4YYQA

Ficin a
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
216
structure length
215
Chain Sequence
LPETVDWRSKGAVNPIRNQGQCGSWAFSAVAAVESINKIVTGQLLSLSEQQLLDCAQSYKNLGCQGGWVNKAFEYIIQNRGITSQSNYPYTGHKGQCRTGLASIATIDSYQYVPSNNENALKNAVANQPVSVAVEAAGRAFQLYKSGVFTGSCGVAIDHAVVLIGYGKYNGVDYWLLRNSWGTNWGEQGYMKLQRNVAQSAGKCGVARLCLYPVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ficin isoform A
publication title Crystal structure of four variants of the protease Ficin from the common fig
rcsb
total genus 69
structure length 215
sequence length 216
chains with identical sequence B
ec nomenclature ec 3.4.22.3: Ficain.
pdb deposition date 2015-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4yyqA00
2PBHA 1YT7A 1BP4A 3BOWA 5K16A 2G8EA 2YJCA 4BQVA 1DF0A 4AXMA 4P6EA 3HHAA 2XU1A 2Y5BA 1ATKA 3F75A 5CVMA 4X6HA 3K8UA 4BSQA 4G54A 1AYVA 4CDDB 3P5UA 2E03A 1AYWA 3H8CA 4BPVA 1AU4A 1STFE 4Q8GA 2G6DA 1CJLA 1PE6A 4XR7A 2HD5A 2R9FA 4I04A 3ZUAA 2NQIA 2R9CA 4PADA 1EF7A 4QH6A 2R9MA 1Y08A 3QT4A 1O0EA 1MEGA 3ERVA 4YYWA 3MHHA 1NL6A 1TU6A 2DC7A 1GECE 1QXPA 3H6SA 4I07A 3N3GA 2AUXA 1QOLA 2AYOA 1CPJA 2XU4A 5JA7A 1PCIA 1VSNA 3RVXA 3O0UA 3S3QA 1BY8A 3P5WA 2VHSA 3WXFA 2E02A 3KW9A 1CSBB 1SP4B 2BDLA 1F2CA 2G8JA 2AUZA 3K9MA 1QMYA 2IBIA 4CZWA 1XKGA 2Y6EA 1CQDA 1YALA 2AVWA 3OF8A 1MEMA 1S4VA 2AU1A 3H8BA 1NB3A 3BWKA 3O1GA 2O6XA 4Q8HA 3PBHA 3BCNA 2PREA 2R9NA 4PI3A 3KKUA 2AYNA 1F29A 2CIOA 2B1NA 3CBKA 2OP3A 2AIMA 1ME4A 3AI8A 2G7YA 2VHFA 4AXLA 3LXSA 3WXGA 4YYRA 2OULA 5JH3A 2XU3A 1Q6KA 1SNKA 2FT2A 1MS6A 4P6GA 1F2AA 3M99A 1EWMA 1PPPA 3KWBX 1K3BB 2DJFB 1BGOA 2GFOA 2OZ2A 3PDFA 1TLOA 2DC8A 2P7UA 1NLJA 1CB5A 1PPDA 1CV8A 3HD3A 4ZUXU 4X6JA 3N4CA 9PAPA 1PXVA 4CDCB 3QJ3A 2FTDA 4YV8A 3U8EA 1ME3A 4QRXA 1U5IA 5PADA 1PPNA 3NHEA 1MDWA 3V6EA 2FRQA 4HWYA 3P5VA 1CVZA 1ZIVA 2WBFX 4N79A 2DCDA 2FUDA 1M6DA 1KHPA 3KSEA 4YYUA 4PP1A 3CH3X 1PPOA 2AS8A 3TNXA 1EWOA 3OVXA 4W5CA 1KHQA 3B79A 4I05A 4KLBA 3GCBA 2HHNA 2NQDB 1TL9A 4X6IA 1QDQA 2GHUA 1VJVA 4RY2A 4BS5A 5CHVA 2E00A 5F02A 1Y4HA 2IPPB 1ICFA 6PADA 3RVVA 1EWLA 2PNSA 2DC6A 1GCBA 1BQIA 1YVBA 1AYUA 1ZCMA 5A24A 1U9WA 3E1ZB 2HXZA 3BPMA 2DCCA 3OF9A 2P0RA 7PCKA 3OISA 3USVA 8PCHA 1EWPA 1YK7A 2BDZA 4QRGA 1YK8A 2FO5A 1NQCA 2DC9A 1KFXL 4XUIA 1PADA 3IMAA 3HWNA 4OEMA 4QBBA 3K24A 2YJ8A 3MHSA 3H89A 3CBJA 1PBHA 2FQ9A 2NQAA 1CS8A 2C0YA 2H7JA 5J94A 2CB5A 3DF0A 3IOQA 2YJBA 1AIMA 1CTEA 4YYSA 2JQGR 2ARYA 2DCBA 1PIPA 1MHWA 3P5XA 4WA6A 4MZSA 3MORA 3D6SA 1HUCB 1MIRA 2DJGB 4YVAA 2YJ2A 4FIPA 1NPZA 5FPWA 4CDFB 3IEJA 4CDEB 