2NQAA

Catalytic domain of human calpain 8
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
320
structure length
305
Chain Sequence
NALKYLGQDFKTLRQQCLDSGVLFKDPEFPAPSALGYTQGIIWKRPTELPSPQFIVGGATRTDIQGGLGDCWLLAAIASLTLNEELLYRVVPRDQDFQENYAGIFHFQFWQYGEWVEVVIDDRLPTKNGQLLFLHSEQGNEFWSALLEKAYAKLNGYEALAGGSTVEGFEDFTGGISEFYDLKKPPANLYQIIRKALAGSLLGCSIDVYSAAEAEAITSQKLVKSHAYSVTGVEEVNFQGHPEKLIRLRNPWGEEWSGAWSDDAPEWNHIDPRRKEELDKKVEDGEFWMSLSDFVRQFSRLEICN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Human Calpain 8
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Calpain 8
total genus 76
structure length 305
sequence length 320
chains with identical sequence B
ec nomenclature ec 3.4.22.53: Calpain-2.
pdb deposition date 2006-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00648 Peptidase_C2 Calpain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2nqaA02
2AUXA 2HHNA 1U9QX 1KFUL 1YT7A 1PPDA 2R9NA 3I3TA 4N4ZA 3OVZA 5A24A 3USVA 1AU4A 4YYWA 2NQDB 4P6EA 4W5BA 3OF8A 1CV8A 2YJBA 1MDWA 1AYUA 1YVBA 3H8CA 2AIMA 4I05A 3I06A 1DEUA 2HXZA 4I04A 1QMYA 3KW9A 2C0YA 2BDZA 4MSXA 1CSBB 5J94A 1Y4HA 2PBHA 3KWBX 3BC3A 4WA6A 2JQGR 4YV8A 1Y08A 4N8WA 4YYVA 1VJVA 3N4CA 3E1ZB 2BDLA 4Q8GA 3OVXA 3BPFA 2DCCA 2XU4A 3DF0A 1KHPA 3MORA 1AIMA 2AVWA 2B1MA 1FH0A 1AYVA 1GCBA 2ACTA 2AYOA 2XU3A 2R9OA 2FQ9A 3MTNA 4KLBA 3HHIA 4DMXA 2FO5A 4DMYA 2DC7A 2PREA 4CDDB 1ZCMA 1TLOA 2P0RA 2YJ2A 4YYUA 3RVVA 2CB5A 2P7UA 3BWKA 1S4VA 3QT4A 2G8JA 4ZUXU 5FPWA 3C9EA 1MEMA 4QBBA 3CH3X 4PP1A 1F2CA 5PADA 5K16A 1NB5A 2HH5A 4QRGA 4X6IA 5F02A 4PP2E 3CBKA 2AYNA 1NLJA 1K3BB 4BQVA 2AUZA 4BPVA 3V6EA 2JQFR 5JA7A 3ZUAA 3B79A 3LFYA 1A6RA 3CH2X 2FRQA 3BOWA 3QSDA 2FT2A 4CZWA 4MZSA 3AI8A 3P5XA 2OULA 2WBFX 1HUCB 3BPMA 5EF4A 1THEA 2DCBA 3IUTA 4FIPA 3V6CA 2PNSA 3H8BA 4BS6A 3TNXA 1KHQA 1PADA 