4IUMA

Equine arteritis virus papain-like protease 2 (plp2) covalently bound to ubiquitin
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
127
structure length
127
Chain Sequence
GYNPPGDGACGYRCLAFMNGATVVSAGCSSDLWCDDELAYRVFQLSPTFTVTIPGGRVCPNAKYAMICDKQHWRVKRAKGVGLCLDESCFRGICNCQRMSGPPPAPVSAAVLDHILEAATFGNVRVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/protein binding
molecule keywords papain-like protease 2
publication title Deubiquitinase function of arterivirus papain-like protease 2 suppresses the innate immune response in infected host cells.
pubmed doi rcsb
source organism Equine arteritis virus
total genus 36
structure length 127
sequence length 127
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2013-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05412 Peptidase_C33 Equine arterivirus Nsp2-type cysteine proteinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.160 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4iumA00
4IUMA
chains in the Genus database with same CATH superfamily
4I04A 2XU3A 3IOQA 2NQIA 4DMXA 1PPOA 1SP4B 4PP2E 1CB5A 4RY2A 3F5VA 2DCDA 1X9YA 2OZ2A 1AIMA 7PCKA 1PPPA 2DCBA 1HUCB 2Y6EA 3BY4A 2P86A 4WA6A 4W5CA 4PT5A 1A6RA 4REZA 1MIRA 3PT2A 2WBFX 3HHIA 3KFQA 8PCHA 1TLOA 1DEUA 1U9XA 2ARYA 5EZSA 3PDFA 2O6XA 3IV2A 3ZUAA 4YYVA 1BP4A 4RF1A 2R9OA 2R9CA 1Q6KA 4QRVA 4ZUXU 1U9VA 1U5IA 1CPJA 3USVA 1ZIVA 4R3DA 2FTDA 4W5BA 2DJFB 4BOZA 4OEMA 2DOSA 1CJLA 2YJ9A 3BB7A 5E6JA 1CTEA 3MTVA 2UZJA 3OF8A 1IWDA 4X6JA 2AVWA 2VHSA 3PHXA 1QDQA 2OP3A 1SNKA 3MP2A 4N4ZA 3KWBX 3OQCA 4IUMA 3N3KA 4XZXA 2G7YA 4QRXA 2BU3A 3PHUA 3TNXA 4CDCB 1AYUA 5CVMA 2DC8A 1NQCA 1QOLA 4D8IA 3BC3A 3HWNA 2FRQA 2DC7A 2XU4A 4D8BA 3WXEA 2HD5A 4RNAA 2AUZA 3KWZA 1VSNA 4OVZB 1KHPA 3I06A 1AYWA 2FT2A 3HD3A 3C0RA 1BY8A 4XUIA 3RNVA 5EGWA 3TMPA 2GFOA 3KW9A 4YYSA 1UKFA 1QMYA 4AXMA 2IBIA 2HH5A 2H7JA 1AU3A 3K8UA 4P16A 4I05A 2BTWB 4XR7A 2OULA 3KSEA 1AYVA 3QJ3A 4OVZA 2PADA 4BSQA 2HXZA 3RVXA 2E00A 2DC9A 3LXSA 1TU6A 2B1NA 4CDEB 1GECE 2JQGR 3MORA 5JH3A 2BTWA 4FIPA 4P6EA 3OVXA 2FQ9A 3HHAA 2F1GA 3BPFA 3GCBA 3QT4A 4X6IA 3O0UA 4M0WA 4BOPA 3AI8A 2YJ2A 3U8EA 1YVBA 2Y5BA 1GLOA 9PAPA 1YK7A 4Q8GA 1BGOA 1EF7A 3BWKA 3IMAA 3I3TA 4WURA 3RVWA 1ZCMA 1EWLA 1U9WA 4MZSA 3H89A 3PNRA 4I07A 4MZOA 2Z84A 1PCIA 2GHUA 2DC6A 3IEJA 2G8JA 1THEA 4PP1A 3BBAA 4IP3A 1EWOA 3OISA 1POPA 3CBJA 2P0RA 4CDDB 1KXRA 2ACTA 4G54A 1F2BA 1PVJA 