1U9QX 4N8WA 1GLOA 4W5BA 2R6NA 3LFYA 3C9EA 5CHTA 4DMXA 4K7CA 4YYVA 1JQPA 1U9XA 4FJCA 5EGWA 2ATOA 1A6RA 3N3KA 1AU3A 4QRVA 1GMYA 3OVZA 3F5VA 1ITOA 3HHIA 4DMYA 4BS6A 4PP2E 4W4UA 2P86A 2F1GA 4MZOA 2YJ9A 1DEUA 3PW3A 1IWDA 3I06A 3CH2X 2FRAA 3S3RA 4MSXA 3I3TA 3WXEA 3IHPA 5EF4A 1THEA 2JQFR 3KFQA 2DCAA 3MTNA 2DZYA 3BPFA 1AECA 1AU0A 2PADA 3PNRA 2E01A 1X9YA 3RVWA 2R9OA 2DZZA 2HH5A 1U9VA 1KFUL 3V6CA 3BC3A 3KX1A 2F7DA 1F2BA 4FK5A 4YYQA 5CVNB 2FYEA 1AU2A 1POPA 4OELA 1KXRA 2B1MA 2NQGA 2ACTA 1NB5A 5CVOB 3IUTA 3QSDA 3H7DA 3IV2A 1FH0A 3KWZA 4N4ZA 2XU5A
chains in the Genus database with same CATH superfamily
4OVZA 2PBHA 1YT7A 1BP4A 3BOWA 5K16A 2G8EA 2YJCA 4BQVA 1DF0A 3PHWA 4HXDB 4AXMA 4P6EA 3HHAA 2XU1A 2Y5BA 1ATKA 3F75A 5CVMA 3MTVA 4X6HA 3K8UA 5KO3A 4BSQA 4G54A 1AYVA 4CDDB 3P5UA 2E03A 1AYWA 3H8CA 4BPVA 1AU4A 1STFE 4Q8GA 2G6DA 1CJLA 1PE6A 4XR7A 2HD5A 2R9FA 4I04A 3PRPA 3ZUAA 2NQIA 2R9CA 4PADA 1EF7A 2R9MA 4QH6A 1Y08A 3QT4A 1O0EA 1MEGA 3ERVA 1DKIA 4YYWA 3MHHA 1NL6A 1TU6A 2DC7A 4PT5A 1GECE 1QXPA 3H6SA 4I07A 3N3GA 2AUXA 1QOLA 4RKXA 2AYOA 1CPJA 2XU4A 5JA7A 1PCIA 1VSNA 3RVXA 3O0UA 3S3QA 1BY8A 4A5UA 3P5WA 4WURA 2VHSA 2JRIA 2E02A 3KW9A 3WXFA 1CSBB 1SP4B 2BDLA 2UZJA 1F2CA 2G8JA 2AUZA 3IFUA 3PRMA 3K9MA 1QMYA 3PT2A 2IBIA 4CZWA 1XKGA 2Y6EA 4IUMA 1CQDA 1YALA 2AVWA 3OF8A 1MEMA 1S4VA 2AU1A 3H8BA 1NB3A 3BWKA 4RF0A 3O1GA 2O6XA 4Q8HA 1PVJA 4ZTBA 3PBHA 3E9SA 2FE8A 3BCNA 2J7QC 2PREA 2R9NA 4PI3A 3KKUA 2AYNA 1F29A 2CIOA 3OQCA 4M0WA 2B1NA 3CBKA 2OP3A 2AIMA 3BB7A 1ME4A 3AI8A 2G7YA 2VHFA 4AXLA 3LXSA 5JZEA 3WXGA 4YYRA 2OULA 5JH3A 2XU3A 1Q6KA 1SNKA 2FT2A 1MS6A 4P6GA 1F2AA 3M99A 1EWMA 1PPPA 3KWBX 1K3BB 2DJFB 1YZBA 1BGOA 2GFOA 1UKFA 2OZ2A 3PDFA 1TLOA 2DOSA 2DC8A 2P7UA 1NLJA 4BOUA 1CB5A 4D8BA 1PPDA 1CV8A 3HD3A 4ZUXU 2Z84A 4X6JA 3N4CA 9PAPA 1PXVA 4CDCB 3QJ3A 2FTDA 4YV8A 3U8EA 1ME3A 4QRXA 1U5IA 5PADA 1PPNA 3NHEA 1MDWA 3V6EA 3PSEA 2FRQA 4HWYA 3PHXA 3P5VA 1CVZA 1ZIVA 2WBFX 3RNVA 4N79A 2DCDA 4OW0A 2FUDA 1M6DA 1KHPA 3KSEA 4RNAA 4YYUA 3ZNHA 4PP1A 4BOZA 3CH3X 1PPOA 2AS8A 4BOQA 3TNXA 1EWOA 3OVXA 3TMPA 4W5CA 1KHQA 3B79A 4I05A 4KLBA 3GCBA 2HHNA 2NQDB 1TL9A 4X6IA 1QDQA 2GHUA 1VJVA 4RY2A 4BS5A 5CHVA 2E00A 5F02A 1Y4HA 2IPPB 1ICFA 6PADA 3RVVA 1EWLA 2PNSA 2DC6A 1GCBA 1BQIA 1YVBA 1AYUA 1ZCMA 5A24A 1U9WA 3E1ZB 2HXZA 3W31A 3BPMA 2DCCA 3OF9A 2P0RA 4P16A 7PCKA 4OVZB 3OISA 4RF1A 3USVA 8PCHA 1EWPA 1YK7A 2BDZA 4QRGA 1YK8A 2FO5A 1NQCA 2DC9A 1KFXL 4XUIA 5E6JA 1PADA 3IMAA 4BOPA 3HWNA 4OEMA 4QBBA 3K24A 2YJ8A 3MHSA 4IP3A 3H89A 3PHUA 3CBJA 1PBHA 2FQ9A 