4IUMA

Equine arteritis virus papain-like protease 2 (plp2) covalently bound to ubiquitin
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
127
structure length
127
Chain Sequence
GYNPPGDGACGYRCLAFMNGATVVSAGCSSDLWCDDELAYRVFQLSPTFTVTIPGGRVCPNAKYAMICDKQHWRVKRAKGVGLCLDESCFRGICNCQRMSGPPPAPVSAAVLDHILEAATFGNVRVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Deubiquitinase function of arterivirus papain-like protease 2 suppresses the innate immune response in infected host cells.
pubmed doi rcsb
source organism Equine arteritis virus
molecule tags Hydrolase/protein binding
molecule keywords papain-like protease 2
total genus 36
structure length 127
sequence length 127
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2013-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05412 Peptidase_C33 Equine arterivirus Nsp2-type cysteine proteinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.160 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4iumA00
4IUMA
chains in the Genus database with same CATH superfamily
4RF0A 2DC8A 2R9CA 4WA6A 3TRKA 1DKIA 2FUDA 3OVZA 1AIMA 1PPNA 3QSDA 2BTWB 1EWMA 2P7UA 4K7CA 4DMYA 2VHFA 1F2AA 4X6IA 4HXDB 4BOPA 4FK5A 2AVWA 3BY4A 1X9YA 4HWYA 2XU3A 3MHSA 1CB5A 2FTDA 3TNXA 5CVNB 3W31A 4RKXA 2PNSA 2B1MA 5F02A 1JQPA 4DMXA 1YT7A 2PADA 3PT2A 4XZXA 4QBBA 3MTVA 4OVZA 1S4VA 2DC7A 1AU0A 2DZZA 1MHWA 3QT4A 4IUMA 2G6DA 3V6CA 5EZQA 4YYRA 1QXPA 3I06A 3B21A 3IOQA 3K9MA 4BOQA 1PE6A 1EF7A 2YJ2A 2HH5A 1EWLA 3HD3A 1U9XA 1Q6KA 3RVXA 4CDEB 1MDWA 3MHHA 2BDZA 1U9WA 2FQ9A 3E9SA 4XR7A 3WXFA 4BS5A 4MM3B 4Q8HA 2DJFB 2F7DA 4XUIA 1QMYA 3ZNHA 1ZCMA 4ZUXU 3P5XA 2AS8A 1F29A 4REZA 4OVZB 1CVZA 3CBJA 4N79A 1ITOA 3IUTA 1THEA 2ACTA 3CBKA 2GFOA 2AYNA 2NQGA 4BQVA 3OQCA 2DCCA 1PPDA 3B79A 2AUXA 2GHUA 3CH2X 3KWZA 1AU2A 4W4UA 2Z84A 3V6EA 2CIOA 1XKGA 2JRIA 4AXMA 1PCIA 4RY2A 2OP3A 2PREA 5JA7A 5EF4A 3WXEA 3PHWA 4Q8GA 2P0RA 1YVBA 2NQIA 2ARYA 1GMYA 1IWDA 1QDQA 5CVMA 1MIRA 2Y6EA 2AU1A 2J7QC 2H7JA 4PP1A 4YVAA 4X6JA 4PP2E 4P6GA 1MEGA 1Y4HA 2P86A 1STFE 2DOSA 1HUCB 2NQDB 4I05A 2FT2A 3MJ5A 3MTNA 4ZTBA 4D8BA 3OVXA 4GUAA 2FRQA 1TU6A 3LFYA 3D6SA 4I07A 5KO3A 8PCHA 2O6XA 3P5VA 3BWKA 1NB3A 1CS8A 1PBHA 1PXVA 3O0UA 2R9OA 1FH0A 4WURA 3BCNA 3RNVA 1BP4A 4YYSA 3RVVA 1ME4A 3K8UA 2YJ8A 3E1ZB 3IHPA 6PADA 1GLOA 3KFQA 3F75A 2B1NA 1CSBB 1K3BB 2C0YA 2DCBA 2YJ9A 2PBHA 4QRGA 5CHTA 3M99A 4MZOA 1Y08A 4AXLA 4PADA 1NL6A 