4IUMA

Equine arteritis virus papain-like protease 2 (plp2) covalently bound to ubiquitin
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
127
structure length
127
Chain Sequence
GYNPPGDGACGYRCLAFMNGATVVSAGCSSDLWCDDELAYRVFQLSPTFTVTIPGGRVCPNAKYAMICDKQHWRVKRAKGVGLCLDESCFRGICNCQRMSGPPPAPVSAAVLDHILEAATFGNVRVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords papain-like protease 2
publication title Deubiquitinase function of arterivirus papain-like protease 2 suppresses the innate immune response in infected host cells.
pubmed doi rcsb
source organism Equine arteritis virus
molecule tags Hydrolase/protein binding
total genus 36
structure length 127
sequence length 127
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2013-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05412 Peptidase_C33 Equine arterivirus Nsp2-type cysteine proteinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.160 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4iumA00
4IUMA
chains in the Genus database with same CATH superfamily
4YYQA 5EZQA 1PPDA 2YJ9A 3BCNA 3K9MA 4W5CA 3N3KA 3CH3X 5EGWA 2GFOA 1CPJA 3F75A 3S3RA 4P16A 4OELA 1AYWA 3NHEA 1AYUA 4WA6A 3CH2X 2R9CA 2YJ2A 1ITOA 3MHSA 2CIOA 3OVZA 1BGOA 2DC9A 4QRXA 4FJCA 2NQAA 2F1GA 3PW3A 1CJLA 4OVZB 5CHTA 2DJFB 4BS5A 3TRKA 3ZUAA 3OF9A 1QDQA 1CTEA 4XUIA 5EZSA 4BOSA 1AECA 3HHIA 2PBHA 3LFYA 4X6IA 4N79A 4YYSA 2FO5A 3WXEA 4YYVA 2DC8A 3CBJA 5CVOB 2JQFR 2E00A 1O0EA 1THEA 4RF1A 3MTNA 1Q6KA 1NL6A 4XR7A 2P86A 3BOWA 4RKXA 2YJCA 2XU3A 2HD5A 1CQDA 2NQIA 2AVWA 1EWLA 2YJ8A 3H8BA 1PVJA 4W5BA 2FQ9A 1BY8A 4MM3B 2ACTA 3H89A 4BOPA 3C0RA 2NQDB 4BOUA 3BY4A 3DF0A 1BP4A 1Y08A 5KO3A 1MIRA 2VHSA 3H8CA 3RVXA 4MZSA 2BU3A 1F2BA 4YVAA 1EWMA 1PIPA 5CVNB 3OF8A 2H7JA 4CDEB 2Y5BA 6PADA 3I06A 4K7CA 3W30A 7PCKA 4I04A 3BBAA 4MZOA 2JQGR 3MTVA 2HH5A 1CS8A 2YJBA 9PAPA 3ZNHA 2JRIA 2DOSA 1CV8A 2G8JA 4RF0A 2OULA 3OVXA 1BQIA 2VHFA 1TL9A 3I3TA 2E03A 4QRGA 4ZUXU 1POPA 1EWOA 1X9YA 2AGAA 4CDCB 1PPOA 1QXPA 4G54A 3KW9A 4AXMA 4BQVA 3KFQA 1YZBA 2HWKA 2DCAA 1DF0A 5JZEA 3K8UA 2BDLA 1YT7A 1NPZA 2DJGB 2DC6A 3D6SA 1AYVA 1U9QX 1GMYA 1KHPA 3IFUA 4QH6A 3H6SA 2P7UA 2R9MA 4IP3A 3O1GA 3PSEA 1ME4A 5PADA 4W4UA 1PXVA 3N4CA 3V6EA 1GCBA 1MEGA 4ZTBA 2DCDA 1GECE 3M99A 5E6JA 2B1NA 3PHXA 4DMYA 5F02A 2DZYA 4I07A 2P0RA 4Q8HA 2G8EA 2G6DA 4X6JA 1NB5A 3QSDA 1QMYA 2WBFX 1AU2A 2IPPB 2BTWA 1PBHA 4D8BA 1YK7A 2J7QA 