4YYQA

Ficin a
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
216
structure length
215
Chain Sequence
LPETVDWRSKGAVNPIRNQGQCGSWAFSAVAAVESINKIVTGQLLSLSEQQLLDCAQSYKNLGCQGGWVNKAFEYIIQNRGITSQSNYPYTGHKGQCRTGLASIATIDSYQYVPSNNENALKNAVANQPVSVAVEAAGRAFQLYKSGVFTGSCGVAIDHAVVLIGYGKYNGVDYWLLRNSWGTNWGEQGYMKLQRNVAQSAGKCGVARLCLYPVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of four variants of the protease Ficin from the common fig
rcsb
molecule tags Hydrolase
molecule keywords Ficin isoform A
total genus 69
structure length 215
sequence length 216
chains with identical sequence B
ec nomenclature ec 3.4.22.3: Ficain.
pdb deposition date 2015-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4yyqA00
4X6HA 3OVXA 1F29A 2R6NA 4X6IA 3BC3A 3KW9A 1PPDA 3IHPA 2YJ2A 2ACTA 2G6DA 2ATOA 4CZWA 2DJGB 3BPMA 3O1GA 3N3GA 1Q6KA 5FPWA 1ITOA 9PAPA 4I05A 1S4VA 1BY8A 5CVOB 3MORA 1CJLA 2R9MA 3F75A 1JQPA 4I04A 1GLOA 3MHHA 4QRVA 8PCHA 2G8JA 1VJVA 2XU1A 2YJ8A 2H7JA 5CHTA 4W4UA 3O0UA 3WXEA 3CBKA 2E01A 3K24A 2HHNA 1NQCA 1PIPA 1X9YA 2AVWA 2FT2A 4CDCB 1PXVA 3BPFA 3P5UA 1PADA 4FK5A 4HWYA 3CBJA 3KWBX 3P5WA 1MIRA 3RVWA 3H8BA 2G8EA 1BQIA 1MEMA 2Y5BA 1AU4A 4RY2A 4YYWA 3TNXA 4YYQA 2R9OA 3HHAA 3PW3A 5CHVA 1PE6A 2AUZA 3CH3X 3BWKA 1CVZA 5K16A 1GECE 2GHUA 1MS6A 3QSDA 1MEGA 1AYUA 2FRAA 2DC8A 5F02A 3N4CA 5JA7A 1KFUL 3S3RA 3IMAA 2DZYA 1THEA 3DF0A 1F2AA 1ZIVA 4PI3A 3U8EA 1VSNA 2B1MA 4AXMA 1MHWA 1AYVA 4X6JA 2FTDA 3S3QA 1KFXL 1SP4B 3RVXA 1O0EA 2VHFA 1TU6A 3CH2X 1A6RA 1KXRA 1FH0A 1F2CA 2DCAA 4YYVA 2P86A 2NQIA 1KHPA 4PP2E 5A24A 1CTEA 1YVBA 3N3KA 2E00A 3HD3A 1SNKA 1Y4HA 1TL9A 1CPJA 2CIOA 2NQGA 2PADA 3ERVA 6PADA 2DC9A 4OELA 1QDQA 4N79A 4Q8GA 3I3TA 1AU3A 2VHSA 2HXZA 5CVMA 2HH5A 3NHEA 3KX1A 2AS8A 2DCBA 2PNSA 3AI8A 3H89A 3OF9A 4FIPA 1AECA 1QXPA 2G7YA 4BSQA 2GFOA 1U9WA 3H7DA 2FUDA 2IPPB 2E02A 1PCIA 2CB5A 2JQGR 3KKUA 1ICFA 3MHSA 4CDEB 4YYSA 1AIMA 1EWPA 2P7UA 4P6EA 1AU0A 4QBBA 3I06A 1YK7A 3V6CA 2P0RA 3OF8A 3IEJA 1CQDA 7PCKA 3GCBA 4DMYA 1YT7A 2DCDA 2R9FA 2YJBA 1ZCMA 1U9XA 3E1ZB 1PPNA 2ARYA 3QJ3A 2XU3A 1NB5A 3B79A 3LXSA 3IOQA 1BGOA 2HD5A 1TLOA 4W5CA 3H6SA 2C0YA 2AIMA 3OVZA 1ME3A 1Y08A 1ATKA 1MDWA 2BDZA 1QOLA 2FRQA 1EF7A 3KFQA 4BPVA 3IUTA 1NB3A 4PP1A 4CDDB 1POPA 2AU1A 2OP3A 1U9VA 2R9NA 1DEUA 3KSEA 2DCCA 1QMYA 2AYNA 3WXGA 1U9QX 4I07A 1K3BB 2YJ9A 4BS6A 4MZOA 2OZ2A 2B1NA 1XKGA 2YJCA 3RVVA 3V6EA 1PPOA 1YALA 2AUXA 1ME4A 4YYRA 3ZUAA 1BP4A 3K8UA 2FQ9A 4FJCA 4XUIA 3BOWA 3PBHA 1M6DA 4PADA 2O6XA 1EWOA 4G54A 2XU4A 3MTNA 4QH6A 4QRGA 3USVA 1CSBB 