2FUDA 4OEMA 4MZOA 1NB3A 1PCIA 3WXGA 1STFE 2ARYA 1EF7A 3HWNA 3F5VA 1AYWA 1KXRA 1PXVA 3N3KA 2R9MA 3NHEA 2YJ8A 2R9CA 3P5WA 1QDQA 3P5UA 2AS8A 3D6SA 3PBHA 2Y6EA 4RY2A 4PADA 4FJCA 1CS8A 1JQPA 1NPZA 1CB5A 2G8EA 4I07A 1PPPA 1X9YA 3U8EA 3ERVA 2FRAA 2IBIA 2YJCA 3IOQA 1TU6A 2B1NA 4CDFB 2PADA 2ATOA 1O0EA 3M99A 2OP3A 2DJFB 3H7DA 1IWDA 3N3GA 4FK5A 1GLOA 2DCAA 1GMYA 4PI3A 4AXLA 1NQCA 1EWLA 1NL6A 4N79A 2HD5A 2YJ9A 2E00A 3OISA 5CVOB 3MHHA 4X6HA 2GFOA 1AECA 1MEGA 2H7JA 1ZIVA 2DCDA 3IV2A 4BSQA 3HHAA 1PPNA 1QOLA 2NQGA 9PAPA 2OZ2A 1YALA 3KWZA 2P86A 1PBHA 5CVNB 2F7DA 1ME3A 3WXEA 3KKUA 1AU2A 1ME4A 4CDEB 3IHPA 2AU1A 3H89A 3K24A 2DZZA 1U9VA 1EWPA 3QJ3A 2DJGB 1YK7A 1YK8A 3S3RA 3GCBA 1U9WA 1U9XA 3WXFA 3KSEA 3HD3A 1SNKA 2XU5A 4CDCB 3CBJA 1VSNA 2VHSA 3KFQA 1U5IA 4XR7A 2FTDA 1GECE 3BCNA 2E01A 4W5CA 5CHVA 1AU3A 1ATKA 5CVMA 3PNRA 4AXMA 2IPPB 2R6NA 4QH6A 8PCHA 1AU0A 4P6GA 2DC6A 3IMAA 4K7CA 1DF0A 3RVWA 4YYSA 2GHUA 1CPJA 2R9FA 7PCKA 3OF9A 2Y5BA 3LXSA 4G54A 3F75A 1BQIA 1PIPA 3K9MA 4X6JA 2E02A 4QRXA 2E03A 3PW3A 1POPA 1PPOA 2VHFA 2CIOA 4YYRA 5EGWA 1QXPA 2DC9A 3S3QA 4XUIA 4Q8HA 2DC8A 4HWYA 2G6DA 1M6DA 1EWMA 2F1GA 1Q6KA 2NQIA 3IEJA 1MS6A 4W4UA 1MHWA 1F2BA 6PADA 2G7YA 4QRVA 1BY8A 1TL9A 2FYEA 1CJLA 1MIRA 1ITOA 4YVAA 4BS5A 1BP4A 3MHSA 1BGOA 1CVZA 3P5VA 2DZYA 1CTEA 1CQDA 5CHTA 3O0UA 1KFXL 3KX1A 2NQAA 5JH3A 3O1GA 4OELA 4YYQA 1SP4B 3H6SA 1F2AA 1PE6A 2XU1A 1EWOA 1ICFA 1XKGA 3PDFA 3RVXA 1F29A 3K8UA 2O6XA
chains in the Genus database with same CATH superfamily
2AUXA 2HHNA 1U9QX 1KFUL 1YT7A 1DKIA 1PPDA 2R9NA 3RNVA 3I3TA 4N4ZA 3OVZA 5A24A 3USVA 1AU4A 4YYWA 2NQDB 4P6EA 4W5BA 3OF8A 1CV8A 2YJBA 1MDWA 1AYUA 1YVBA 4REZA 3PRPA 2DOSA 4BOUA 3H8CA 2AIMA 4I05A 3I06A 1UKFA 1DEUA 2HXZA 4I04A 1QMYA 3KW9A 2AGAA 2C0YA 2BDZA 4IP3A 4MSXA 1CSBB 4BOSA 5J94A 1Y4HA 3W30A 2PBHA 3KWBX 3BC3A 