3PBHA 4PI3A 3P5UA 1YZBA 3P5WA 3N3GA 3O1GA 5EGWA 3ERVA 4W5BA 2FRAA 2CB5A 2F1GA 1U9VA 2E00A 2JQFR 3PHXA 3F5VA 4D8IA 4FJCA 3MORA 3USVA 3K24A 3NHEA 3HHAA 2R9MA 3PDFA 2DZYA 4YYWA 7PCKA 2IPPB 4BPVA 1TL9A 2R9FA 1AYUA 3S3QA 3CH3X 1EWOA 1KHPA 2G8EA 3BC3A 4MI7A 1ME3A 1CPJA 3C9EA 1AYWA 5JH3A 5A24A 2FYEA 3H89A 4PT5A 1AECA 2AIMA 1DEUA 2E01A 2DCDA 1F2CA 3PNRA 4OW0A 3OF8A 4CDDB 2YJBA 4BOUA 1PVJA 4QH6A 1F2BA 3O65A 2BU3A 3IEJA 1ATKA 4MZSA 4A5UA 2UZJA 3PW3A 1NPZA 1YK7A 1PPOA 1ICFA 3U8EA 2XU5A 2DC6A 2OZ2A 4MSXA 2AGAA 1CJLA 1BQIA 4QRVA 1AU4A 1AU3A 2OULA 3IV2A 4W5CA 4QRXA 1O0EA 5FPWA 3H7DA 4RNAA 3H8BA 2R6NA 3KW9A 1UKFA 3DF0A 1KHQA 3PHUA 4CZWA 1U5IA 2HD5A 2BDLA 3PRPA 2JTCA 1YK8A 3I3TA 2YJCA 3MP2A 4N4ZA 4CDCB 1EWPA 2HHNA 3IMAA 4CDFB 1VJVA 9PAPA 4N8WA 2R9NA 2FO5A 1SP4B 4KLBA 3C0RA 4X6HA 3H6SA 1NQCA 3RVWA 4BSQA 3H8CA 2G8JA 4YV8A 3WXGA 1A6RA 1CV8A 4D8EA 3ZUAA 2J7QA 1NB5A 1BY8A 1GECE 3TMPA 1YALA 3KSEA 3LXSA 1U9QX 4OEMA 3IFUA 2E03A 3BPMA 4OELA 3OISA 1ZIVA 3QJ3A 1PPPA 2BTWA 3KKUA 1PIPA 2E02A 1CTEA 4YYUA 1BGOA 5EZSA 4FIPA 1KFXL 1MEMA 3N4CA 2DCAA 1MS6A 2DJGB 5CVOB 5K16A 2Y5BA 3PRMA 2XU4A 1DF0A 4G54A 3HHIA 4BS6A 2NQAA 4M0WA 5CHVA 5J94A 2AUZA 2ATOA 2IBIA 2XU1A 3OF9A 4IP3A 2VHSA 3S3RA 1SNKA 3GCBA 1KFUL 2WBFX 4BOSA 4BOZA 3BB7A 4RF1A 3KX1A 1VSNA 1POPA 2G7YA 1GCBA 1AYVA 2HWKA 1TLOA 1NLJA 4YYVA 3PSEA 4P16A 1KXRA 3HWNA 3BPFA 5PADA 3BOWA 2HXZA 1CQDA 3N3KA 5JZEA 2FE8A 1M6DA 4YYQA 2DC9A 2AYOA 4I04A 1QOLA 3BBAA 4P6EA 5E6JA 3KWBX 4R3DA 1PADA 3W30A 3AI8A 2JQGR
chains in the Genus database with same CATH topology
3PRMA 3IFUA 2AGAA 4RF0A 3MJ5A 3PSEA 3PHXA 4D8IA 3E9SA 4ZTBA 4P16A 4IUMA 4M0WA 1DKIA 4OW0A 3TRKA 4D8BA 3OQCA 2BTWA 3W31A 5EZQA 4GUAA 4BOUA 4IP3A 2BTWB 2FE8A 4RNAA 4RKXA 1PVJA 3B21A 3C0RA 5JZEA 3PHUA 4BOQA 1UKFA 5KO3A 4MM3B 2J7QC 3O65A 2BU3A 5EZSA 3ZNHA 4BOSA 4BOZA 3BB7A 4HXDB 3BBAA 3RNVA 5E6JA 1YZBA 3PRPA 4REZA 2Z84A 2JTCA 3PT2A 4OVZB 4R3DA 4RF1A 2JRIA 3BY4A 4XZXA 4A5UA 4BOPA 4D8EA 2UZJA 3MTVA 4OVZA 3W30A 2J7QA 4MI7A 4WURA 3MP2A 2DOSA 3TMPA 2HWKA 3PHWA 4PT5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IUM A; 
#chains in the Genus database with same CATH topology
