4IUMA

Equine arteritis virus papain-like protease 2 (plp2) covalently bound to ubiquitin
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
127
structure length
127
Chain Sequence
b'GYNPPGDGACGYRCLAFMNGATVVSAGCSSDLWCDDELAYRVFQLSPTFTVTIPGGRVCPNAKYAMICDKQHWRVKRAKGVGLCLDESCFRGICNCQRMSGPPPAPVSAAVLDHILEAATFGNVRVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords papain-like protease 2
publication title Deubiquitinase function of arterivirus papain-like protease 2 suppresses the innate immune response in infected host cells.
pubmed doi rcsb
source organism Equine arteritis virus
molecule tags Hydrolase/protein binding
total genus 36
structure length 127
sequence length 127
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2013-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05412 Peptidase_C33 Equine arterivirus Nsp2-type cysteine proteinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.160 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4iumA00
4IUMA
chains in the Genus database with same CATH superfamily
4P6GA 1KFUL 4I05A 1AU2A 1TLOA 2HWKA 4W5CA 4YYQA 3IEJA 3OF9A 1PADA 2AU1A 4PT5A 2DC6A 4BPVA 3H89A 3H8BA 1EWOA 2AYNA 2DOSA 2HHNA 3BWKA 1BGOA 2AVWA 5J94A 2HXZA 1PCIA 3CBKA 3C9EA 3KKUA 3BOWA 3RVVA 2R9MA 2G8EA 4MZSA 4CZWA 2ATOA 4R3DA 5K16A 2JQGR 2HD5A 4OW0A 2IBIA 3IHPA 5FPWA 1KHPA 2GFOA 1F2AA 4M0WA 3I3TA 5EZQA 3ZNHA 2AYOA 2H7JA 2P0RA 3E1ZB 4PP2E 3MTVA 3QJ3A 5A24A 3USVA 3IOQA 3P5XA 4BOUA 3IFUA 3M99A 4PP1A 1HUCB 5JZEA 3CH2X 4RY2A 1Q6KA 2NQAA 3MJ5A 1PE6A 1XKGA 3KSEA 2R9NA 2Y6EA 2NQIA 2CIOA 1PPOA 5CVNB 2ARYA 3D6SA 3RVXA 5KO3A 1NPZA 4K7CA 3H6SA 3BY4A 3ERVA 2NQDB 4D8EA 1ME3A 3N3GA 4WURA 2E01A 1YK8A 3B21A 2F1GA 1DF0A 4X6JA 1U9QX 1YALA 4N4ZA 3WXEA 1O0EA 4D8IA 3PHUA 1MEGA 4I07A 9PAPA 1BY8A 2B1NA 3QSDA 4MSXA 3TRKA 2G8JA 2YJ2A 1AYWA 2UZJA 3MP2A 3H8CA 4PI3A 3WXGA 1POPA 4YYWA 1DEUA 4N79A 2B1MA 1YZBA 3V6CA 2DZYA 1CTEA 2BTWB 2YJ8A 2CB5A 4X6IA 3O65A 1F2BA 3DF0A 4YVAA 1QXPA 3IV2A 2DC8A 1PVJA 1ZCMA 2R9OA 2JQFR 4W4UA 5CHTA 3OVXA 2NQGA 3QT4A 2FRQA 2YJ9A 2YJBA 4RF1A 4DMXA 4QRVA 1PPDA 3LFYA 3GCBA 1EF7A 3PRMA 3HHIA 3N3KA 4YYVA 4REZA 1TU6A 1PXVA 2XU1A 4CDDB 4QRGA 2PNSA 3P5WA 4P16A 4YV8A 2FT2A 3MORA 3PNRA 1GLOA 1YK7A 3E9SA 1PBHA 4AXMA 3NHEA 2J7QA 4I04A 2AS8A 1X9YA 4OEMA 3MTNA 4FJCA 5JH3A 3O1GA 1U9XA 1CV8A 2DC7A 1A6RA 4HXDB 2G6DA 2AGAA 4BSQA 1BQIA 1MHWA 3BC3A 3HHAA 2E02A 3BPMA 3OVZA 