3H8CA 2WBFX 3F5VA 4N4ZA 4P6GA 4YYUA 3P5VA 4YVAA 3HHIA 1NLJA 1YK8A 1IWDA 2OULA 5EGWA 2FYEA 4QRXA 1DF0A 1KHQA 2AYOA 2BDLA 2DZZA 2JQFR 3IV2A 1AU2A 2NQDB 4N8WA 1GCBA 2FO5A 3C9EA 1STFE 3K9MA 3KWZA 4DMXA 1GMYA 4BQVA 3QT4A 5J94A 5EF4A 1NPZA 4MSXA 1HUCB 1F2BA 3OISA 4BS5A 4ZUXU 5PADA 3LFYA 1PBHA 2PBHA 4Q8HA 1NL6A 2F7DA 3P5XA 3BCNA 2Y6EA 4XR7A 3HWNA 4W5BA 3WXFA 1AYWA 3M99A 4KLBA 5JH3A 1U5IA 2DJFB 2XU5A 1EWLA 5CVNB 2IBIA 1EWMA 2DC6A 1PPPA 2E03A 2NQAA 4AXLA 1CS8A 4WA6A 2F1GA 4OEMA 3D6SA 2DC7A 2PREA 3PDFA 3PNRA 4K7CA 4MZSA 4CDFB 4YV8A 1CV8A 1CB5A 2R9CA
chains in the Genus database with same CATH superfamily
4X6HA 3OVXA 2DOSA 1F29A 2R6NA 4X6IA 3BC3A 3KW9A 1PPDA 3IHPA 2YJ2A 3BY4A 2ACTA 2G6DA 2ATOA 4CZWA 2BTWB 3W30A 2DJGB 3BPMA 3O1GA 3PT2A 3TRKA 3N3GA 1Q6KA 4BOZA 4XZXA 1ITOA 5FPWA 9PAPA 4I05A 1S4VA 1BY8A 5CVOB 3MORA 2HWKA 1CJLA 2R9MA 3F75A 1JQPA 4BOSA 4I04A 1GLOA 3MHHA 4QRVA 8PCHA 2G8JA 3BB7A 1VJVA 2XU1A 2YJ8A 2H7JA 5CHTA 4W4UA 3O0UA 3WXEA 3CBKA 2E01A 3IFUA 3K24A 3PHWA 2HHNA 1NQCA 1PIPA 3O65A 1X9YA 2AVWA 2FT2A 4CDCB 1PXVA 4D8BA 3BPFA 3P5UA 1PADA 4FK5A 5JZEA 4HWYA 3CBJA 4D8IA 3KWBX 3P5WA 1MIRA 1YZBA 3RVWA 2J7QC 3H8BA 2G8EA 1BQIA 1MEMA 2Y5BA 1AU4A 4RY2A 4YYWA 3TNXA 3PRMA 4YYQA 2R9OA 3HHAA 3PW3A 5CHVA 1PE6A 2AUZA 3CH3X 3BWKA 1CVZA 5K16A 1GECE 2GHUA 1MS6A 3QSDA 1MEGA 3C0RA 1AYUA 3MTVA 2FRAA 2DC8A 5F02A 3N4CA 5EZQA 3E9SA 3TMPA 5JA7A 1KFUL 4RF1A 3S3RA 3IMAA 2DZYA 1THEA 3DF0A 1F2AA 3B21A 1ZIVA 4PI3A 3U8EA 1VSNA 2B1MA 1UKFA 4AXMA 1MHWA 1AYVA 5KO3A 4X6JA 4RKXA 5EZSA 2FTDA 3S3QA 1KFXL 1SP4B 3RVXA 1O0EA 4BOPA 2VHFA 1TU6A 3CH2X 1A6RA 1KXRA 1FH0A 1F2CA 2DCAA 4YYVA 2P86A 2NQIA 1KHPA 4PP2E 5A24A 1CTEA 1YVBA 3N3KA 2E00A 3HD3A 1SNKA 4RF0A 1Y4HA 1TL9A 1CPJA 2CIOA 2Z84A 4MM3B 2NQGA 2PADA 3ERVA 6PADA 2DC9A 4OELA 1QDQA 4N79A 4Q8GA 3I3TA 3PHXA 1AU3A 2VHSA 2HXZA 5CVMA 2HH5A 3NHEA 3KX1A 2AS8A 2DCBA 2PNSA 3AI8A 3H89A 3OF9A 4FIPA 1AECA 1QXPA 2G7YA 3BBAA 3PHUA 4BSQA 2FE8A 2GFOA 1U9WA 3H7DA 2FUDA 2IPPB 2E02A 1PCIA 2CB5A 2JQGR 3KKUA 1ICFA 3MHSA 4CDEB 4YYSA 4REZA 1AIMA 1EWPA 2P7UA 4P6EA 1AU0A 4QBBA 3I06A 1YK7A 3V6CA 2P0RA 3OF8A 3IEJA 1CQDA 7PCKA 2J7QA 3GCBA 4DMYA 1YT7A 4OVZB 2DCDA 2UZJA 2JRIA 4P16A 2R9FA 2YJBA 1ZCMA 1U9XA 4D8EA 3E1ZB 1PPNA 2ARYA 4RNAA 2AGAA 3QJ3A 2XU3A 1NB5A 3B79A 3LXSA 3IOQA 1BGOA 2HD5A 1TLOA 2JTCA 4W5CA 3H6SA 2C0YA 2AIMA 3OQCA 3OVZA 1ME3A 1Y08A 1ATKA 3MP2A 1MDWA 4A5UA 4OVZA 3RNVA 2BDZA 1QOLA 2FRQA 1EF7A 3KFQA 2BU3A 4BPVA 3IUTA 1NB3A 4R3DA 4PP1A 4CDDB 1POPA 2AU1A 2OP3A 1U9VA 2R9NA 1DEUA 3KSEA 4WURA 