 4RF0 A;  2DC8 A;  2R9C A;  4WA6 A;  3TRK A;  1DKI A;  2FUD A;  3OVZ A;  1AIM A;  1PPN A;  3QSD A;  2BTW B;  1EWM A;  2P7U A;  4K7C A;  4DMY A;  2VHF A;  1F2A A;  4X6I A;  4HXD B;  4BOP A;  4FK5 A;  2AVW A;  3BY4 A;  1X9Y A;  4HWY A;  2XU3 A;  3MHS A;  1CB5 A;  2FTD A;  3TNX A;  5CVN B;  3W31 A;  4RKX A;  2PNS A;  2B1M A;  5F02 A;  1JQP A;  4DMX A;  1YT7 A;  2PAD A;  3PT2 A;  4XZX A;  4QBB A;  3MTV A;  4OVZ A;  1S4V A;  2DC7 A;  1AU0 A;  2DZZ A;  1MHW A;  3QT4 A;  4IUM A;  2G6D A;  3V6C A;  5EZQ A;  4YYR A;  1QXP A;  3I06 A;  3B21 A;  3IOQ A;  3K9M A;  4BOQ A;  1PE6 A;  1EF7 A;  2YJ2 A;  2HH5 A;  1EWL A;  3HD3 A;  1U9X A;  1Q6K A;  3RVX A;  4CDE B;  1MDW A;  3MHH A;  2BDZ A;  1U9W A;  2FQ9 A;  3E9S A;  4XR7 A;  3WXF A;  4BS5 A;  4MM3 B;  4Q8H A;  2DJF B;  2F7D A;  4XUI A;  1QMY A;  3ZNH A;  1ZCM A;  4ZUX U;  3P5X A;  2AS8 A;  1F29 A;  4REZ A;  4OVZ B;  1CVZ A;  3CBJ A;  4N79 A;  1ITO A;  3IUT A;  1THE A;  2ACT A;  3CBK A;  2GFO A;  2AYN A;  2NQG A;  4BQV A;  3OQC A;  2DCC A;  1PPD A;  3B79 A;  2AUX A;  2GHU A;  3CH2 X;  3KWZ A;  1AU2 A;  4W4U A;  2Z84 A;  3V6E A;  2CIO A;  1XKG A;  2JRI A;  4AXM A;  1PCI A;  4RY2 A;  2OP3 A;  2PRE A;  5JA7 A;  5EF4 A;  3WXE A;  3PHW A;  4Q8G A;  2P0R A;  1YVB A;  2NQI A;  2ARY A;  1GMY A;  1IWD A;  1QDQ A;  5CVM A;  1MIR A;  2Y6E A;  2AU1 A;  2J7Q C;  2H7J A;  4PP1 A;  4YVA A;  4X6J A;  4PP2 E;  4P6G A;  1MEG A;  1Y4H A;  2P86 A;  1STF E;  2DOS A;  1HUC B;  2NQD B;  4I05 A;  2FT2 A;  3MJ5 A;  3MTN A;  4ZTB A;  4D8B A;  3OVX A;  4GUA A;  2FRQ A;  1TU6 A;  3LFY A;  3D6S A;  4I07 A;  5KO3 A;  8PCH A;  2O6X A;  3P5V A;  3BWK A;  1NB3 A;  1CS8 A;  1PBH A;  1PXV A;  3O0U A;  2R9O A;  1FH0 A;  4WUR A;  3BCN A;  3RNV A;  1BP4 A;  4YYS A;  3RVV A;  1ME4 A;  3K8U A;  2YJ8 A;  3E1Z B;  3IHP A;  6PAD A;  1GLO A;  3KFQ A;  3F75 A;  2B1N A;  1CSB B;  1K3B B;  2C0Y A;  2DCB A;  2YJ9 A;  2PBH A;  4QRG A;  5CHT A;  3M99 A;  4MZO A;  1Y08 A;  4AXL A;  4PAD A;  1NL6 A;  3PBH A;  4PI3 A;  3P5U A;  1YZB A;  3P5W A;  3N3G A;  3O1G A;  5EGW A;  3ERV A;  4W5B A;  2FRA A;  2CB5 A;  2F1G A;  1U9V A;  2E00 A;  2JQF R;  3PHX A;  3F5V A;  4D8I A;  4FJC A;  3MOR A;  3USV A;  3K24 A;  3NHE A;  3HHA A;  2R9M A;  3PDF A;  2DZY A;  4YYW A;  7PCK A;  2IPP B;  4BPV A;  1TL9 A;  2R9F A;  1AYU A;  3S3Q A;  3CH3 X;  1EWO A;  1KHP A;  2G8E A;  3BC3 A;  4MI7 A;  1ME3 A;  1CPJ A;  3C9E A;  1AYW A;  5JH3 A;  5A24 A;  2FYE A;  3H89 A;  4PT5 A;  1AEC A;  2AIM A;  1DEU A;  2E01 A;  2DCD A;  1F2C A;  3PNR A;  4OW0 A;  3OF8 A;  4CDD B;  2YJB A;  4BOU A;  1PVJ A;  4QH6 A;  1F2B A;  3O65 A;  2BU3 A;  3IEJ A;  1ATK A;  4MZS A;  4A5U