3MHHA 4YYWA 1CS8A 4QH6A 2PREA 1NPZA 4GUAA 3MTNA 3KKUA 4K7CA 1CQDA 4P6GA 1NLJA 3RVVA 2AYNA 2FO5A 2B1MA 4D8EA 3W30A 1TL9A 3DF0A 3OF9A 3WXGA 1MDWA 2BDZA 3O1GA 3H8CA 1NL6A 3PBHA 2G6DA 1AU0A 2AU1A 3BPMA 4BOQA 3V6CA 2FUDA 2HHNA 1AU2A 3PRPA 1GMYA 3C9EA 2R9NA 4CZWA 5CHTA 1MHWA 3P5UA 2ATOA 3NHEA 5KO3A 2YJCA 4Q8HA 1KHQA 3P5WA 2G8EA 2CIOA 1Y4HA 3S3RA 1ITOA 1F29A 1PPNA 1CVZA 1JQPA 1EWPA 2NQGA 4QBBA 4OW0A 2F7DA 1PADA 4DMYA 5JA7A 2PBHA 1YZBA 3MJ5A 3QSDA 4FK5A 2FYEA 1MS6A 2JQFR 2PNSA 1MEGA 2J7QA 1AECA 3P5XA 3CBKA 2FRAA 4W4UA 1NB5A 2AGAA 2DZZA 6PADA 3WXFA 4YYRA 1VJVA 3H6SA 1XKGA 1KFXL 4KLBA 1PIPA 3PSEA 5FPWA 4MI7A 3M99A 4AXLA 1ME4A 5PADA 3F75A 3K24A 1CSBB 1NB3A 1PE6A 2DJGB 2YJBA 1MEMA 3KX1A 2R9MA 2NQAA 4CDFB 1Y08A 4YYUA 3P5VA 1PPDA 5EZQA 1F2CA 1PBHA 3IUTA 1GCBA 1ATKA 3BCNA 2JRIA 3D6SA 4RF0A 2AIMA 4FJCA 1M6DA 1O0EA 3PW3A 2AYOA 2BDLA 2CB5A 5A24A 3IHPA 2FE8A 1DF0A 1PXVA 3OVZA 2JTCA 2R6NA 2C0YA 4MM3B 4YV8A 4PADA 1AU4A 5CVNB 4MSXA 3ZNHA 4RKXA 1DKIA 3MHSA 5K16A 4YYQA 4PI3A 4X6HA 1YT7A 4QRGA 3N3GA 4BOSA 4BOUA 2AS8A 1FH0A 2DZYA 1EWMA 1ME3A 5J94A 3H8BA 2XU1A 1YALA 3B21A 4BS6A 3K9MA 3W31A 2IPPB 4OELA 1STFE 2VHFA 2DCCA 2J7QC 2E01A 3CH2X 1CV8A 4ZTBA 4YVAA 2XU5A 3CH3X 3ERVA 5EF4A 4N79A 4BQVA 2HWKA 3N4CA 5JZEA 3IFUA 5CVOB 5F02A 3B79A 3E1ZB 4N8WA 1KFUL 4HXDB 3PRMA 4BS5A 5CHVA 3V6EA 1F2AA 2E02A 2P7UA 1YK8A 3S3QA 4HWYA 3LFYA 2R9FA 4A5UA 4BPVA 1BQIA 2YJ8A 1U9QX 3PHWA 1S4VA 2E03A 3TRKA 3H7DA 3O65A 2DCAA 3BOWA 3E9SA 1QXPA 1ICFA 2AUXA 1K3BB 2NQDB
chains in the Genus database with same CATH topology
3BBAA 4IP3A 4D8BA 5EZQA 4RNAA 4OVZB 2JRIA 4RF0A 3C0RA 1PVJA 3RNVA 3TMPA 1UKFA 3BY4A 4GUAA 4P16A 4PT5A 2BTWB 2FE8A 4REZA 2JTCA 3PT2A 4MM3B 4D8EA 3W30A 4OVZA 5EZSA 3ZNHA 4RKXA 1DKIA 4BOQA 4RF1A 4BOSA 4BOUA 3PRPA 3B21A 2BTWA 3W31A 2J7QC 5KO3A 4R3DA 4ZTBA 4BOZA 4M0WA 4BOPA 2DOSA 3BB7A 5E6JA 3MTVA 2UZJA 2HWKA 4OW0A 5JZEA 3IFUA 1YZBA 3MJ5A 3PHXA 4HXDB 3PRMA 4WURA 2J7QA 3MP2A 3OQCA 4IUMA 2AGAA 4XZXA 4A5UA 2BU3A 3PHUA 3PHWA 3PSEA 3TRKA 3O65A 4MI7A 3E9SA 2Z84A 4D8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IUM A; 
#chains in the Genus database with same CATH topology