2DCCA 1QMYA 3ZNHA 2AYNA 3WXGA 1U9QX 4I07A 1K3BB 2YJ9A 4BS6A 4MZOA 2OZ2A 2B1NA 1XKGA 2YJCA 4IP3A 3RVVA 3V6EA 1PPOA 1YALA 2AUXA 1ME4A 4YYRA 3ZUAA 1BP4A 3K8UA 2FQ9A 2BTWA 4FJCA 4OW0A 4XUIA 3BOWA 3PBHA 1M6DA 4PADA 2O6XA 5E6JA 1EWOA 4G54A 2XU4A 3MTNA 4QH6A 4QRGA 3USVA 1CSBB 3PRPA 3H8CA 2WBFX 4GUAA 3F5VA 4N4ZA 4P6GA 4YYUA 3P5VA 4YVAA 3HHIA 1NLJA 1YK8A 1IWDA 2OULA 5EGWA 2FYEA 4QRXA 1DF0A 1KHQA 2AYOA 2BDLA 2DZZA 2JQFR 3IV2A 1AU2A 4N8WA 2NQDB 1GCBA 2FO5A 3C9EA 3PSEA 3MJ5A 1STFE 3K9MA 3KWZA 4DMXA 1GMYA 4BQVA 4HXDB 3QT4A 5J94A 5EF4A 1NPZA 4MSXA 4BOUA 1HUCB 1F2BA 3OISA 4BS5A 4ZUXU 5PADA 3LFYA 1PBHA 2PBHA 4Q8HA 4M0WA 1NL6A 2F7DA 3P5XA 3BCNA 2Y6EA 4XR7A 3HWNA 4MI7A 4W5BA 3WXFA 3W31A 1AYWA 3M99A 4KLBA 5JH3A 1U5IA 2DJFB 2XU5A 1EWLA 5CVNB 2IBIA 1EWMA 2DC6A 1PPPA 4PT5A 1DKIA 2E03A 2NQAA 4AXLA 1CS8A 4WA6A 2F1GA 4OEMA 4ZTBA 3D6SA 2DC7A 2PREA 3PDFA 3PNRA 4K7CA 4MZSA 4CDFB 4YV8A 1CV8A 4IUMA 4BOQA 1PVJA 1CB5A 2R9CA
chains in the Genus database with same CATH topology
4X6HA 3OVXA 1F29A 2R6NA 4X6IA 3BC3A 3KW9A 1PPDA 3IHPA 2YJ2A 2ACTA 2G6DA 2ATOA 4CZWA 2DJGB 3BPMA 3O1GA 1GX3A 3N3GA 1Q6KA 5FPWA 1ITOA 9PAPA 4I05A 1S4VA 1BY8A 5CVOB 4BGFA 3MORA 1CJLA 2R9MA 3F75A 1JQPA 4I04A 1GLOA 3MHHA 4QRVA 8PCHA 2G8JA 1VJVA 2XU1A 2YJ8A 2H7JA 5CHTA 4W4UA 3O0UA 3WXEA 3CBKA 2E01A 3K24A 2HHNA 1NQCA 1PIPA 1X9YA 2AVWA 2FT2A 4CDCB 1PXVA 4C5PA 3BPFA 3P5UA 1PADA 4FK5A 4HWYA 3CBJA 3KWBX 3P5WA 1MIRA 3RVWA 3H8BA 2G8EA 1BQIA 1MEMA 2Y5BA 1AU4A 4RY2A 4YYWA 3TNXA 4YYQA 2R9OA 3HHAA 3PW3A 5CHVA 1PE6A 2AUZA 3CH3X 3BWKA 1CVZA 5K16A 1GECE 2GHUA 1MS6A 3D9WA 3QSDA 1MEGA 1AYUA 2FRAA 2DC8A 5F02A 3N4CA 5JA7A 1KFUL 3S3RA 3IMAA 2DZYA 1THEA 3DF0A 1F2AA 1ZIVA 4PI3A 3U8EA 1VSNA 2B1MA 4AXMA 1MHWA 1AYVA 4X6JA 2FTDA 3S3QA 1KFXL 1SP4B 3RVXA 1O0EA 2VHFA 1TU6A 3CH2X 1A6RA 1KXRA 1FH0A 1F2CA 2DCAA 4YYVA 2P86A 2NQIA 1KHPA 4PP2E 5A24A 1CTEA 1YVBA 3N3KA 2E00A 3HD3A 1SNKA 2VFCA 1Y4HA 1TL9A 1CPJA 2CIOA 2NQGA 2PADA 3ERVA 6PADA 2DC9A 4OELA 1QDQA 4N79A 4Q8GA 3I3TA 1AU3A 2VHSA 2HXZA 5CVMA 2HH5A 3NHEA 3KX1A 2AS8A 2DCBA 2PNSA 3AI8A 3H89A 3OF9A 4FIPA 1AECA 1QXPA 2G7YA 4BSQA 2GFOA 1U9WA 3H7DA 2FUDA 2IPPB 4NV8A 2E02A 1PCIA 2CB5A 2JQGR 3KKUA 1ICFA 3MHSA 4CDEB 4YYSA 1AIMA 1EWPA 2P7UA 4P6EA 1AU0A 4QBBA 3I06A 1YK7A 3V6CA 2P0RA 2BSZA 3OF8A 3IEJA 1CQDA 7PCKA 3GCBA 4DMYA 1YT7A 2DCDA 2R9FA 2YJBA 1ZCMA 1U9XA 3E1ZB 1PPNA 2ARYA 3QJ3A 2XU3A 1NB5A 3B79A 3LXSA 3IOQA 1BGOA 2HD5A 1TLOA 4W5CA 3H6SA 2C0YA 2AIMA 3OVZA 1ME3A 1Y08A 1ATKA 1MDWA 2BDZA 1QOLA 2FRQA 1EF7A 3KFQA 4BPVA 3IUTA 1NB3A 4PP1A 