4D8EA 1VJVA 3HHAA 3MORA 3PT2A 2Y6EA 2DCCA 1F29A 1MDWA 4OEMA 1QOLA 3MP2A 1K3BB 3H7DA 1MS6A 3RVVA 3KKUA 4OW0A 4MI7A 1KHQA 5CVMA 2G7YA 8PCHA 4PI3A 2JTCA 3PBHA 3IUTA 3E1ZB 3E9SA 1TU6A 1KFXL 3BPMA 5A24A 3IV2A 3W31A 1ZIVA 1CSBB 4N8WA 3QT4A 4N4ZA 3BPFA 2PREA 1A6RA 2AYOA 2BDZA 3BC3A 4BOQA 1F2AA 2OP3A 2E01A 3N3GA 2R9OA 2NQGA 4PP2E 2F7DA 2HHNA 4QRVA 2FTDA 3PRPA 1ATKA 3PHUA 3O65A 1YVBA 2J7QC 4RNAA 5FPWA 4Q8GA 3S3QA 3TMPA 1F2CA 2DC7A 4DMXA 4AXLA 1DKIA 1TLOA 3HD3A 3IHPA 3GCBA 1EF7A 1PADA 2AIMA 3CBKA 4YYRA 2XU1A 2R9FA 2FE8A 2GHUA 4BPVA 4I05A 1S4VA 3KX1A 1AIMA 1GLOA 1SP4B 4IUMA 1PPPA 3BB7A 5CHVA 3U8EA 3P5UA 1VSNA 3WXGA 4CDFB 4P6EA 1ZCMA 2CB5A 4R3DA 1STFE 2IBIA 3KWBX 1MEMA 1PE6A 1DEUA 2PNSA 1ME3A 4M0WA 5JA7A 3KSEA 4D8IA 1NLJA 1AU0A 3ERVA 4BOZA 1PCIA 2XU4A 3B21A 1MHWA 2FT2A 3P5XA 3TNXA 1ICFA 2XU5A 4KLBA 4FIPA 3OISA 4A5UA 3HWNA 3P5WA 1UKFA 2E02A 4OVZA 2R9NA 2OZ2A 3KWZA 3WXFA 2FYEA 2BTWB 3AI8A 1YK8A 3PNRA 3F5VA 5K16A 2ATOA 4PP1A 2DZZA 1M6DA 2AU1A 2FRAA 1FH0A 5EF4A 4WURA 3RNVA 3MJ5A 4REZA 4CDDB 1U9XA 2ARYA 4YYWA 4MSXA 1AU3A 1U9WA 1Y4HA 1KFUL 3PRMA 3O0UA 2B1MA 4FK5A 1NB3A 3BWKA 3C9EA 4BS6A 5JH3A 1U5IA 3K24A 4HWYA 1XKGA 3PHWA 3B79A 4YYUA 3V6CA 1YALA 3OQCA 2PADA 1JQPA 4CZWA 1IWDA 4BSQA 3IOQA 4HXDB 3PDFA 4PADA 4PT5A 4GUAA 1PPNA 3P5VA 2HXZA 2AUZA 1EWPA 3MHHA 2AUXA 2AYNA 5J94A 4X6HA 2C0YA 4P6GA 4QBBA 2O6XA 3LXSA 1SNKA 1HUCB 4RY2A 4YV8A 2AS8A 4XZXA 1KXRA 3IEJA 3IMAA 3USVA 1CB5A 2FRQA 3QJ3A 2UZJA 2FUDA 3RVWA 1U9VA 2Z84A 1CVZA 2R6NA 2DCBA 1AU4A 1NQCA
chains in the Genus database with same CATH topology
5EZQA 2BTWB 3W30A 3BBAA 3MTVA 3E9SA 3ZNHA 2JRIA 4WURA 2DOSA 4RF0A 3RNVA 4P16A 3MJ5A 4REZA 3W31A 2AGAA 4BOQA 3PRMA 4OVZB 3TRKA 1YZBA 2HWKA 5JZEA 3PRPA 5EZSA 4BOSA 3PHWA 3PHUA 3O65A 3IFUA 2J7QC 4RNAA 4IP3A 3TMPA 3PSEA 3OQCA 1DKIA 4RF1A 4ZTBA 4HXDB 2FE8A 5E6JA 4RKXA 3PHXA 4PT5A 4GUAA 4IUMA 3BB7A 4R3DA 2BTWA 1PVJA 4D8BA 2J7QA 4MM3B 4BOPA 4M0WA 4D8EA 3C0RA 4BOUA 3BY4A 4D8IA 3PT2A 4BOZA 3B21A 3MP2A 5KO3A 4XZXA 2BU3A 2UZJA 4OW0A 4MI7A 4A5UA 2Z84A 2JTCA 1UKFA 4OVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IUM A; 
#chains in the Genus database with same CATH topology