4OELA 3OQCA 1CJLA 1NB3A 1NQCA 1U5IA 4KLBA 1S4VA 2WBFX 2PBHA 1NLJA 1NL6A 2BDLA 4MM3B 3MHSA 4OVZB 3F75A 2GHUA 2R9CA 3TNXA 4YYUA 3BBAA 2DCDA 1KXRA 1U9VA 2DJGB 3HD3A 2P86A 3PDFA 4RKXA 1MDWA 1KFXL 3OISA 4MI7A 2AUZA 2PREA 2XU4A 3K9MA 4CDCB 1CQDA 5F02A 2OP3A 1AIMA 1MEMA 5EF4A 4G54A 1VJVA 2BDZA 3H7DA 2FRAA 2Z84A 3O0UA 2ACTA 2PADA 1EWPA 2R9FA 2DCAA 1SP4B 4CDEB 4WA6A 3PSEA 1YVBA 3PHXA 2IPPB 4FK5A 1GECE 3F5VA 4GUAA 1CSBB 3N4CA 3KWZA 2FTDA 3IUTA 1CS8A 3HWNA 2FE8A 4Q8HA 1EWMA 2XU3A 3IMAA 1ATKA 1F29A 3BB7A 1EWLA 1QOLA 4ZUXU 3V6EA 4YYRA 3MHHA 1BP4A 2DZZA 3KWBX 4RNAA 4FIPA 4DMYA 3WXFA 4BS6A 4W5BA 3RNVA 2DC9A 2JRIA 2YJCA 4MZOA 3KX1A 1TL9A 3BPFA 4XUIA 2DCCA 4QBBA 4RF0A 7PCKA 2O6XA 1JQPA 1AECA 4AXLA 1VSNA 1Y4HA 1AU3A 1ITOA 3K8UA 2J7QC 1STFE 3U8EA 1NB5A 3CH3X 2AIMA 2FYEA 3P5UA 1YT7A 4PADA 3PRPA 1PIPA 1QDQA 4BOSA 3S3QA 2OULA 3LXSA 4QRXA 1GCBA 3PHWA 5CVOB 2BTWA 4IP3A 1CVZA 2DCBA 8PCHA 4BOZA 1THEA 5EGWA 3PT2A 3B79A 2FO5A 4N8WA 4BS5A 2P7UA 5JA7A 2FQ9A 1M6DA 4P6EA 4BOPA 1U9WA 2VHSA 4Q8GA 1MS6A 2C0YA 2F7DA 3ZUAA 3TMPA 2Y5BA 1QMYA 2BU3A 4ZTBA 1UKFA 2G7YA 2DJFB 3RVWA 4XR7A 1FH0A 5CHVA 2HH5A 4A5UA 1ME4A 1CB5A 1PPPA 2E03A 1AU4A 3KW9A 1AYVA 2JTCA 4IUMA 2E00A 3BCNA 4D8BA 3AI8A 2R6NA 2AUXA 1MIRA 4QH6A 5EZSA 6PADA 1F2CA 5CVMA 2VHFA 1AYUA 4BOQA 1AU0A 4XZXA 2OZ2A 4X6HA 1IWDA 3PBHA 3C0RA 3I06A 1ICFA 4BQVA 1DKIA 3KFQA 3W31A 5E6JA 4OVZA 1SNKA 3OF8A 1PPNA 4CDFB 5PADA 1Y08A 3P5VA 3W30A 3PW3A 2FUDA 4HWYA 4YYSA 1KHQA 3S3RA 1CPJA 3CBJA 1ZIVA 1K3BB 3K24A 2XU5A 1GMYA
chains in the Genus database with same CATH topology
4MM3B 4BOZA 4OVZB 4D8IA 3PHUA 2HWKA 3PT2A 3BBAA 3TRKA 4RKXA 4MI7A 2UZJA 4PT5A 3MP2A 4BOPA 2Z84A 3TMPA 1YZBA 2DOSA 2BTWB 2BU3A 4ZTBA 1UKFA 3O65A 4A5UA 1PVJA 3PSEA 4R3DA 3PHXA 4OW0A 4GUAA 2JTCA 4RF1A 4IUMA 4M0WA 2FE8A 5EZQA 3ZNHA 3PRMA 4D8BA 4REZA 3BB7A 3MTVA 5EZSA 4RNAA 4BOUA 4P16A 3IFUA 3RNVA 4BOQA 2JRIA 5JZEA 4XZXA 3E9SA 4RF0A 2J7QA 3MJ5A 3C0RA 1DKIA 3W31A 2J7QC 5E6JA 4OVZA 4HXDB 2AGAA 5KO3A 3W30A 3BY4A 3PRPA 4BOSA 4D8EA 3OQCA 3PHWA 4WURA 3B21A 2BTWA 4IP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IUM A; 
#chains in the Genus database with same CATH topology