2NQAA 1CS8A 2C0YA 2H7JA 5J94A 2BTWB 2CB5A 3DF0A 3IOQA 2YJBA 4MI7A 1AIMA 1CTEA 4YYSA 3MJ5A 2JQGR 2ARYA 2DCBA 1PIPA 1MHWA 3P5XA 4WA6A 4MZSA 3MORA 3D6SA 1HUCB 1MIRA 2DJGB 3BBAA 3O65A 5EZSA 4GUAA 4YVAA 2YJ2A 4FIPA 2HWKA 1NPZA 5FPWA 4CDFB 3IEJA 4CDEB 1U9QX 4N8WA 1GLOA 4XZXA 4W5BA 2R6NA 3LFYA 3C9EA 4D8IA 5CHTA 4DMXA 4K7CA 4YYVA 2JTCA 3BY4A 4R3DA 1JQPA 1U9XA 4FJCA 2J7QA 5EGWA 2ATOA 2BTWA 1A6RA 4REZA 3N3KA 1AU3A 4QRVA 1GMYA 3OVZA 3F5VA 1ITOA 3HHIA 4DMYA 4D8EA 4BS6A 4PP2E 4W4UA 2P86A 2F1GA 4MZOA 2YJ9A 5EZQA 3W30A 1DEUA 3PW3A 1IWDA 3TRKA 3I06A 3CH2X 2FRAA 3S3RA 4MSXA 3I3TA 3WXEA 3IHPA 2AGAA 5EF4A 1THEA 2JQFR 3KFQA 2DCAA 3MTNA 2DZYA 3MP2A 3BPFA 1AECA 1AU0A 2BU3A 2PADA 3PNRA 2E01A 1X9YA 3RVWA 2R9OA 2DZZA 2HH5A 1U9VA 1KFUL 3V6CA 3B21A 3BC3A 3KX1A 4BOSA 2F7DA 1F2BA 3C0RA 4FK5A 4YYQA 5CVNB 2FYEA 1AU2A 1POPA 4OELA 1KXRA 2B1MA 2NQGA 2ACTA 4MM3B 1NB5A 5CVOB 3IUTA 3QSDA 3H7DA 3IV2A 1FH0A 3KWZA 4N4ZA 2XU5A
chains in the Genus database with same CATH topology
2PBHA 1YT7A 1BP4A 3BOWA 5K16A 4C5PA 2G8EA 2YJCA 4BQVA 1DF0A 4AXMA 4P6EA 3HHAA 2XU1A 2Y5BA 1ATKA 3F75A 5CVMA 4X6HA 2BSZA 3K8UA 4BSQA 4G54A 1AYVA 4CDDB 3P5UA 2E03A 1AYWA 3H8CA 4BPVA 1AU4A 1STFE 4Q8GA 2G6DA 1CJLA 1PE6A 3D9WA 4XR7A 2HD5A 2R9FA 4I04A 3ZUAA 2NQIA 2R9CA 4PADA 1EF7A 2R9MA 4QH6A 1Y08A 3QT4A 1O0EA 1MEGA 3ERVA 1W5RA 4YYWA 3MHHA 1NL6A 1TU6A 2DC7A 4NV8A 1GX3A 1GECE 1QXPA 3H6SA 4I07A 3N3GA 2AUXA 1QOLA 2AYOA 1CPJA 2XU4A 5JA7A 1PCIA 1VSNA 3RVXA 3O0UA 3S3QA 1BY8A 3P5WA 2VHSA 3WXFA 2E02A 3KW9A 1CSBB 1SP4B 2BDLA 1F2CA 2G8JA 2AUZA 4GUZA 3K9MA 1QMYA 2IBIA 4CZWA 1XKGA 2Y6EA 1CQDA 1YALA 2AVWA 3OF8A 1MEMA 1S4VA 4NV7A 2AU1A 3H8BA 1NB3A 3BWKA 3O1GA 2O6XA 4Q8HA 3PBHA 3BCNA 2PREA 2R9NA 4PI3A 3KKUA 2AYNA 2VFBA 1F29A 2CIOA 2B1NA 3CBKA 2OP3A 2AIMA 1ME4A 3AI8A 2G7YA 2VHFA 4AXLA 3LXSA 3WXGA 4YYRA 2OULA 5JH3A 2XU3A 1Q6KA 1SNKA 2FT2A 1MS6A 4P6GA 1F2AA 3M99A 1EWMA 1PPPA 3KWBX 1K3BB 2DJFB 1BGOA 2GFOA 2OZ2A 3PDFA 1TLOA 2DC8A 2P7UA 1NLJA 1CB5A 1PPDA 1CV8A 3HD3A 4ZUXU 4X6JA 3N4CA 9PAPA 1PXVA 4CDCB 3QJ3A 2FTDA 4YV8A 3U8EA 1ME3A 4QRXA 1U5IA 5PADA 1PPNA 3NHEA 1MDWA 3V6EA 2FRQA 4HWYA 3P5VA 1CVZA 1ZIVA 2WBFX 4N79A 2DCDA 2FUDA 1M6DA 1KHPA 3KSEA 4YYUA 4PP1A 3CH3X 1PPOA 2AS8A 3TNXA 1EWOA 3OVXA 4W5CA 1KHQA 3B79A 4BGFA 4I05A 4KLBA 3GCBA 2HHNA 2NQDB 1TL9A 4X6IA 1QDQA 2GHUA 1VJVA 4RY2A 4BS5A 5CHVA 2E00A 5F02A 1Y4HA 2IPPB 1ICFA 6PADA 3RVVA 1EWLA 2PNSA 2DC6A 1GCBA 1BQIA 1YVBA 1AYUA 1ZCMA 5A24A 1U9WA 3E1ZB 2HXZA 3BPMA 2DCCA 3OF9A 2P0RA 7PCKA 2VFCA 3OISA 3USVA 4B55A 8PCHA 1EWPA 