4CDDB 1POPA 2AU1A 2OP3A 1U9VA 2R9NA 1DEUA 3KSEA 2DCCA 1QMYA 2AYNA 4NV7A 3WXGA 1U9QX 4I07A 1K3BB 2YJ9A 4BS6A 4MZOA 2OZ2A 2B1NA 1XKGA 2YJCA 3RVVA 3V6EA 1PPOA 1YALA 2AUXA 1ME4A 4YYRA 3ZUAA 1BP4A 3K8UA 2FQ9A 4FJCA 1W4TA 4XUIA 3BOWA 3PBHA 1W5RA 1M6DA 4PADA 2VFBA 2O6XA 1EWOA 4G54A 2XU4A 3MTNA 4QH6A 4QRGA 4GUZA 3USVA 1CSBB 3H8CA 2WBFX 3F5VA 4N4ZA 4P6GA 4YYUA 3P5VA 4YVAA 3HHIA 1NLJA 1YK8A 1IWDA 2OULA 5EGWA 2FYEA 4QRXA 1DF0A 1KHQA 2AYOA 2BDLA 2DZZA 2JQFR 3IV2A 1AU2A 2NQDB 1W6FA 4N8WA 1GCBA 2FO5A 3C9EA 1STFE 3K9MA 3KWZA 4DMXA 1GMYA 4BQVA 3QT4A 5J94A 5EF4A 1NPZA 4MSXA 1HUCB 1F2BA 3OISA 4BS5A 4ZUXU 5PADA 3LFYA 1PBHA 2PBHA 4Q8HA 3LTWA 1NL6A 2F7DA 3P5XA 3BCNA 2Y6EA 1E2TA 4XR7A 3HWNA 4W5BA 3WXFA 4B55A 1AYWA 3M99A 4KLBA 5JH3A 1U5IA 2DJFB 2XU5A 1EWLA 5CVNB 2IBIA 1EWMA 2DC6A 1PPPA 2E03A 2NQAA 4AXLA 1CS8A 4WA6A 2F1GA 4OEMA 3D6SA 2DC7A 2PREA 3PDFA 3PNRA 4K7CA 4MZSA 4CDFB 4YV8A 1CV8A 1CB5A 2R9CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X6H A;  3OVX A;  1F29 A;  2R6N A;  4X6I A;  3BC3 A;  3KW9 A;  1PPD A;  3IHP A;  2YJ2 A;  2ACT A;  2G6D A;  2ATO A;  4CZW A;  2DJG B;  3BPM A;  3O1G A;  3N3G A;  1Q6K A;  5FPW A;  1ITO A;  9PAP A;  4I05 A;  1S4V A;  1BY8 A;  5CVO B;  3MOR A;  1CJL A;  2R9M A;  3F75 A;  1JQP A;  4I04 A;  1GLO A;  3MHH A;  4QRV A;  8PCH A;  2G8J A;  1VJV A;  2XU1 A;  2YJ8 A;  2H7J A;  5CHT A;  4W4U A;  3O0U A;  3WXE A;  3CBK A;  2E01 A;  3K24 A;  2HHN A;  1NQC A;  1PIP A;  1X9Y A;  2AVW A;  2FT2 A;  4CDC B;  1PXV A;  3BPF A;  3P5U A;  1PAD A;  4FK5 A;  4HWY A;  3CBJ A;  3KWB X;  3P5W A;  1MIR A;  3RVW A;  3H8B A;  2G8E A;  1BQI A;  1MEM A;  2Y5B A;  1AU4 A;  4RY2 A;  4YYW A;  3TNX A;  4YYQ A;  2R9O A;  3HHA A;  3PW3 A;  5CHV A;  1PE6 A;  2AUZ A;  3CH3 X;  3BWK A;  1CVZ A;  5K16 A;  1GEC E;  2GHU A;  1MS6 A;  3QSD A;  1MEG A;  1AYU A;  2FRA A;  2DC8 A;  5F02 A;  3N4C A;  5JA7 A;  1KFU L;  3S3R A;  3IMA A;  2DZY A;  1THE A;  3DF0 A;  1F2A A;  1ZIV A;  4PI3 A;  3U8E A;  1VSN A;  2B1M A;  4AXM A;  1MHW A;  1AYV A;  4X6J A;  2FTD A;  3S3Q A;  1KFX L;  1SP4 B;  3RVX A;  1O0E A;  2VHF A;  1TU6 A;  3CH2 X;  1A6R A;  1KXR A;  1FH0 A;  1F2C A;  2DCA A;  4YYV A;  2P86 A;  2NQI A;  1KHP A;  4PP2 E;  5A24 A;  1CTE A;  1YVB A;  3N3K A;  2E00 A;  3HD3 A;  1SNK A;  1Y4H A;  1TL9 A;  1CPJ A;  2CIO A;  2NQG A;  2PAD A;  3ERV A;  6PAD A;  2DC9 A;  4OEL A;  1QDQ A;  4N79 A;  4Q8G A;  3I3T A;  1AU3 A;  2VHS A;  2HXZ A;  5CVM A;  2HH5 A;  3NHE A;  3KX1 A;  2AS8 A;  2DCB A;  2PNS A;  3AI8 A;  