 4P6G A;  1KFU L;  4I05 A;  1AU2 A;  1TLO A;  2HWK A;  4W5C A;  4YYQ A;  3IEJ A;  3OF9 A;  1PAD A;  2AU1 A;  4PT5 A;  2DC6 A;  4BPV A;  3H89 A;  3H8B A;  1EWO A;  2AYN A;  2DOS A;  2HHN A;  3BWK A;  1BGO A;  2AVW A;  5J94 A;  2HXZ A;  1PCI A;  3CBK A;  3C9E A;  3KKU A;  3BOW A;  3RVV A;  2R9M A;  2G8E A;  4MZS A;  4CZW A;  2ATO A;  4R3D A;  5K16 A;  2JQG R;  2HD5 A;  4OW0 A;  2IBI A;  3IHP A;  5FPW A;  1KHP A;  2GFO A;  1F2A A;  4M0W A;  3I3T A;  5EZQ A;  3ZNH A;  2AYO A;  2H7J A;  2P0R A;  3E1Z B;  4PP2 E;  3MTV A;  3QJ3 A;  5A24 A;  3USV A;  3IOQ A;  3P5X A;  4BOU A;  3IFU A;  3M99 A;  4PP1 A;  1HUC B;  5JZE A;  3CH2 X;  4RY2 A;  1Q6K A;  2NQA A;  3MJ5 A;  1PE6 A;  1XKG A;  3KSE A;  2R9N A;  2Y6E A;  2NQI A;  2CIO A;  1PPO A;  5CVN B;  2ARY A;  3D6S A;  3RVX A;  5KO3 A;  1NPZ A;  4K7C A;  3H6S A;  3BY4 A;  3ERV A;  2NQD B;  4D8E A;  1ME3 A;  3N3G A;  4WUR A;  2E01 A;  1YK8 A;  3B21 A;  2F1G A;  1DF0 A;  4X6J A;  1U9Q X;  1YAL A;  4N4Z A;  3WXE A;  1O0E A;  4D8I A;  3PHU A;  1MEG A;  4I07 A;  9PAP A;  1BY8 A;  2B1N A;  3QSD A;  4MSX A;  3TRK A;  2G8J A;  2YJ2 A;  1AYW A;  2UZJ A;  3MP2 A;  3H8C A;  4PI3 A;  3WXG A;  1POP A;  4YYW A;  1DEU A;  4N79 A;  2B1M A;  1YZB A;  3V6C A;  2DZY A;  1CTE A;  2BTW B;  2YJ8 A;  2CB5 A;  4X6I A;  3O65 A;  1F2B A;  3DF0 A;  4YVA A;  1QXP A;  3IV2 A;  2DC8 A;  1PVJ A;  1ZCM A;  2R9O A;  2JQF R;  4W4U A;  5CHT A;  3OVX A;  2NQG A;  3QT4 A;  2FRQ A;  2YJ9 A;  2YJB A;  4RF1 A;  4DMX A;  4QRV A;  1PPD A;  3LFY A;  3GCB A;  1EF7 A;  3PRM A;  3HHI A;  3N3K A;  4YYV A;  4REZ A;  1TU6 A;  1PXV A;  2XU1 A;  4CDD B;  4QRG A;  2PNS A;  3P5W A;  4P16 A;  4YV8 A;  2FT2 A;  3MOR A;  3PNR A;  1GLO A;  1YK7 A;  3E9S A;  1PBH A;  4AXM A;  3NHE A;  2J7Q A;  4I04 A;  2AS8 A;  1X9Y A;  4OEM A;  3MTN A;  4FJC A;  5JH3 A;  3O1G A;  1U9X A;  1CV8 A;  2DC7 A;  1A6R A;  4HXD B;  2G6D A;  2AGA A;  4BSQ A;  1BQI A;  1MHW A;  3BC3 A;  3HHA A;  2E02 A;  3BPM A;  3OVZ A;  4OEL A;  3OQC A;  1CJL A;  1NB3 A;  1NQC A;  1U5I A;  4KLB A;  1S4V A;  2WBF X;  2PBH A;  1NLJ A;  1NL6 A;  2BDL A;  4MM3 B;  3MHS A;  4OVZ B;  3F75 A;  2GHU A;  2R9C A;  3TNX A;  4YYU A;  3BBA A;  2DCD A;  1KXR A;  1U9V A;  2DJG B;  3HD3 A;  2P86 A;  3PDF A;  4RKX A;  1MDW A;  1KFX L;  3OIS A;  4MI7 A;  2AUZ A;  2PRE A;  2XU4 A;  3K9M A;  4CDC B;  1CQD A;  5F02 A;  2OP3 A;  1AIM A;  1MEM A;  5EF4 A;  4G54 A;  1VJV A;  2BDZ A;  3H7D A;  2FRA A;  2Z84 A;  3O0U A;  2ACT A;  2PAD A;  1EWP A;  2R9F A;  2DCA A;  1SP4 B;  4CDE B;  4WA6 A;  3PSE A;  1YVB A;  3PHX A;  2IPP B;  4FK5 A;  1GEC E;  3F5V A;  4GUA A;  1CSB B;  3N4C A;  3KWZ A;  2FTD A;  3IUT