 4I04 A;  2XU3 A;  3IOQ A;  2NQI A;  4DMX A;  1PPO A;  1SP4 B;  4PP2 E;  1CB5 A;  4RY2 A;  3F5V A;  2DCD A;  1X9Y A;  2OZ2 A;  1AIM A;  7PCK A;  1PPP A;  2DCB A;  1HUC B;  2Y6E A;  3BY4 A;  2P86 A;  4WA6 A;  4W5C A;  4PT5 A;  1A6R A;  4REZ A;  1MIR A;  3PT2 A;  2WBF X;  3HHI A;  3KFQ A;  8PCH A;  1TLO A;  1DEU A;  1U9X A;  2ARY A;  5EZS A;  3PDF A;  2O6X A;  3IV2 A;  3ZUA A;  4YYV A;  1BP4 A;  4RF1 A;  2R9O A;  2R9C A;  1Q6K A;  4QRV A;  4ZUX U;  1U9V A;  1U5I A;  1CPJ A;  3USV A;  1ZIV A;  4R3D A;  2FTD A;  4W5B A;  2DJF B;  4BOZ A;  4OEM A;  2DOS A;  1CJL A;  2YJ9 A;  3BB7 A;  5E6J A;  1CTE A;  3MTV A;  2UZJ A;  3OF8 A;  1IWD A;  4X6J A;  2AVW A;  2VHS A;  3PHX A;  1QDQ A;  2OP3 A;  1SNK A;  3MP2 A;  4N4Z A;  3KWB X;  3OQC A;  4IUM A;  3N3K A;  4XZX A;  2G7Y A;  4QRX A;  2BU3 A;  3PHU A;  3TNX A;  4CDC B;  1AYU A;  5CVM A;  2DC8 A;  1NQC A;  1QOL A;  4D8I A;  3BC3 A;  3HWN A;  2FRQ A;  2DC7 A;  2XU4 A;  4D8B A;  3WXE A;  2HD5 A;  4RNA A;  2AUZ A;  3KWZ A;  1VSN A;  4OVZ B;  1KHP A;  3I06 A;  1AYW A;  2FT2 A;  3HD3 A;  3C0R A;  1BY8 A;  4XUI A;  3RNV A;  5EGW A;  3TMP A;  2GFO A;  3KW9 A;  4YYS A;  1UKF A;  1QMY A;  4AXM A;  2IBI A;  2HH5 A;  2H7J A;  1AU3 A;  3K8U A;  4P16 A;  4I05 A;  2BTW B;  4XR7 A;  2OUL A;  3KSE A;  1AYV A;  3QJ3 A;  4OVZ A;  2PAD A;  4BSQ A;  2HXZ A;  3RVX A;  2E00 A;  2DC9 A;  3LXS A;  1TU6 A;  2B1N A;  4CDE B;  1GEC E;  2JQG R;  3MOR A;  5JH3 A;  2BTW A;  4FIP A;  4P6E A;  3OVX A;  2FQ9 A;  3HHA A;  2F1G A;  3BPF A;  3GCB A;  3QT4 A;  4X6I A;  3O0U A;  4M0W A;  4BOP A;  3AI8 A;  2YJ2 A;  3U8E A;  1YVB A;  2Y5B A;  1GLO A;  9PAP A;  1YK7 A;  4Q8G A;  1BGO A;  1EF7 A;  3BWK A;  3IMA A;  3I3T A;  4WUR A;  3RVW A;  1ZCM A;  1EWL A;  1U9W A;  4MZS A;  3H89 A;  3PNR A;  4I07 A;  4MZO A;  2Z84 A;  1PCI A;  2GHU A;  2DC6 A;  3IEJ A;  2G8J A;  1THE A;  4PP1 A;  3BBA A;  4IP3 A;  1EWO A;  3OIS A;  1POP A;  3CBJ A;  2P0R A;  4CDD B;  1KXR A;  2ACT A;  4G54 A;  1F2B A;  1PVJ A;  3MHH A;  4YYW A;  1CS8 A;  4QH6 A;  2PRE A;  1NPZ A;  4GUA A;  3MTN A;  3KKU A;  4K7C A;  1CQD A;  4P6G A;  1NLJ A;  3RVV A;  2AYN A;  2FO5 A;  2B1M A;  4D8E A;  3W30 A;  1TL9 A;  3DF0 A;  3OF9 A;  3WXG A;  1MDW A;  2BDZ A;  3O1G A;  3H8C A;  1NL6 A;  3PBH A;  2G6D A;  1AU0 A;  2AU1 A;  3BPM A;  4BOQ A;  3V6C A;  2FUD A;  2HHN A;  1AU2 A;  3PRP A;  1GMY A;  3C9E A;  2R9N A;  4CZW A;  5CHT A;  1MHW A;  3P5U A;  2ATO A;  3NHE A;  5KO3 A;  2YJC A;  4Q8H A;  1KHQ A;  3P5W A;  2G8E A;  2CIO A;  1Y4H A;  3S3R A;  1ITO A;  1F29 A;  1PPN A;  1CVZ A;  1JQP A;  1EWP A;  2NQG A;  4QBB A;  4OW0 A;  2F7D A;  1PAD A;  4DMY A;  5JA7 A;  2PBH