1YK7A 2BDZA 4QRGA 1YK8A 2FO5A 1NQCA 2DC9A 1KFXL 4XUIA 1PADA 3IMAA 3HWNA 4OEMA 4QBBA 3K24A 2YJ8A 3MHSA 3H89A 3CBJA 1PBHA 2FQ9A 2NQAA 1CS8A 2C0YA 2H7JA 5J94A 2CB5A 3DF0A 3IOQA 2YJBA 1AIMA 1CTEA 4YYSA 2JQGR 2ARYA 2DCBA 1PIPA 1MHWA 3P5XA 4WA6A 4MZSA 3MORA 3D6SA 1HUCB 1MIRA 2DJGB 4YVAA 2YJ2A 4FIPA 1NPZA 5FPWA 4CDFB 3IEJA 4CDEB 1U9QX 4N8WA 1GLOA 1E2TA 4W5BA 1W4TA 2R6NA 3LFYA 3C9EA 5CHTA 4DMXA 4K7CA 4YYVA 1JQPA 1U9XA 4FJCA 5EGWA 2ATOA 1A6RA 3N3KA 1AU3A 4QRVA 1GMYA 3OVZA 3F5VA 1ITOA 3HHIA 4DMYA 4BS6A 4PP2E 4W4UA 2P86A 2F1GA 4MZOA 2YJ9A 1DEUA 3PW3A 1IWDA 3I06A 3CH2X 2FRAA 3S3RA 4MSXA 3I3TA 3WXEA 3IHPA 5EF4A 1THEA 2JQFR 3KFQA 2DCAA 3MTNA 2DZYA 3BPFA 3LTWA 1AECA 1AU0A 2PADA 3PNRA 2E01A 1X9YA 3RVWA 2R9OA 2DZZA 2HH5A 1U9VA 1KFUL 3V6CA 1W6FA 3BC3A 3KX1A 2F7DA 1F2BA 4FK5A 4YYQA 5CVNB 2FYEA 1AU2A 1POPA 4OELA 1KXRA 2B1MA 2NQGA 2ACTA 1NB5A 5CVOB 3IUTA 3QSDA 3H7DA 3IV2A 1FH0A 3KWZA 4N4ZA 2XU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PBH A;  1YT7 A;  1BP4 A;  3BOW A;  5K16 A;  2G8E A;  2YJC A;  4BQV A;  1DF0 A;  4AXM A;  4P6E A;  3HHA A;  2XU1 A;  2Y5B A;  1ATK A;  3F75 A;  5CVM A;  4X6H A;  3K8U A;  4BSQ A;  4G54 A;  1AYV A;  4CDD B;  3P5U A;  2E03 A;  1AYW A;  3H8C A;  4BPV A;  1AU4 A;  1STF E;  4Q8G A;  2G6D A;  1CJL A;  1PE6 A;  4XR7 A;  2HD5 A;  2R9F A;  4I04 A;  3ZUA A;  2NQI A;  2R9C A;  4PAD A;  1EF7 A;  4QH6 A;  2R9M A;  1Y08 A;  3QT4 A;  1O0E A;  1MEG A;  3ERV A;  4YYW A;  3MHH A;  1NL6 A;  1TU6 A;  2DC7 A;  1GEC E;  1QXP A;  3H6S A;  4I07 A;  3N3G A;  2AUX A;  1QOL A;  2AYO A;  1CPJ A;  2XU4 A;  5JA7 A;  1PCI A;  1VSN A;  3RVX A;  3O0U A;  3S3Q A;  1BY8 A;  3P5W A;  2VHS A;  3WXF A;  2E02 A;  3KW9 A;  1CSB B;  1SP4 B;  2BDL A;  1F2C A;  2G8J A;  2AUZ A;  3K9M A;  1QMY A;  2IBI A;  4CZW A;  1XKG A;  2Y6E A;  1CQD A;  1YAL A;  2AVW A;  3OF8 A;  1MEM A;  1S4V A;  2AU1 A;  3H8B A;  1NB3 A;  3BWK A;  3O1G A;  2O6X A;  4Q8H A;  3PBH A;  3BCN A;  2PRE A;  2R9N A;  4PI3 A;  3KKU A;  2AYN A;  1F29 A;  2CIO A;  2B1N A;  3CBK A;  2OP3 A;  2AIM A;  1ME4 A;  3AI8 A;  2G7Y A;  2VHF A;  4AXL A;  3LXS A;  3WXG A;  4YYR A;  2OUL A;  5JH3 A;  2XU3 A;  1Q6K A;  1SNK A;  2FT2 A;  1MS6 A;  4P6G A;  1F2A A;  3M99 A;  1EWM A;  1PPP A;  3KWB X;  1K3B B;  2DJF B;  1BGO A;  2GFO A;  2OZ2 A;  3PDF A;  1TLO A;  2DC8 A;  2P7U A;  1NLJ A;  1CB5 A;  1PPD A;  1CV8 A;  3HD3 A;  4ZUX U;  4X6J A;  3N4C A;  9PAP A;  1PXV A;  4CDC B;  3QJ3 A;  2FTD A;  4YV8 A;  3U8E A;  1ME3 A;  4QRX A;  1U5I A;  5PAD A;  1PPN