3H89 A;  3OF9 A;  4FIP A;  1AEC A;  1QXP A;  2G7Y A;  4BSQ A;  2GFO A;  1U9W A;  3H7D A;  2FUD A;  2IPP B;  2E02 A;  1PCI A;  2CB5 A;  2JQG R;  3KKU A;  1ICF A;  3MHS A;  4CDE B;  4YYS A;  1AIM A;  1EWP A;  2P7U A;  4P6E A;  1AU0 A;  4QBB A;  3I06 A;  1YK7 A;  3V6C A;  2P0R A;  3OF8 A;  3IEJ A;  1CQD A;  7PCK A;  3GCB A;  4DMY A;  1YT7 A;  2DCD A;  2R9F A;  2YJB A;  1ZCM A;  1U9X A;  3E1Z B;  1PPN A;  2ARY A;  3QJ3 A;  2XU3 A;  1NB5 A;  3B79 A;  3LXS A;  3IOQ A;  1BGO A;  2HD5 A;  1TLO A;  4W5C A;  3H6S A;  2C0Y A;  2AIM A;  3OVZ A;  1ME3 A;  1Y08 A;  1ATK A;  1MDW A;  2BDZ A;  1QOL A;  2FRQ A;  1EF7 A;  3KFQ A;  4BPV A;  3IUT A;  1NB3 A;  4PP1 A;  4CDD B;  1POP A;  2AU1 A;  2OP3 A;  1U9V A;  2R9N A;  1DEU A;  3KSE A;  2DCC A;  1QMY A;  2AYN A;  3WXG A;  1U9Q X;  4I07 A;  1K3B B;  2YJ9 A;  4BS6 A;  4MZO A;  2OZ2 A;  2B1N A;  1XKG A;  2YJC A;  3RVV A;  3V6E A;  1PPO A;  1YAL A;  2AUX A;  1ME4 A;  4YYR A;  3ZUA A;  1BP4 A;  3K8U A;  2FQ9 A;  4FJC A;  4XUI A;  3BOW A;  3PBH A;  1M6D A;  4PAD A;  2O6X A;  1EWO A;  4G54 A;  2XU4 A;  3MTN A;  4QH6 A;  4QRG A;  3USV A;  1CSB B;  3H8C A;  2WBF X;  3F5V A;  4N4Z A;  4P6G A;  4YYU A;  3P5V A;  4YVA A;  3HHI A;  1NLJ A;  1YK8 A;  1IWD A;  2OUL A;  5EGW A;  2FYE A;  4QRX A;  1DF0 A;  1KHQ A;  2AYO A;  2BDL A;  2DZZ A;  2JQF R;  3IV2 A;  1AU2 A;  2NQD B;  4N8W A;  1GCB A;  2FO5 A;  3C9E A;  1STF E;  3K9M A;  3KWZ A;  4DMX A;  1GMY A;  4BQV A;  3QT4 A;  5J94 A;  5EF4 A;  1NPZ A;  4MSX A;  1HUC B;  1F2B A;  3OIS A;  4BS5 A;  4ZUX U;  5PAD A;  3LFY A;  1PBH A;  2PBH A;  4Q8H A;  1NL6 A;  2F7D A;  3P5X A;  3BCN A;  2Y6E A;  4XR7 A;  3HWN A;  4W5B A;  3WXF A;  1AYW A;  3M99 A;  4KLB A;  5JH3 A;  1U5I A;  2DJF B;  2XU5 A;  1EWL A;  5CVN B;  2IBI A;  1EWM A;  2DC6 A;  1PPP A;  2E03 A;  2NQA A;  4AXL A;  1CS8 A;  4WA6 A;  2F1G A;  4OEM A;  3D6S A;  2DC7 A;  2PRE A;  3PDF A;  3PNR A;  4K7C A;  4MZS A;  4CDF B;  4YV8 A;  1CV8 A;  1CB5 A;  2R9C A; 
#chains in the Genus database with same CATH topology
 4X6H A;  3OVX A;  2DOS A;  1F29 A;  2R6N A;  4X6I A;  3BC3 A;  3KW9 A;  1PPD A;  3IHP A;  2YJ2 A;  3BY4 A;  2ACT A;  2G6D A;  2ATO A;  4CZW A;  2BTW B;  3W30 A;  2DJG B;  3BPM A;  3O1G A;  3PT2 A;  3TRK A;  3N3G A;  1Q6K A;  4BOZ A;  4XZX A;  1ITO A;  5FPW A;  9PAP A;  4I05 A;  1S4V A;  1BY8 A;  5CVO B;  3MOR A;  2HWK A;  1CJL A;  2R9M A;  3F75 A;  1JQP A;  4BOS A;  4I04 A;  1GLO A;  3MHH A;  4QRV A;  8PCH A;  2G8J A;  3BB7 A;  1VJV A;  2XU1 A;  2YJ8 