1ATK A;  4FK5 A;  1NL6 A;  2PNS A;  3P5U A;  3PBH A;  4YVA A;  2JQG R;  3MOR A;  2HXZ A;  2R9M A;  3BWK A;  3LTW A;  3KKU A;  2NQG A;  1ITO A;  1CQD A;  4XR7 A;  1AU4 A;  1CJL A;  1ME3 A;  4QRX A;  2ATO A;  1U5I A;  4YYW A;  2E00 A;  1HUC B;  3KWZ A;  2DJG B;  1PIP A;  1QXP A;  2OZ2 A;  1STF E;  3WXE A;  1AYV A;  1F2B A;  1EWP A;  4MZO A;  3IMA A;  4CDD B;  4XUI A;  4ZUX U;  2XU5 A;  3M99 A;  3QJ3 A;  2FT2 A;  5F02 A;  3LFY A;  2AVW A;  2FTD A;  3QT4 A;  1AYU A;  4YYQ A;  8PCH A;  1AU0 A;  1GEC E;  3IHP A;  1GCB A;  3BCN A;  4MZS A;  1FH0 A;  2DC9 A;  3BPF A;  2VHS A;  4DMX A;  2CB5 A;  3B79 A;  1EF7 A;  4P6E A;  3MTN A;  3HWN A;  1NB3 A;  1CS8 A;  1U9Q X;  3ZUA A;  1TLO A;  2G7Y A;  4PAD A;  2ACT A;  1Y08 A;  4Q8H A;  4WA6 A;  4W5B A;  3NHE A;  4FJC A;  3H7D A;  3IUT A;  4QBB A;  3HHA A;  4OEM A;  2HH5 A;  2AS8 A;  1W6F A;  4X6J A;  1MIR A;  3O1G A;  2DC6 A;  3RVX A;  1KXR A;  4QH6 A;  4NV7 A;  3HHI A;  1PPD A;  1POP A;  1A6R A;  1AU2 A;  2C0Y A;  3KFQ A;  3IEJ A;  1CTE A;  3E1Z B;  5EF4 A;  2DC7 A;  7PCK A;  2Y5B A;  1CV8 A;  1PPO A;  4NV8 A;  3P5W A;  2FO5 A;  1BY8 A;  4N79 A;  2BDZ A;  4PP1 A;  1NPZ A;  2NQD B;  4P6G A;  6PAD A;  1AIM A;  1S4V A;  1U9X A;  3D9W A;  3C9E A;  2G8E A;  3I06 A;  4BQV A;  2WBF X;  2VHF A;  2AYN A;  1F2A A;  3I3T A;  3TNX A;  3MHS A;  3RVV A;  4I07 A;  3K24 A;  2FRQ A;  1X9Y A;  1PAD A;  4PP2 E;  1E2T A;  3WXF A;  4AXM A;  4AXL A;  2DC8 A;  4GUZ A;  2JQF R;  3KW9 A;  5EGW A;  3S3Q A;  4KLB A;  3IOQ A;  1AEC A;  2ARY A;  2GHU A;  1KFU L;  3K9M A;  1ME4 A;  4YYV A;  5CHT A;  2E01 A;  1KHQ A;  3N4C A;  3OVX A;  3P5V A;  3CH2 X;  2FRA A;  2DJF B;  1W4T A;  2IPP B;  1CSB B;  4N4Z A;  1F2C A;  2DCD A;  1M6D A;  1Q6K A;  1CVZ A;  2R9O A;  5CHV A;  4B55 A;  4CDC B;  2H7J A;  3USV A;  4YYU A;  1NQC A;  2HHN A;  2NQA A;  1JQP A;  1IWD A;  2VFC A;  3P5X A;  1K3B B;  1EWO A;  3OF9 A;  1PXV A;  2AIM A;  4BPV A;  1GLO A;  3F75 A;  1BQI A;  2R9F A;  3PNR A;  2B1N A;  3N3G A;  2YJ2 A;  1YVB A;  3HD3 A;  2Y6E A;  1SNK A;  2CIO A;  4OEL A;  3F5V A;  5FPW A;  2XU4 A;  1MS6 A;  3KSE A;  2AU1 A;  2YJB A;  2YJ9 A;  1NLJ A;  1TU6 A;  2PBH A;  3OF8 A;  3CBJ A;  4BS5 A;  2XU1 A;  2DZY A;  2F1G A;  3H6S A;  1DF0 A;  3S3R A;  3CH3 X;  1PE6 A;  2OUL A;  3H89 A;  1ZCM A;  2G6D A;  3PW3 A;  4YYR A;  1U9V A;  4YV8 A;  5K16 A;  2AUZ A;  4X6I A;  2BDL A;  2VFB A;  3H8B A;  4Q8G A;  3V6E A;  4C5P A;  3CBK A;  3AI8 A;  2AUX A;  3N3K A;  2R6N A;  2P7U A;  2YJ8 A;  2DZZ A;  1YK7 A;  2O6X A;  3U8E A;  5J94 A;  5JH3 A;  4CZW A;  4W5C A;  1QMY A;  1AYW A;  2DCB A;  4YYS A;  4BGF A;  1MHW A;  1SP4 B;  2FQ9 A;  3BC3 A;  3K8U A;  4CDF B;  3QSD A;  4BSQ A;  4BS6 A;  1KHP A;  2E03 A;  3H8C A;  2IBI A;  1NB5 A;  2G8J A;  1VJV A;  3BPM A;  4K7C A;  1YAL A;  2PRE A;  4N8W A;  1EWM A;  2R9C A;  1XKG A;  1F29 A;  4RY2 A;  2BSZ A;  1MEM A;  1GX3 A;  1PCI A;  2PAD A;  3MHH A;  3WXG A;  5JA7 A;  2FUD A;  3D6S A;  3BOW A;  2GFO A;  2OP3 A;  1VSN A;  2R9N A;  1O0E A;  1PBH A;  2DCC A;  3ERV A;  1DEU A;  2F7D A;  1KFX L;  3LXS A;  1ICF A;  1PPP A;  1ZIV A;  2AYO A;  1THE A;  4FIP A;  3KWB X;  3RVW A;  3PDF A;  2FYE A;  1W5R A;  4I04 A;  1CB5 A;  4W4U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...