 4YYQ A;  5EZQ A;  1PPD A;  2YJ9 A;  3BCN A;  3K9M A;  4W5C A;  3N3K A;  3CH3 X;  5EGW A;  2GFO A;  1CPJ A;  3F75 A;  3S3R A;  4P16 A;  4OEL A;  1AYW A;  3NHE A;  1AYU A;  4WA6 A;  3CH2 X;  2R9C A;  2YJ2 A;  1ITO A;  3MHS A;  2CIO A;  3OVZ A;  1BGO A;  2DC9 A;  4QRX A;  4FJC A;  2NQA A;  2F1G A;  3PW3 A;  1CJL A;  4OVZ B;  5CHT A;  2DJF B;  4BS5 A;  3TRK A;  3ZUA A;  3OF9 A;  1QDQ A;  1CTE A;  4XUI A;  5EZS A;  4BOS A;  1AEC A;  3HHI A;  2PBH A;  3LFY A;  4X6I A;  4N79 A;  4YYS A;  2FO5 A;  3WXE A;  4YYV A;  2DC8 A;  3CBJ A;  5CVO B;  2JQF R;  2E00 A;  1O0E A;  1THE A;  4RF1 A;  3MTN A;  1Q6K A;  1NL6 A;  4XR7 A;  2P86 A;  3BOW A;  4RKX A;  2YJC A;  2XU3 A;  2HD5 A;  1CQD A;  2NQI A;  2AVW A;  1EWL A;  2YJ8 A;  3H8B A;  1PVJ A;  4W5B A;  2FQ9 A;  1BY8 A;  4MM3 B;  2ACT A;  3H89 A;  4BOP A;  3C0R A;  2NQD B;  4BOU A;  3BY4 A;  3DF0 A;  1BP4 A;  1Y08 A;  5KO3 A;  1MIR A;  2VHS A;  3H8C A;  3RVX A;  4MZS A;  2BU3 A;  1F2B A;  4YVA A;  1EWM A;  1PIP A;  5CVN B;  3OF8 A;  2H7J A;  4CDE B;  2Y5B A;  6PAD A;  3I06 A;  4K7C A;  3W30 A;  7PCK A;  4I04 A;  3BBA A;  4MZO A;  2JQG R;  3MTV A;  2HH5 A;  1CS8 A;  2YJB A;  9PAP A;  3ZNH A;  2JRI A;  2DOS A;  1CV8 A;  2G8J A;  4RF0 A;  2OUL A;  3OVX A;  1BQI A;  2VHF A;  1TL9 A;  3I3T A;  2E03 A;  4QRG A;  4ZUX U;  1POP A;  1EWO A;  1X9Y A;  2AGA A;  4CDC B;  1PPO A;  1QXP A;  4G54 A;  3KW9 A;  4AXM A;  4BQV A;  3KFQ A;  1YZB A;  2HWK A;  2DCA A;  1DF0 A;  5JZE A;  3K8U A;  2BDL A;  1YT7 A;  1NPZ A;  2DJG B;  2DC6 A;  3D6S A;  1AYV A;  1U9Q X;  1GMY A;  1KHP A;  3IFU A;  4QH6 A;  3H6S A;  2P7U A;  2R9M A;  4IP3 A;  3O1G A;  3PSE A;  1ME4 A;  5PAD A;  4W4U A;  1PXV A;  3N4C A;  3V6E A;  1GCB A;  1MEG A;  4ZTB A;  2DCD A;  1GEC E;  3M99 A;  5E6J A;  2B1N A;  3PHX A;  4DMY A;  5F02 A;  2DZY A;  4I07 A;  2P0R A;  4Q8H A;  2G8E A;  2G6D A;  4X6J A;  1NB5 A;  3QSD A;  1QMY A;  2WBF X;  1AU2 A;  2IPP B;  2BTW A;  1PBH A;  4D8B A;  1YK7 A;  2J7Q A;  4D8E A;  1VJV A;  3HHA A;  3MOR A;  3PT2 A;  2Y6E A;  2DCC A;  1F29 A;  1MDW A;  4OEM A;  1QOL A;  3MP2 A;  1K3B B;  3H7D A;  1MS6 A;  3RVV A;  3KKU A;  4OW0 A;  4MI7 A;  1KHQ A;  5CVM A;  2G7Y A;  8PCH A;  4PI3 A;  2JTC A;  3PBH A;  3IUT A;  3E1Z B;  3E9S A;  1TU6 A;  1KFX L;  3BPM A;  5A24 A;  3IV2 A;  3W31 A;  1ZIV A;  1CSB B;  4N8W A;  3QT4 A;  4N4Z A;  3BPF A;  2PRE A;  1A6R A;  2AYO A;  2BDZ A;  3BC3 A;  4BOQ A;  1F2A A;  2OP3 A;  2E01 A;  3N3G A;  2R9O A;  2NQG A;  4PP2 E;  2F7D A;  2HHN A;  4QRV A;  2FTD A;  3PRP A;  1ATK A;  3PHU A;  3O65 A;  1YVB A;  2J7Q C;  4RNA A;  5FPW A;  4Q8G A;  3S3Q A;  3TMP A;  1F2C A;  2DC7 A;  4DMX A;  4AXL