A;  3NHE A;  1MDW A;  3V6E A;  2FRQ A;  4HWY A;  3P5V A;  1CVZ A;  1ZIV A;  2WBF X;  4N79 A;  2DCD A;  2FUD A;  1M6D A;  1KHP A;  3KSE A;  4YYU A;  4PP1 A;  3CH3 X;  1PPO A;  2AS8 A;  3TNX A;  1EWO A;  3OVX A;  4W5C A;  1KHQ A;  3B79 A;  4I05 A;  4KLB A;  3GCB A;  2HHN A;  2NQD B;  1TL9 A;  4X6I A;  1QDQ A;  2GHU A;  1VJV A;  4RY2 A;  4BS5 A;  5CHV A;  2E00 A;  5F02 A;  1Y4H A;  2IPP B;  1ICF A;  6PAD A;  3RVV A;  1EWL A;  2PNS A;  2DC6 A;  1GCB A;  1BQI A;  1YVB A;  1AYU A;  1ZCM A;  5A24 A;  1U9W A;  3E1Z B;  2HXZ A;  3BPM A;  2DCC A;  3OF9 A;  2P0R A;  7PCK A;  3OIS A;  3USV A;  8PCH A;  1EWP A;  1YK7 A;  2BDZ A;  4QRG A;  1YK8 A;  2FO5 A;  1NQC A;  2DC9 A;  1KFX L;  4XUI A;  1PAD A;  3IMA A;  3HWN A;  4OEM A;  4QBB A;  3K24 A;  2YJ8 A;  3MHS A;  3H89 A;  3CBJ A;  1PBH A;  2FQ9 A;  2NQA A;  1CS8 A;  2C0Y A;  2H7J A;  5J94 A;  2CB5 A;  3DF0 A;  3IOQ A;  2YJB A;  1AIM A;  1CTE A;  4YYS A;  2JQG R;  2ARY A;  2DCB A;  1PIP A;  1MHW A;  3P5X A;  4WA6 A;  4MZS A;  3MOR A;  3D6S A;  1HUC B;  1MIR A;  2DJG B;  4YVA A;  2YJ2 A;  4FIP A;  1NPZ A;  5FPW A;  4CDF B;  3IEJ A;  4CDE B;  1U9Q X;  4N8W A;  1GLO A;  4W5B A;  2R6N A;  3LFY A;  3C9E A;  5CHT A;  4DMX A;  4K7C A;  4YYV A;  1JQP A;  1U9X A;  4FJC A;  5EGW A;  2ATO A;  1A6R A;  3N3K A;  1AU3 A;  4QRV A;  1GMY A;  3OVZ A;  3F5V A;  1ITO A;  3HHI A;  4DMY A;  4BS6 A;  4PP2 E;  4W4U A;  2P86 A;  2F1G A;  4MZO A;  2YJ9 A;  1DEU A;  3PW3 A;  1IWD A;  3I06 A;  3CH2 X;  2FRA A;  3S3R A;  4MSX A;  3I3T A;  3WXE A;  3IHP A;  5EF4 A;  1THE A;  2JQF R;  3KFQ A;  2DCA A;  3MTN A;  2DZY A;  3BPF A;  1AEC A;  1AU0 A;  2PAD A;  3PNR A;  2E01 A;  1X9Y A;  3RVW A;  2R9O A;  2DZZ A;  2HH5 A;  1U9V A;  1KFU L;  3V6C A;  3BC3 A;  3KX1 A;  2F7D A;  1F2B A;  4FK5 A;  4YYQ A;  5CVN B;  2FYE A;  1AU2 A;  1POP A;  4OEL A;  1KXR A;  2B1M A;  2NQG A;  2ACT A;  1NB5 A;  5CVO B;  3IUT A;  3QSD A;  3H7D A;  3IV2 A;  1FH0 A;  3KWZ A;  4N4Z A;  2XU5 A; 
#chains in the Genus database with same CATH topology
 4OVZ A;  2PBH A;  1YT7 A;  1BP4 A;  3BOW A;  5K16 A;  2G8E A;  2YJC A;  4BQV A;  1DF0 A;  3PHW A;  4HXD B;  4AXM A;  4P6E A;  3HHA A;  2XU1 A;  2Y5B A;  1ATK A;  3F75 A;  5CVM A;  3MTV A;  4X6H A;  3K8U A;  5KO3 A;  4BSQ A;  4G54 A;  1AYV A;  4CDD B;  3P5U A;  2E03 A;  1AYW A;  3H8C A;  4BPV A;  1AU4 A;  1STF E;  4Q8G A;  2G6D A;  1CJL A;  1PE6 A;  4XR7 A;  2HD5 A;  2R9F A;  4I04 A;  3PRP A;  3ZUA A;  2NQI A;  2R9C A;  4PAD A;  1EF7 A;  2R9M A;  4QH6 A;  