A;  2H7J A;  5CHT A;  4W4U A;  3O0U A;  3WXE A;  3CBK A;  2E01 A;  3IFU A;  3K24 A;  3PHW A;  2HHN A;  1NQC A;  1PIP A;  3O65 A;  1X9Y A;  2AVW A;  2FT2 A;  4CDC B;  1PXV A;  4D8B A;  3BPF A;  3P5U A;  1PAD A;  4FK5 A;  5JZE A;  4HWY A;  3CBJ A;  4D8I A;  3KWB X;  3P5W A;  1MIR A;  1YZB A;  3RVW A;  2J7Q C;  3H8B A;  2G8E A;  1BQI A;  1MEM A;  2Y5B A;  1AU4 A;  4RY2 A;  4YYW A;  3TNX A;  3PRM A;  4YYQ A;  2R9O A;  3HHA A;  3PW3 A;  5CHV A;  1PE6 A;  2AUZ A;  3CH3 X;  3BWK A;  1CVZ A;  5K16 A;  1GEC E;  2GHU A;  1MS6 A;  3QSD A;  1MEG A;  3C0R A;  1AYU A;  3MTV A;  2FRA A;  2DC8 A;  5F02 A;  3N4C A;  5EZQ A;  3E9S A;  3TMP A;  5JA7 A;  1KFU L;  4RF1 A;  3S3R A;  3IMA A;  2DZY A;  1THE A;  3DF0 A;  1F2A A;  3B21 A;  1ZIV A;  4PI3 A;  3U8E A;  1VSN A;  2B1M A;  1UKF A;  4AXM A;  1MHW A;  1AYV A;  5KO3 A;  4X6J A;  4RKX A;  5EZS A;  2FTD A;  3S3Q A;  1KFX L;  1SP4 B;  3RVX A;  1O0E A;  4BOP A;  2VHF A;  1TU6 A;  3CH2 X;  1A6R A;  1KXR A;  1FH0 A;  1F2C A;  2DCA A;  4YYV A;  2P86 A;  2NQI A;  1KHP A;  4PP2 E;  5A24 A;  1CTE A;  1YVB A;  3N3K A;  2E00 A;  3HD3 A;  1SNK A;  4RF0 A;  1Y4H A;  1TL9 A;  1CPJ A;  2CIO A;  2Z84 A;  4MM3 B;  2NQG A;  2PAD A;  3ERV A;  6PAD A;  2DC9 A;  4OEL A;  1QDQ A;  4N79 A;  4Q8G A;  3I3T A;  3PHX A;  1AU3 A;  2VHS A;  2HXZ A;  5CVM A;  2HH5 A;  3NHE A;  3KX1 A;  2AS8 A;  2DCB A;  2PNS A;  3AI8 A;  3H89 A;  3OF9 A;  4FIP A;  1AEC A;  1QXP A;  2G7Y A;  3BBA A;  3PHU A;  4BSQ A;  2FE8 A;  2GFO A;  1U9W A;  3H7D A;  2FUD A;  2IPP B;  2E02 A;  1PCI A;  2CB5 A;  2JQG R;  3KKU A;  1ICF A;  3MHS A;  4CDE B;  4YYS A;  4REZ A;  1AIM A;  1EWP A;  2P7U A;  4P6E A;  1AU0 A;  4QBB A;  3I06 A;  1YK7 A;  3V6C A;  2P0R A;  3OF8 A;  3IEJ A;  1CQD A;  7PCK A;  2J7Q A;  3GCB A;  4DMY A;  1YT7 A;  4OVZ B;  2DCD A;  2UZJ A;  2JRI A;  4P16 A;  2R9F A;  2YJB A;  1ZCM A;  1U9X A;  4D8E A;  3E1Z B;  1PPN A;  2ARY A;  4RNA A;  2AGA A;  3QJ3 A;  2XU3 A;  1NB5 A;  3B79 A;  3LXS A;  3IOQ A;  1BGO A;  2HD5 A;  1TLO A;  2JTC A;  4W5C A;  3H6S A;  2C0Y A;  2AIM A;  3OQC A;  3OVZ A;  1ME3 A;  1Y08 A;  1ATK A;  3MP2 A;  1MDW A;  4A5U A;  4OVZ A;  3RNV A;  2BDZ A;  1QOL A;  2FRQ A;  1EF7 A;  3KFQ A;  2BU3 A;  4BPV A;  3IUT A;  1NB3 A;  4R3D A;  4PP1 A;  4CDD B;  1POP A;  2AU1 A;  2OP3 A;  1U9V A;  2R9N A;  1DEU A;  3KSE A;  4WUR A;  2DCC A;  1QMY A;  3ZNH A;  2AYN A;  3WXG A;  1U9Q X;  4I07 A;  1K3B B;  2YJ9 A;  4BS6 A;  4MZO A;  2OZ2 A;  2B1N A;  1XKG A;  2YJC A;  4IP3 A;  3RVV A;  3V6E