A;  1CS8 A;  3HWN A;  2FE8 A;  4Q8H A;  1EWM A;  2XU3 A;  3IMA A;  1ATK A;  1F29 A;  3BB7 A;  1EWL A;  1QOL A;  4ZUX U;  3V6E A;  4YYR A;  3MHH A;  1BP4 A;  2DZZ A;  3KWB X;  4RNA A;  4FIP A;  4DMY A;  3WXF A;  4BS6 A;  4W5B A;  3RNV A;  2DC9 A;  2JRI A;  2YJC A;  4MZO A;  3KX1 A;  1TL9 A;  3BPF A;  4XUI A;  2DCC A;  4QBB A;  4RF0 A;  7PCK A;  2O6X A;  1JQP A;  1AEC A;  4AXL A;  1VSN A;  1Y4H A;  1AU3 A;  1ITO A;  3K8U A;  2J7Q C;  1STF E;  3U8E A;  1NB5 A;  3CH3 X;  2AIM A;  2FYE A;  3P5U A;  1YT7 A;  4PAD A;  3PRP A;  1PIP A;  1QDQ A;  4BOS A;  3S3Q A;  2OUL A;  3LXS A;  4QRX A;  1GCB A;  3PHW A;  5CVO B;  2BTW A;  4IP3 A;  1CVZ A;  2DCB A;  8PCH A;  4BOZ A;  1THE A;  5EGW A;  3PT2 A;  3B79 A;  2FO5 A;  4N8W A;  4BS5 A;  2P7U A;  5JA7 A;  2FQ9 A;  1M6D A;  4P6E A;  4BOP A;  1U9W A;  2VHS A;  4Q8G A;  1MS6 A;  2C0Y A;  2F7D A;  3ZUA A;  3TMP A;  2Y5B A;  1QMY A;  2BU3 A;  4ZTB A;  1UKF A;  2G7Y A;  2DJF B;  3RVW A;  4XR7 A;  1FH0 A;  5CHV A;  2HH5 A;  4A5U A;  1ME4 A;  1CB5 A;  1PPP A;  2E03 A;  1AU4 A;  3KW9 A;  1AYV A;  2JTC A;  4IUM A;  2E00 A;  3BCN A;  4D8B A;  3AI8 A;  2R6N A;  2AUX A;  1MIR A;  4QH6 A;  5EZS A;  6PAD A;  1F2C A;  5CVM A;  2VHF A;  1AYU A;  4BOQ A;  1AU0 A;  4XZX A;  2OZ2 A;  4X6H A;  1IWD A;  3PBH A;  3C0R A;  3I06 A;  1ICF A;  4BQV A;  1DKI A;  3KFQ A;  3W31 A;  5E6J A;  4OVZ A;  1SNK A;  3OF8 A;  1PPN A;  4CDF B;  5PAD A;  1Y08 A;  3P5V A;  3W30 A;  3PW3 A;  2FUD A;  4HWY A;  4YYS A;  1KHQ A;  3S3R A;  1CPJ A;  3CBJ A;  1ZIV A;  1K3B B;  3K24 A;  2XU5 A;  1GMY A; 
#chains in the Genus database with same CATH homology
 4MM3 B;  4BOZ A;  4OVZ B;  4D8I A;  3PHU A;  2HWK A;  3PT2 A;  3BBA A;  3TRK A;  4RKX A;  4MI7 A;  2UZJ A;  4PT5 A;  3MP2 A;  4BOP A;  2Z84 A;  3TMP A;  1YZB A;  2DOS A;  2BTW B;  2BU3 A;  4ZTB A;  1UKF A;  3O65 A;  4A5U A;  1PVJ A;  3PSE A;  4R3D A;  3PHX A;  4OW0 A;  4GUA A;  2JTC A;  4RF1 A;  4IUM A;  4M0W A;  2FE8 A;  5EZQ A;  3ZNH A;  3PRM A;  4D8B A;  4REZ A;  3BB7 A;  3MTV A;  5EZS A;  4RNA A;  4BOU A;  4P16 A;  3IFU A;  3RNV A;  4BOQ A;  2JRI A;  5JZE A;  4XZX A;  3E9S A;  4RF0 A;  2J7Q A;  3MJ5 A;  3C0R A;  1DKI A;  3W31 A;  2J7Q C;  5E6J A;  4OVZ A;  4HXD B;  2AGA A;  5KO3 A;  3W30 A;  3BY4 A;  3PRP A;  4BOS A;  4D8E A;  3OQC A;  3PHW A;  4WUR A;  3B21 A;  2BTW A;  4IP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...