1Y08 A;  3QT4 A;  1O0E A;  1MEG A;  3ERV A;  1DKI A;  4YYW A;  3MHH A;  1NL6 A;  1TU6 A;  2DC7 A;  4PT5 A;  1GEC E;  1QXP A;  3H6S A;  4I07 A;  3N3G A;  2AUX A;  1QOL A;  4RKX A;  2AYO A;  1CPJ A;  2XU4 A;  5JA7 A;  1PCI A;  1VSN A;  3RVX A;  3O0U A;  3S3Q A;  1BY8 A;  4A5U A;  3P5W A;  4WUR A;  2VHS A;  2JRI A;  2E02 A;  3KW9 A;  3WXF A;  1CSB B;  1SP4 B;  2BDL A;  2UZJ A;  1F2C A;  2G8J A;  2AUZ A;  3IFU A;  3PRM A;  3K9M A;  1QMY A;  3PT2 A;  2IBI A;  4CZW A;  1XKG A;  2Y6E A;  4IUM A;  1CQD A;  1YAL A;  2AVW A;  3OF8 A;  1MEM A;  1S4V A;  2AU1 A;  3H8B A;  1NB3 A;  3BWK A;  4RF0 A;  3O1G A;  2O6X A;  4Q8H A;  1PVJ A;  4ZTB A;  3PBH A;  3E9S A;  2FE8 A;  3BCN A;  2J7Q C;  2PRE A;  2R9N A;  4PI3 A;  3KKU A;  2AYN A;  1F29 A;  2CIO A;  3OQC A;  4M0W A;  2B1N A;  3CBK A;  2OP3 A;  2AIM A;  3BB7 A;  1ME4 A;  3AI8 A;  2G7Y A;  2VHF A;  4AXL A;  3LXS A;  5JZE A;  3WXG A;  4YYR A;  2OUL A;  5JH3 A;  2XU3 A;  1Q6K A;  1SNK A;  2FT2 A;  1MS6 A;  4P6G A;  1F2A A;  3M99 A;  1EWM A;  1PPP A;  3KWB X;  1K3B B;  2DJF B;  1YZB A;  1BGO A;  2GFO A;  1UKF A;  2OZ2 A;  3PDF A;  1TLO A;  2DOS A;  2DC8 A;  2P7U A;  1NLJ A;  4BOU A;  1CB5 A;  4D8B A;  1PPD A;  1CV8 A;  3HD3 A;  4ZUX U;  2Z84 A;  4X6J A;  3N4C A;  9PAP A;  1PXV A;  4CDC B;  3QJ3 A;  2FTD A;  4YV8 A;  3U8E A;  1ME3 A;  4QRX A;  1U5I A;  5PAD A;  1PPN A;  3NHE A;  1MDW A;  3V6E A;  3PSE A;  2FRQ A;  4HWY A;  3PHX A;  3P5V A;  1CVZ A;  1ZIV A;  2WBF X;  3RNV A;  4N79 A;  2DCD A;  4OW0 A;  2FUD A;  1M6D A;  1KHP A;  3KSE A;  4RNA A;  4YYU A;  3ZNH A;  4PP1 A;  4BOZ A;  3CH3 X;  1PPO A;  2AS8 A;  4BOQ A;  3TNX A;  1EWO A;  3OVX A;  3TMP A;  4W5C A;  1KHQ A;  3B79 A;  4I05 A;  4KLB A;  3GCB A;  2HHN A;  2NQD B;  1TL9 A;  4X6I A;  1QDQ A;  2GHU A;  1VJV A;  4RY2 A;  4BS5 A;  5CHV A;  2E00 A;  5F02 A;  1Y4H A;  2IPP B;  1ICF A;  6PAD A;  3RVV A;  1EWL A;  2PNS A;  2DC6 A;  1GCB A;  1BQI A;  1YVB A;  1AYU A;  1ZCM A;  5A24 A;  1U9W A;  3E1Z B;  2HXZ A;  3W31 A;  3BPM A;  2DCC A;  3OF9 A;  2P0R A;  4P16 A;  7PCK A;  4OVZ B;  3OIS A;  4RF1 A;  3USV A;  8PCH A;  1EWP A;  1YK7 A;  2BDZ A;  4QRG A;  1YK8 A;  2FO5 A;  1NQC A;  2DC9 A;  1KFX L;  4XUI A;  5E6J A;  1PAD A;  3IMA A;  4BOP A;  3HWN A;  4OEM A;  4QBB A;  3K24 A;  2YJ8 A;  3MHS A;  4IP3 A;  3H89 A;  3PHU A;  3CBJ A;  1PBH A;  2FQ9 A;  2NQA A;  1CS8 A;  2C0Y A;  2H7J A;  5J94 A;  2BTW B;  2CB5 A;  3DF0 A;  3IOQ A;  2YJB A;  4MI7 A;  1AIM A;  1CTE A;  4YYS A;  3MJ5 A;  2JQG R;  2ARY