A;  2UZJ A;  3PW3 A;  1NPZ A;  1YK7 A;  1PPO A;  1ICF A;  3U8E A;  2XU5 A;  2DC6 A;  2OZ2 A;  4MSX A;  2AGA A;  1CJL A;  1BQI A;  4QRV A;  1AU4 A;  1AU3 A;  2OUL A;  3IV2 A;  4W5C A;  4QRX A;  1O0E A;  5FPW A;  3H7D A;  4RNA A;  3H8B A;  2R6N A;  3KW9 A;  1UKF A;  3DF0 A;  1KHQ A;  3PHU A;  4CZW A;  1U5I A;  2HD5 A;  2BDL A;  3PRP A;  2JTC A;  1YK8 A;  3I3T A;  2YJC A;  3MP2 A;  4N4Z A;  4CDC B;  1EWP A;  2HHN A;  3IMA A;  4CDF B;  1VJV A;  9PAP A;  4N8W A;  2R9N A;  2FO5 A;  1SP4 B;  4KLB A;  3C0R A;  4X6H A;  3H6S A;  1NQC A;  3RVW A;  4BSQ A;  3H8C A;  2G8J A;  4YV8 A;  3WXG A;  1A6R A;  1CV8 A;  4D8E A;  3ZUA A;  2J7Q A;  1NB5 A;  1BY8 A;  1GEC E;  3TMP A;  1YAL A;  3KSE A;  3LXS A;  1U9Q X;  4OEM A;  3IFU A;  2E03 A;  3BPM A;  4OEL A;  3OIS A;  1ZIV A;  3QJ3 A;  1PPP A;  2BTW A;  3KKU A;  1PIP A;  2E02 A;  1CTE A;  4YYU A;  1BGO A;  5EZS A;  4FIP A;  1KFX L;  1MEM A;  3N4C A;  2DCA A;  1MS6 A;  2DJG B;  5CVO B;  5K16 A;  2Y5B A;  3PRM A;  2XU4 A;  1DF0 A;  4G54 A;  3HHI A;  4BS6 A;  2NQA A;  4M0W A;  5CHV A;  5J94 A;  2AUZ A;  2ATO A;  2IBI A;  2XU1 A;  3OF9 A;  4IP3 A;  2VHS A;  3S3R A;  1SNK A;  3GCB A;  1KFU L;  2WBF X;  4BOS A;  4BOZ A;  3BB7 A;  4RF1 A;  3KX1 A;  1VSN A;  1POP A;  2G7Y A;  1GCB A;  1AYV A;  2HWK A;  1TLO A;  1NLJ A;  4YYV A;  3PSE A;  4P16 A;  1KXR A;  3HWN A;  3BPF A;  5PAD A;  3BOW A;  2HXZ A;  1CQD A;  3N3K A;  5JZE A;  2FE8 A;  1M6D A;  4YYQ A;  2DC9 A;  2AYO A;  4I04 A;  1QOL A;  3BBA A;  4P6E A;  5E6J A;  3KWB X;  4R3D A;  1PAD A;  3W30 A;  3AI8 A;  2JQG R; 
#chains in the Genus database with same CATH homology
 3PRM A;  3IFU A;  2AGA A;  4RF0 A;  3MJ5 A;  3PSE A;  3PHX A;  4D8I A;  3E9S A;  4ZTB A;  4P16 A;  4IUM A;  4M0W A;  1DKI A;  4OW0 A;  3TRK A;  4D8B A;  3OQC A;  2BTW A;  3W31 A;  5EZQ A;  4GUA A;  4BOU A;  4IP3 A;  2BTW B;  2FE8 A;  4RNA A;  4RKX A;  1PVJ A;  3B21 A;  3C0R A;  5JZE A;  3PHU A;  4BOQ A;  1UKF A;  5KO3 A;  4MM3 B;  2J7Q C;  3O65 A;  2BU3 A;  5EZS A;  3ZNH A;  4BOS A;  4BOZ A;  3BB7 A;  4HXD B;  3BBA A;  3RNV A;  5E6J A;  1YZB A;  3PRP A;  4REZ A;  2Z84 A;  2JTC A;  3PT2 A;  4OVZ B;  4R3D A;  4RF1 A;  2JRI A;  3BY4 A;  4XZX A;  4A5U A;  4BOP A;  4D8E A;  2UZJ A;  3MTV A;  4OVZ A;  3W30 A;  2J7Q A;  4MI7 A;  4WUR A;  3MP2 A;  2DOS A;  3TMP A;  2HWK A;  3PHW A;  4PT5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...