A;  1PPO A;  1YAL A;  2AUX A;  1ME4 A;  4YYR A;  3ZUA A;  1BP4 A;  3K8U A;  2FQ9 A;  2BTW A;  4FJC A;  4OW0 A;  4XUI A;  3BOW A;  3PBH A;  1M6D A;  4PAD A;  2O6X A;  5E6J A;  1EWO A;  4G54 A;  2XU4 A;  3MTN A;  4QH6 A;  4QRG A;  3USV A;  1CSB B;  3PRP A;  3H8C A;  2WBF X;  4GUA A;  3F5V A;  4N4Z A;  4P6G A;  4YYU A;  3P5V A;  4YVA A;  3HHI A;  1NLJ A;  1YK8 A;  1IWD A;  2OUL A;  5EGW A;  2FYE A;  4QRX A;  1DF0 A;  1KHQ A;  2AYO A;  2BDL A;  2DZZ A;  2JQF R;  3IV2 A;  1AU2 A;  4N8W A;  2NQD B;  1GCB A;  2FO5 A;  3C9E A;  3PSE A;  3MJ5 A;  1STF E;  3K9M A;  3KWZ A;  4DMX A;  1GMY A;  4BQV A;  4HXD B;  3QT4 A;  5J94 A;  5EF4 A;  1NPZ A;  4MSX A;  4BOU A;  1HUC B;  1F2B A;  3OIS A;  4BS5 A;  4ZUX U;  5PAD A;  3LFY A;  1PBH A;  2PBH A;  4Q8H A;  4M0W A;  1NL6 A;  2F7D A;  3P5X A;  3BCN A;  2Y6E A;  4XR7 A;  3HWN A;  4MI7 A;  4W5B A;  3WXF A;  3W31 A;  1AYW A;  3M99 A;  4KLB A;  5JH3 A;  1U5I A;  2DJF B;  2XU5 A;  1EWL A;  5CVN B;  2IBI A;  1EWM A;  2DC6 A;  1PPP A;  4PT5 A;  1DKI A;  2E03 A;  2NQA A;  4AXL A;  1CS8 A;  4WA6 A;  2F1G A;  4OEM A;  4ZTB A;  3D6S A;  2DC7 A;  2PRE A;  3PDF A;  3PNR A;  4K7C A;  4MZS A;  4CDF B;  4YV8 A;  1CV8 A;  4IUM A;  4BOQ A;  1PVJ A;  1CB5 A;  2R9C A; 
#chains in the Genus database with same CATH homology
 4X6H A;  3OVX A;  1F29 A;  2R6N A;  4X6I A;  3BC3 A;  3KW9 A;  1PPD A;  3IHP A;  2YJ2 A;  2ACT A;  2G6D A;  2ATO A;  4CZW A;  2DJG B;  3BPM A;  3O1G A;  1GX3 A;  3N3G A;  1Q6K A;  5FPW A;  1ITO A;  9PAP A;  4I05 A;  1S4V A;  1BY8 A;  5CVO B;  4BGF A;  3MOR A;  1CJL A;  2R9M A;  3F75 A;  1JQP A;  4I04 A;  1GLO A;  3MHH A;  4QRV A;  8PCH A;  2G8J A;  1VJV A;  2XU1 A;  2YJ8 A;  2H7J A;  5CHT A;  4W4U A;  3O0U A;  3WXE A;  3CBK A;  2E01 A;  3K24 A;  2HHN A;  1NQC A;  1PIP A;  1X9Y A;  2AVW A;  2FT2 A;  4CDC B;  1PXV A;  4C5P A;  3BPF A;  3P5U A;  1PAD A;  4FK5 A;  4HWY A;  3CBJ A;  3KWB X;  3P5W A;  1MIR A;  3RVW A;  3H8B A;  2G8E A;  1BQI A;  1MEM A;  2Y5B A;  1AU4 A;  4RY2 A;  4YYW A;  3TNX A;  4YYQ A;  2R9O A;  3HHA A;  3PW3 A;  5CHV A;  1PE6 A;  2AUZ A;  3CH3 X;  3BWK A;  1CVZ A;  5K16 A;  1GEC E;  2GHU A;  1MS6 A;  3D9W A;  3QSD A;  1MEG A;  1AYU A;  2FRA A;  2DC8 A;  5F02 A;  3N4C A;  5JA7 A;  1KFU L;  3S3R A;  3IMA A;  2DZY A;  1THE A;  3DF0 A;  1F2A A;  1ZIV A;  4PI3 A;  3U8E A;  1VSN A;  2B1M A;  4AXM A;  1MHW A;  1AYV A;  4X6J A;  2FTD A;  3S3Q A;  1KFX L;  1SP4 B;  3RVX A;  1O0E A;  2VHF A;  1TU6 A;  3CH2 X;  1A6R A;  1KXR A;  1FH0 A;  