A;  1YZB A;  3MJ5 A;  3QSD A;  4FK5 A;  2FYE A;  1MS6 A;  2JQF R;  2PNS A;  1MEG A;  2J7Q A;  1AEC A;  3P5X A;  3CBK A;  2FRA A;  4W4U A;  1NB5 A;  2AGA A;  2DZZ A;  6PAD A;  3WXF A;  4YYR A;  1VJV A;  3H6S A;  1XKG A;  1KFX L;  4KLB A;  1PIP A;  3PSE A;  5FPW A;  4MI7 A;  3M99 A;  4AXL A;  1ME4 A;  5PAD A;  3F75 A;  3K24 A;  1CSB B;  1NB3 A;  1PE6 A;  2DJG B;  2YJB A;  1MEM A;  3KX1 A;  2R9M A;  2NQA A;  4CDF B;  1Y08 A;  4YYU A;  3P5V A;  1PPD A;  5EZQ A;  1F2C A;  1PBH A;  3IUT A;  1GCB A;  1ATK A;  3BCN A;  2JRI A;  3D6S A;  4RF0 A;  2AIM A;  4FJC A;  1M6D A;  1O0E A;  3PW3 A;  2AYO A;  2BDL A;  2CB5 A;  5A24 A;  3IHP A;  2FE8 A;  1DF0 A;  1PXV A;  3OVZ A;  2JTC A;  2R6N A;  2C0Y A;  4MM3 B;  4YV8 A;  4PAD A;  1AU4 A;  5CVN B;  4MSX A;  3ZNH A;  4RKX A;  1DKI A;  3MHS A;  5K16 A;  4YYQ A;  4PI3 A;  4X6H A;  1YT7 A;  4QRG A;  3N3G A;  4BOS A;  4BOU A;  2AS8 A;  1FH0 A;  2DZY A;  1EWM A;  1ME3 A;  5J94 A;  3H8B A;  2XU1 A;  1YAL A;  3B21 A;  4BS6 A;  3K9M A;  3W31 A;  2IPP B;  4OEL A;  1STF E;  2VHF A;  2DCC A;  2J7Q C;  2E01 A;  3CH2 X;  1CV8 A;  4ZTB A;  4YVA A;  2XU5 A;  3CH3 X;  3ERV A;  5EF4 A;  4N79 A;  4BQV A;  2HWK A;  3N4C A;  5JZE A;  3IFU A;  5CVO B;  5F02 A;  3B79 A;  3E1Z B;  4N8W A;  1KFU L;  4HXD B;  3PRM A;  4BS5 A;  5CHV A;  3V6E A;  1F2A A;  2E02 A;  2P7U A;  1YK8 A;  3S3Q A;  4HWY A;  3LFY A;  2R9F A;  4A5U A;  4BPV A;  1BQI A;  2YJ8 A;  1U9Q X;  3PHW A;  1S4V A;  2E03 A;  3TRK A;  3H7D A;  3O65 A;  2DCA A;  3BOW A;  3E9S A;  1QXP A;  1ICF A;  2AUX A;  1K3B B;  2NQD B; 
#chains in the Genus database with same CATH homology
 3BBA A;  4IP3 A;  4D8B A;  5EZQ A;  4RNA A;  4OVZ B;  2JRI A;  4RF0 A;  3C0R A;  1PVJ A;  3RNV A;  3TMP A;  1UKF A;  3BY4 A;  4GUA A;  4P16 A;  4PT5 A;  2BTW B;  2FE8 A;  4REZ A;  2JTC A;  3PT2 A;  4MM3 B;  4D8E A;  3W30 A;  4OVZ A;  5EZS A;  3ZNH A;  4RKX A;  1DKI A;  4BOQ A;  4RF1 A;  4BOS A;  4BOU A;  3PRP A;  3B21 A;  2BTW A;  3W31 A;  2J7Q C;  5KO3 A;  4R3D A;  4ZTB A;  4BOZ A;  4M0W A;  4BOP A;  2DOS A;  3BB7 A;  5E6J A;  3MTV A;  2UZJ A;  2HWK A;  4OW0 A;  5JZE A;  3IFU A;  1YZB A;  3MJ5 A;  3PHX A;  4HXD B;  3PRM A;  4WUR A;  2J7Q A;  3MP2 A;  3OQC A;  4IUM A;  2AGA A;  4XZX A;  4A5U A;  2BU3 A;  3PHU A;  3PHW A;  3PSE A;  3TRK A;  3O65 A;  4MI7 A;  3E9S A;  2Z84 A;  4D8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...