A;  2DCB A;  1PIP A;  1MHW A;  3P5X A;  4WA6 A;  4MZS A;  3MOR A;  3D6S A;  1HUC B;  1MIR A;  2DJG B;  3BBA A;  3O65 A;  5EZS A;  4GUA A;  4YVA A;  2YJ2 A;  4FIP A;  2HWK A;  1NPZ A;  5FPW A;  4CDF B;  3IEJ A;  4CDE B;  1U9Q X;  4N8W A;  1GLO A;  4XZX A;  4W5B A;  2R6N A;  3LFY A;  3C9E A;  4D8I A;  5CHT A;  4DMX A;  4K7C A;  4YYV A;  2JTC A;  3BY4 A;  4R3D A;  1JQP A;  1U9X A;  4FJC A;  2J7Q A;  5EGW A;  2ATO A;  2BTW A;  1A6R A;  4REZ A;  3N3K A;  1AU3 A;  4QRV A;  1GMY A;  3OVZ A;  3F5V A;  1ITO A;  3HHI A;  4DMY A;  4D8E A;  4BS6 A;  4PP2 E;  4W4U A;  2P86 A;  2F1G A;  4MZO A;  2YJ9 A;  5EZQ A;  3W30 A;  1DEU A;  3PW3 A;  1IWD A;  3TRK A;  3I06 A;  3CH2 X;  2FRA A;  3S3R A;  4MSX A;  3I3T A;  3WXE A;  3IHP A;  2AGA A;  5EF4 A;  1THE A;  2JQF R;  3KFQ A;  2DCA A;  3MTN A;  2DZY A;  3MP2 A;  3BPF A;  1AEC A;  1AU0 A;  2BU3 A;  2PAD A;  3PNR A;  2E01 A;  1X9Y A;  3RVW A;  2R9O A;  2DZZ A;  2HH5 A;  1U9V A;  1KFU L;  3V6C A;  3B21 A;  3BC3 A;  3KX1 A;  4BOS A;  2F7D A;  1F2B A;  3C0R A;  4FK5 A;  4YYQ A;  5CVN B;  2FYE A;  1AU2 A;  1POP A;  4OEL A;  1KXR A;  2B1M A;  2NQG A;  2ACT A;  4MM3 B;  1NB5 A;  5CVO B;  3IUT A;  3QSD A;  3H7D A;  3IV2 A;  1FH0 A;  3KWZ A;  4N4Z A;  2XU5 A; 
#chains in the Genus database with same CATH homology
 2PBH A;  1YT7 A;  1BP4 A;  3BOW A;  5K16 A;  4C5P A;  2G8E A;  2YJC A;  4BQV A;  1DF0 A;  4AXM A;  4P6E A;  3HHA A;  2XU1 A;  2Y5B A;  1ATK A;  3F75 A;  5CVM A;  4X6H A;  2BSZ A;  3K8U A;  4BSQ A;  4G54 A;  1AYV A;  4CDD B;  3P5U A;  2E03 A;  1AYW A;  3H8C A;  4BPV A;  1AU4 A;  1STF E;  4Q8G A;  2G6D A;  1CJL A;  1PE6 A;  3D9W A;  4XR7 A;  2HD5 A;  2R9F A;  4I04 A;  3ZUA A;  2NQI A;  2R9C A;  4PAD A;  1EF7 A;  2R9M A;  4QH6 A;  1Y08 A;  3QT4 A;  1O0E A;  1MEG A;  3ERV A;  1W5R A;  4YYW A;  3MHH A;  1NL6 A;  1TU6 A;  2DC7 A;  4NV8 A;  1GX3 A;  1GEC E;  1QXP A;  3H6S A;  4I07 A;  3N3G A;  2AUX A;  1QOL A;  2AYO A;  1CPJ A;  2XU4 A;  5JA7 A;  1PCI A;  1VSN A;  3RVX A;  3O0U A;  3S3Q A;  1BY8 A;  3P5W A;  2VHS A;  3WXF A;  2E02 A;  3KW9 A;  1CSB B;  1SP4 B;  2BDL A;  1F2C A;  2G8J A;  2AUZ A;  4GUZ A;  3K9M A;  1QMY A;  2IBI A;  4CZW A;  1XKG A;  2Y6E A;  1CQD A;  1YAL A;  2AVW A;  3OF8 A;  1MEM A;  1S4V A;  4NV7 A;  2AU1 A;  3H8B A;  1NB3 A;  3BWK A;  3O1G A;  2O6X A;  4Q8H A;  3PBH A;  3BCN A;  2PRE A;  2R9N A;  4PI3 A;  3KKU A;  2AYN A;  2VFB A;  1F29 A;  2CIO A;  2B1N A;  3CBK A;  2OP3 A;  2AIM A;  1ME4 A;  3AI8 A;  2G7Y A;  2VHF A;  4AXL A;  