1F2C A;  2DCA A;  4YYV A;  2P86 A;  2NQI A;  1KHP A;  4PP2 E;  5A24 A;  1CTE A;  1YVB A;  3N3K A;  2E00 A;  3HD3 A;  1SNK A;  2VFC A;  1Y4H A;  1TL9 A;  1CPJ A;  2CIO A;  2NQG A;  2PAD A;  3ERV A;  6PAD A;  2DC9 A;  4OEL A;  1QDQ A;  4N79 A;  4Q8G A;  3I3T A;  1AU3 A;  2VHS A;  2HXZ A;  5CVM A;  2HH5 A;  3NHE A;  3KX1 A;  2AS8 A;  2DCB A;  2PNS A;  3AI8 A;  3H89 A;  3OF9 A;  4FIP A;  1AEC A;  1QXP A;  2G7Y A;  4BSQ A;  2GFO A;  1U9W A;  3H7D A;  2FUD A;  2IPP B;  4NV8 A;  2E02 A;  1PCI A;  2CB5 A;  2JQG R;  3KKU A;  1ICF A;  3MHS A;  4CDE B;  4YYS A;  1AIM A;  1EWP A;  2P7U A;  4P6E A;  1AU0 A;  4QBB A;  3I06 A;  1YK7 A;  3V6C A;  2P0R A;  2BSZ A;  3OF8 A;  3IEJ A;  1CQD A;  7PCK A;  3GCB A;  4DMY A;  1YT7 A;  2DCD A;  2R9F A;  2YJB A;  1ZCM A;  1U9X A;  3E1Z B;  1PPN A;  2ARY A;  3QJ3 A;  2XU3 A;  1NB5 A;  3B79 A;  3LXS A;  3IOQ A;  1BGO A;  2HD5 A;  1TLO A;  4W5C A;  3H6S A;  2C0Y A;  2AIM A;  3OVZ A;  1ME3 A;  1Y08 A;  1ATK A;  1MDW A;  2BDZ A;  1QOL A;  2FRQ A;  1EF7 A;  3KFQ A;  4BPV A;  3IUT A;  1NB3 A;  4PP1 A;  4CDD B;  1POP A;  2AU1 A;  2OP3 A;  1U9V A;  2R9N A;  1DEU A;  3KSE A;  2DCC A;  1QMY A;  2AYN A;  4NV7 A;  3WXG A;  1U9Q X;  4I07 A;  1K3B B;  2YJ9 A;  4BS6 A;  4MZO A;  2OZ2 A;  2B1N A;  1XKG A;  2YJC A;  3RVV A;  3V6E A;  1PPO A;  1YAL A;  2AUX A;  1ME4 A;  4YYR A;  3ZUA A;  1BP4 A;  3K8U A;  2FQ9 A;  4FJC A;  1W4T A;  4XUI A;  3BOW A;  3PBH A;  1W5R A;  1M6D A;  4PAD A;  2VFB A;  2O6X A;  1EWO A;  4G54 A;  2XU4 A;  3MTN A;  4QH6 A;  4QRG A;  4GUZ A;  3USV A;  1CSB B;  3H8C A;  2WBF X;  3F5V A;  4N4Z A;  4P6G A;  4YYU A;  3P5V A;  4YVA A;  3HHI A;  1NLJ A;  1YK8 A;  1IWD A;  2OUL A;  5EGW A;  2FYE A;  4QRX A;  1DF0 A;  1KHQ A;  2AYO A;  2BDL A;  2DZZ A;  2JQF R;  3IV2 A;  1AU2 A;  2NQD B;  1W6F A;  4N8W A;  1GCB A;  2FO5 A;  3C9E A;  1STF E;  3K9M A;  3KWZ A;  4DMX A;  1GMY A;  4BQV A;  3QT4 A;  5J94 A;  5EF4 A;  1NPZ A;  4MSX A;  1HUC B;  1F2B A;  3OIS A;  4BS5 A;  4ZUX U;  5PAD A;  3LFY A;  1PBH A;  2PBH A;  4Q8H A;  3LTW A;  1NL6 A;  2F7D A;  3P5X A;  3BCN A;  2Y6E A;  1E2T A;  4XR7 A;  3HWN A;  4W5B A;  3WXF A;  4B55 A;  1AYW A;  3M99 A;  4KLB A;  5JH3 A;  1U5I A;  2DJF B;  2XU5 A;  1EWL A;  5CVN B;  2IBI A;  1EWM A;  2DC6 A;  1PPP A;  2E03 A;  2NQA A;  4AXL A;  1CS8 A;  4WA6 A;  2F1G A;  4OEM A;  3D6S A;  2DC7 A;  2PRE A;  3PDF A;  3PNR A;  4K7C A;  4MZS A;  4CDF B;  4YV8 A;  1CV8 A;  1CB5 A;  2R9C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...