4WA6A 2JQGR 4YV8A 4HXDB 1Y08A 4N8WA 4YYVA 1VJVA 3PHUA 3N4CA 3E1ZB 2BDLA 4Q8GA 3OVXA 3BPFA 3PT2A 2DCCA 2Z84A 2XU4A 3DF0A 1KHPA 3MORA 1AIMA 2AVWA 2B1MA 1FH0A 1AYVA 1GCBA 2ACTA 4M0WA 2AYOA 2XU3A 2R9OA 2FQ9A 3MTNA 4KLBA 3HHIA 4DMXA 2FO5A 4DMYA 4OVZA 2DC7A 2PREA 4CDDB 1ZCMA 1TLOA 2P0RA 2YJ2A 3E9SA 4YYUA 3RVVA 2CB5A 2P7UA 3BWKA 1S4VA 3QT4A 4BOPA 2G8JA 4ZUXU 5FPWA 3C9EA 3BB7A 4D8IA 1MEMA 4QBBA 2JTCA 3CH3X 4PP1A 1F2CA 5PADA 5K16A 1NB5A 2HH5A 4QRGA 4X6IA 5F02A 4PP2E 3CBKA 2AYNA 4ZTBA 1NLJA 1K3BB 4BQVA 2J7QA 2AUZA 4BPVA 3V6EA 2JQFR 4D8BA 5JA7A 3ZUAA 3B79A 3LFYA 1A6RA 3CH2X 2FRQA 3BOWA 3QSDA 2FT2A 4CZWA 4MZSA 3AI8A 3P5XA 2OULA 2WBFX 1HUCB 3BPMA 5EF4A 1THEA 2DCBA 3IUTA 4FIPA 4MI7A 3V6CA 2PNSA 3H8BA 3ZNHA 4BS6A 3TNXA 1KHQA 1PADA 2FUDA 4OEMA 4MZOA 4GUAA 1NB3A 1PCIA 3WXGA 5EZSA 1STFE 2ARYA 1EF7A 3HWNA 3F5VA 1AYWA 1KXRA 3BBAA 4P16A 1PXVA 3N3KA 2R9MA 3PRMA 3MP2A 3W31A 3PSEA 3NHEA 2YJ8A 2R9CA 3P5WA 1QDQA 3P5UA 2AS8A 3D6SA 4PT5A 3TRKA 3PBHA 2Y6EA 4RY2A 4PADA 4FJCA 1CS8A 1JQPA 1NPZA 1CB5A 4I07A 2G8EA 1PPPA 1X9YA 3U8EA 3ERVA 3C0RA 2FRAA 2IBIA 2YJCA 3IOQA 1TU6A 2B1NA 3BY4A 4CDFB 2PADA 2ATOA 1O0EA 3M99A 2J7QC 2OP3A 2DJFB 3H7DA 1YZBA 1IWDA 3N3GA 4FK5A 1GLOA 4D8EA 4R3DA 4BOQA 2DCAA 1GMYA 3B21A 4PI3A 4IUMA 4AXLA 1NQCA 1EWLA 1NL6A 4N79A 2HD5A 2YJ9A 2E00A 3OISA 5CVOB 3MHHA 4X6HA 2GFOA 1AECA 1MEGA 4A5UA 2H7JA 1ZIVA 2DCDA 2HWKA 3IV2A 4BSQA 3HHAA 1PPNA 1QOLA 2NQGA 3PHXA 9PAPA 2OZ2A 1YALA 4RNAA 3KWZA 2P86A 1PBHA 5CVNB 3TMPA 2F7DA 1ME3A 2BTWA 3WXEA 3KKUA 1AU2A 4RF1A 1ME4A 4CDEB 3IHPA 2AU1A 3H89A 4MM3B 3K24A 2DZZA 1U9VA 1EWPA 3QJ3A 2DJGB 1YK7A 1YK8A 3MJ5A 3PHWA 3S3RA 3GCBA 1U9WA 4WURA 1U9XA 3WXFA 3KSEA 3HD3A 1SNKA 2XU5A 4CDCB 3CBJA 1VSNA 2VHSA 4XZXA 3KFQA 1U5IA 4XR7A 2FTDA 1GECE 3BCNA 2E01A 4W5CA 5CHVA 1AU3A 1ATKA 5CVMA 3PNRA 4AXMA 2IPPB 2R6NA 4QH6A 8PCHA 