A;  1DKI A;  1TLO A;  3HD3 A;  3IHP A;  3GCB A;  1EF7 A;  1PAD A;  2AIM A;  3CBK A;  4YYR A;  2XU1 A;  2R9F A;  2FE8 A;  2GHU A;  4BPV A;  4I05 A;  1S4V A;  3KX1 A;  1AIM A;  1GLO A;  1SP4 B;  4IUM A;  1PPP A;  3BB7 A;  5CHV A;  3U8E A;  3P5U A;  1VSN A;  3WXG A;  4CDF B;  4P6E A;  1ZCM A;  2CB5 A;  4R3D A;  1STF E;  2IBI A;  3KWB X;  1MEM A;  1PE6 A;  1DEU A;  2PNS A;  1ME3 A;  4M0W A;  5JA7 A;  3KSE A;  4D8I A;  1NLJ A;  1AU0 A;  3ERV A;  4BOZ A;  1PCI A;  2XU4 A;  3B21 A;  1MHW A;  2FT2 A;  3P5X A;  3TNX A;  1ICF A;  2XU5 A;  4KLB A;  4FIP A;  3OIS A;  4A5U A;  3HWN A;  3P5W A;  1UKF A;  2E02 A;  4OVZ A;  2R9N A;  2OZ2 A;  3KWZ A;  3WXF A;  2FYE A;  2BTW B;  3AI8 A;  1YK8 A;  3PNR A;  3F5V A;  5K16 A;  2ATO A;  4PP1 A;  2DZZ A;  1M6D A;  2AU1 A;  2FRA A;  1FH0 A;  5EF4 A;  4WUR A;  3RNV A;  3MJ5 A;  4REZ A;  4CDD B;  1U9X A;  2ARY A;  4YYW A;  4MSX A;  1AU3 A;  1U9W A;  1Y4H A;  1KFU L;  3PRM A;  3O0U A;  2B1M A;  4FK5 A;  1NB3 A;  3BWK A;  3C9E A;  4BS6 A;  5JH3 A;  1U5I A;  3K24 A;  4HWY A;  1XKG A;  3PHW A;  3B79 A;  4YYU A;  3V6C A;  1YAL A;  3OQC A;  2PAD A;  1JQP A;  4CZW A;  1IWD A;  4BSQ A;  3IOQ A;  4HXD B;  3PDF A;  4PAD A;  4PT5 A;  4GUA A;  1PPN A;  3P5V A;  2HXZ A;  2AUZ A;  1EWP A;  3MHH A;  2AUX A;  2AYN A;  5J94 A;  4X6H A;  2C0Y A;  4P6G A;  4QBB A;  2O6X A;  3LXS A;  1SNK A;  1HUC B;  4RY2 A;  4YV8 A;  2AS8 A;  4XZX A;  1KXR A;  3IEJ A;  3IMA A;  3USV A;  1CB5 A;  2FRQ A;  3QJ3 A;  2UZJ A;  2FUD A;  3RVW A;  1U9V A;  2Z84 A;  1CVZ A;  2R6N A;  2DCB A;  1AU4 A;  1NQC A; 
#chains in the Genus database with same CATH homology
 5EZQ A;  2BTW B;  3W30 A;  3BBA A;  3MTV A;  3E9S A;  3ZNH A;  2JRI A;  4WUR A;  2DOS A;  4RF0 A;  3RNV A;  4P16 A;  3MJ5 A;  4REZ A;  3W31 A;  2AGA A;  4BOQ A;  3PRM A;  4OVZ B;  3TRK A;  1YZB A;  2HWK A;  5JZE A;  3PRP A;  5EZS A;  4BOS A;  3PHW A;  3PHU A;  3O65 A;  3IFU A;  2J7Q C;  4RNA A;  4IP3 A;  3TMP A;  3PSE A;  3OQC A;  1DKI A;  4RF1 A;  4ZTB A;  4HXD B;  2FE8 A;  5E6J A;  4RKX A;  3PHX A;  4PT5 A;  4GUA A;  4IUM A;  3BB7 A;  4R3D A;  2BTW A;  1PVJ A;  4D8B A;  2J7Q A;  4MM3 B;  4BOP A;  4M0W A;  4D8E A;  3C0R A;  4BOU A;  3BY4 A;  4D8I A;  3PT2 A;  4BOZ A;  3B21 A;  3MP2 A;  5KO3 A;  4XZX A;  2BU3 A;  2UZJ A;  4OW0 A;  4MI7 A;  4A5U A;  2Z84 A;  2JTC A;  1UKF A;  4OVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...