3LXS A;  3WXG A;  4YYR A;  2OUL A;  5JH3 A;  2XU3 A;  1Q6K A;  1SNK A;  2FT2 A;  1MS6 A;  4P6G A;  1F2A A;  3M99 A;  1EWM A;  1PPP A;  3KWB X;  1K3B B;  2DJF B;  1BGO A;  2GFO A;  2OZ2 A;  3PDF A;  1TLO A;  2DC8 A;  2P7U A;  1NLJ A;  1CB5 A;  1PPD A;  1CV8 A;  3HD3 A;  4ZUX U;  4X6J A;  3N4C A;  9PAP A;  1PXV A;  4CDC B;  3QJ3 A;  2FTD A;  4YV8 A;  3U8E A;  1ME3 A;  4QRX A;  1U5I A;  5PAD A;  1PPN A;  3NHE A;  1MDW A;  3V6E A;  2FRQ A;  4HWY A;  3P5V A;  1CVZ A;  1ZIV A;  2WBF X;  4N79 A;  2DCD A;  2FUD A;  1M6D A;  1KHP A;  3KSE A;  4YYU A;  4PP1 A;  3CH3 X;  1PPO A;  2AS8 A;  3TNX A;  1EWO A;  3OVX A;  4W5C A;  1KHQ A;  3B79 A;  4BGF A;  4I05 A;  4KLB A;  3GCB A;  2HHN A;  2NQD B;  1TL9 A;  4X6I A;  1QDQ A;  2GHU A;  1VJV A;  4RY2 A;  4BS5 A;  5CHV A;  2E00 A;  5F02 A;  1Y4H A;  2IPP B;  1ICF A;  6PAD A;  3RVV A;  1EWL A;  2PNS A;  2DC6 A;  1GCB A;  1BQI A;  1YVB A;  1AYU A;  1ZCM A;  5A24 A;  1U9W A;  3E1Z B;  2HXZ A;  3BPM A;  2DCC A;  3OF9 A;  2P0R A;  7PCK A;  2VFC A;  3OIS A;  3USV A;  4B55 A;  8PCH A;  1EWP A;  1YK7 A;  2BDZ A;  4QRG A;  1YK8 A;  2FO5 A;  1NQC A;  2DC9 A;  1KFX L;  4XUI A;  1PAD A;  3IMA A;  3HWN A;  4OEM A;  4QBB A;  3K24 A;  2YJ8 A;  3MHS A;  3H89 A;  3CBJ A;  1PBH A;  2FQ9 A;  2NQA A;  1CS8 A;  2C0Y A;  2H7J A;  5J94 A;  2CB5 A;  3DF0 A;  3IOQ A;  2YJB A;  1AIM A;  1CTE A;  4YYS A;  2JQG R;  2ARY A;  2DCB A;  1PIP A;  1MHW A;  3P5X A;  4WA6 A;  4MZS A;  3MOR A;  3D6S A;  1HUC B;  1MIR A;  2DJG B;  4YVA A;  2YJ2 A;  4FIP A;  1NPZ A;  5FPW A;  4CDF B;  3IEJ A;  4CDE B;  1U9Q X;  4N8W A;  1GLO A;  1E2T A;  4W5B A;  1W4T A;  2R6N A;  3LFY A;  3C9E A;  5CHT A;  4DMX A;  4K7C A;  4YYV A;  1JQP A;  1U9X A;  4FJC A;  5EGW A;  2ATO A;  1A6R A;  3N3K A;  1AU3 A;  4QRV A;  1GMY A;  3OVZ A;  3F5V A;  1ITO A;  3HHI A;  4DMY A;  4BS6 A;  4PP2 E;  4W4U A;  2P86 A;  2F1G A;  4MZO A;  2YJ9 A;  1DEU A;  3PW3 A;  1IWD A;  3I06 A;  3CH2 X;  2FRA A;  3S3R A;  4MSX A;  3I3T A;  3WXE A;  3IHP A;  5EF4 A;  1THE A;  2JQF R;  3KFQ A;  2DCA A;  3MTN A;  2DZY A;  3BPF A;  3LTW A;  1AEC A;  1AU0 A;  2PAD A;  3PNR A;  2E01 A;  1X9Y A;  3RVW A;  2R9O A;  2DZZ A;  2HH5 A;  1U9V A;  1KFU L;  3V6C A;  1W6F A;  3BC3 A;  3KX1 A;  2F7D A;  1F2B A;  4FK5 A;  4YYQ A;  5CVN B;  2FYE A;  1AU2 A;  1POP A;  4OEL A;  1KXR A;  2B1M A;  2NQG A;  2ACT A;  1NB5 A;  5CVO B;  3IUT A;  3QSD A;  3H7D A;  3IV2 A;  1FH0 A;  3KWZ A;  4N4Z A;  2XU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...