1AU0A 4P6GA 2DC6A 3IMAA 4K7CA 1DF0A 3RVWA 4YYSA 2BU3A 2GHUA 1CPJA 5KO3A 2R9FA 7PCKA 3OF9A 2Y5BA 3LXSA 4G54A 3F75A 1BQIA 1PIPA 3K9MA 4X6JA 2E02A 4RKXA 4QRXA 2E03A 4RF0A 3PW3A 1POPA 1PPOA 2VHFA 2JRIA 2CIOA 4YYRA 5EGWA 1QXPA 2DC9A 3S3QA 4OW0A 4XUIA 4Q8HA 2DC8A 4OVZB 4HWYA 2G6DA 5JZEA 1M6DA 1EWMA 2F1GA 1Q6KA 2NQIA 3IEJA 3MTVA 1MS6A 4W4UA 1PVJA 1MHWA 1F2BA 6PADA 2G7YA 4QRVA 1BY8A 3OQCA 1TL9A 2FYEA 1CJLA 5EZQA 1MIRA 1ITOA 3O65A 4YVAA 3IFUA 4BS5A 1BP4A 3MHSA 1BGOA 2BTWB 1CVZA 3P5VA 2FE8A 2UZJA 2DZYA 1CTEA 1CQDA 5CHTA 3O0UA 1KFXL 3KX1A 2NQAA 5JH3A 3O1GA 4OELA 4YYQA 1SP4B 3H6SA 1F2AA 1PE6A 2XU1A 5E6JA 1EWOA 1ICFA 4BOZA 1XKGA 3PDFA 3RVXA 1F29A 3K8UA 2O6XA
chains in the Genus database with same CATH topology
2AUXA 2HHNA 1U9QX 1KFUL 1YT7A 1PPDA 2R9NA 3I3TA 1W5RA 3OVZA 4N4ZA 5A24A 3LTWA 3USVA 1AU4A 4YYWA 2NQDB 4P6EA 4W5BA 3OF8A 1CV8A 2YJBA 1MDWA 1AYUA 1YVBA 3H8CA 2AIMA 4I05A 3I06A 1DEUA 2HXZA 4I04A 1QMYA 3KW9A 2C0YA 2BDZA 4MSXA 1CSBB 5J94A 1Y4HA 2PBHA 3KWBX 3BC3A 4BGFA 4WA6A 2JQGR 4YV8A 1Y08A 4N8WA 4YYVA 1VJVA 3N4CA 3E1ZB 2BDLA 4Q8GA 3OVXA 3BPFA 2DCCA 2XU4A 3DF0A 1KHPA 3MORA 1AIMA 2AVWA 2B1MA 1FH0A 1AYVA 1GCBA 2ACTA 2AYOA 2XU3A 2R9OA 2FQ9A 3MTNA 4NV7A 4KLBA 3HHIA 4DMXA 2FO5A 4DMYA 2DC7A 2PREA 4CDDB 1ZCMA 1TLOA 2P0RA 2YJ2A 4YYUA 3RVVA 2CB5A 4NV8A 2P7UA 3BWKA 1S4VA 3QT4A 2G8JA 4ZUXU 5FPWA 3C9EA 1MEMA 4QBBA 3CH3X 4PP1A 1W6FA 1F2CA 5PADA 5K16A 1NB5A 2HH5A 4QRGA 4X6IA 5F02A 4PP2E 3CBKA 2AYNA 1NLJA 1K3BB 4BQVA 2AUZA 4BPVA 3V6EA 2JQFR 5JA7A 3ZUAA 3B79A 3LFYA 1A6RA 3CH2X 2FRQA 3BOWA 3QSDA 2FT2A 4CZWA 4MZSA 1GX3A 3AI8A 3P5XA 2OULA 2WBFX 1HUCB 3BPMA 5EF4A 1THEA 2DCBA 3IUTA 4FIPA 3V6CA 2PNSA 3H8BA 4BS6A 3TNXA 1KHQA 1PADA 2FUDA 4OEMA 4MZOA 1NB3A 1PCIA 3WXGA 1STFE 2ARYA 1EF7A 3HWNA 3F5VA 1AYWA 1KXRA 1PXVA 3N3KA 2R9MA 3NHEA 2YJ8A 2R9CA 3P5WA 1QDQA 3P5UA 2AS8A 3D6SA 3PBHA 2Y6EA 4RY2A 4PADA 4FJCA 1CS8A 1JQPA 1NPZA 1CB5A 2G8EA 4I07A 1PPPA 1X9YA 3U8EA 2VFCA 3ERVA 4C5PA 4B55A 2FRAA 2IBIA 2YJCA 3IOQA 1TU6A 2B1NA 4CDFB 2PADA 2ATOA 1O0EA 3M99A 2OP3A 2DJFB 3H7DA 1IWDA 3N3GA 4FK5A 1GLOA 2DCAA 1GMYA 4PI3A 4AXLA 1NQCA 1EWLA 1NL6A 4N79A 2HD5A 2YJ9A 2E00A 3OISA 5CVOB 3MHHA 4X6HA 2GFOA 1AECA 1MEGA 2H7JA 1ZIVA 2DCDA 3IV2A 4BSQA 3HHAA 1PPNA 1QOLA 2NQGA 9PAPA 2OZ2A 1YALA 3KWZA 2P86A 1PBHA 5CVNB 2F7DA 1ME3A 3WXEA 3KKUA 1AU2A 1ME4A 4CDEB 3IHPA 2AU1A 3H89A 3K24A 2DZZA 1U9VA 1EWPA 2BSZA 2DJGB 3QJ3A 1YK7A 1YK8A 3S3RA 3GCBA 1E2TA 1U9WA 1U9XA 3WXFA 3KSEA 3HD3A 1SNKA 2XU5A 4CDCB 3CBJA 1VSNA 2VHSA 3KFQA 1U5IA 4XR7A 2FTDA 1GECE 3BCNA 4GUZA 2E01A 4W5CA 5CHVA 1AU3A 1ATKA 5CVMA 3D9WA 3PNRA 4AXMA 2IPPB 2R6NA 4QH6A 8PCHA 1AU0A 4P6GA 2DC6A 3IMAA 4K7CA 1DF0A 3RVWA 4YYSA 2GHUA 1CPJA 2R9FA 7PCKA 3OF9A 2Y5BA 3LXSA 4G54A 3F75A 1BQIA 1PIPA 2VFBA 3K9MA 4X6JA 2E02A 4QRXA 2E03A 1W4TA 3PW3A 1POPA 1PPOA 2VHFA 2CIOA 4YYRA 5EGWA 1QXPA 2DC9A 3S3QA 4XUIA 4Q8HA 2DC8A 4HWYA 2G6DA 1M6DA 1EWMA 2F1GA 1Q6KA 2NQIA 3IEJA 1MS6A 4W4UA 1MHWA 1F2BA 6PADA 2G7YA 4QRVA 1BY8A 1TL9A 2FYEA 1CJLA 1MIRA 1ITOA 4YVAA 4BS5A 1BP4A 3MHSA 1BGOA 1CVZA 3P5VA 2DZYA 1CTEA 1CQDA 5CHTA 3O0UA 1KFXL 3KX1A 2NQAA 5JH3A 3O1GA 4OELA 4YYQA 1SP4B 3H6SA 1F2AA 1PE6A 2XU1A 1EWOA 1ICFA 1XKGA 3PDFA 3RVXA 1F29A 3K8UA 2O6XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AUX A;  2HHN A;  1U9Q X;  1KFU L;  1YT7 A;  1PPD A;  2R9N A;  3I3T A;  4N4Z A;  3OVZ A;  5A24 A;  3USV A;  1AU4 A;  4YYW A;  2NQD B;  4P6E A;  4W5B A;  3OF8 A;  1CV8 A;  2YJB A;  1MDW A;  1AYU A;  1YVB A;  3H8C A;  2AIM A;  4I05 A;  3I06 A;  1DEU A;  2HXZ A;  4I04 A;  1QMY A;  3KW9 A;  2C0Y A;  2BDZ A;  4MSX A;  1CSB B;  5J94 A;  1Y4H A;  2PBH A;  3KWB X;  3BC3 A;  4WA6 A;  2JQG R;  4YV8 A;  1Y08 A;  4N8W A;  4YYV A;  1VJV A;  3N4C A;  3E1Z B;  2BDL A;  4Q8G A;  3OVX A;  3BPF A;  2DCC A;  2XU4 A;  3DF0 A;  1KHP A;  3MOR A;  1AIM A;  2AVW A;  2B1M A;  1FH0 A;  1AYV A;  1GCB A;  2ACT A;  2AYO A;  2XU3 A;  2R9O A;  2FQ9 A;  3MTN A;  4KLB A;  3HHI A;  4DMX A;  2FO5 A;  4DMY A;  2DC7 A;  2PRE A;  4CDD B;  1ZCM A;  1TLO A;  2P0R A;  2YJ2 A;  4YYU A;  3RVV A;  2CB5 A;  2P7U A;  3BWK A;  1S4V A;  3QT4 A;  2G8J A;  4ZUX U;  5FPW A;  3C9E A;  1MEM A;  4QBB A;  3CH3 X;  4PP1 A;  1F2C A;  5PAD A;  5K16 A;  1NB5 A;  2HH5 A;  4QRG A;  4X6I A;  5F02 A;  4PP2 E;  3CBK A;  2AYN A;  1NLJ A;  1K3B B;  4BQV A;  2AUZ A;  4BPV A;  3V6E A;  2JQF R;  5JA7 A;  3ZUA A;  3B79 A;  3LFY A;  1A6R A;  3CH2 X;  2FRQ A;  3BOW A;  3QSD A;  2FT2 A;  4CZW A;  4MZS A;  3AI8 A;  3P5X A;  2OUL A;  2WBF X;  1HUC B;  3BPM A;  5EF4 A;  1THE A;  2DCB A;  3IUT A;  4FIP A;  3V6C A;  2PNS A;  3H8B A;  4BS6 A;  3TNX A;  1KHQ A;  1PAD A;  2FUD A;  4OEM A;  4MZO A;  1NB3 A;  1PCI A;  3WXG A;  1STF E;  2ARY A;  1EF7 A;  3HWN A;  3F5V A;  1AYW A;  1KXR A;  1PXV A;  3N3K A;  2R9M A;  3NHE A;  2YJ8 A;  2R9C A;  3P5W A;  1QDQ A;  3P5U A;  2AS8 A;  3D6S A;  3PBH A;  2Y6E A;  4RY2 A;  4PAD A;  4FJC A;  1CS8 A;  1JQP A;  1NPZ A;  1CB5 A;  2G8E A;  4I07 A;  1PPP A;  1X9Y A;  3U8E A;  3ERV A;  2FRA A;  2IBI A;  2YJC A;  3IOQ A;  1TU6 A;  2B1N A;  4CDF B;  2PAD A;  2ATO A;  1O0E A;  3M99 A;  2OP3 A;  2DJF B;  3H7D A;  1IWD A;  3N3G A;  4FK5 A;  1GLO A;  2DCA A;  1GMY A;  4PI3 A;  4AXL A;  1NQC A;  1EWL A;  1NL6 A;  4N79 A;  2HD5 A;  2YJ9 A;  2E00 A;  3OIS A;  5CVO B;  3MHH A;  4X6H A;  2GFO A;  1AEC A;  1MEG A;  2H7J A;  1ZIV A;  2DCD A;  3IV2 A;  4BSQ A;  3HHA A;  1PPN A;  1QOL A;  2NQG A;  9PAP A;  2OZ2 A;  1YAL A;  3KWZ A;  2P86 A;  1PBH A;  5CVN B;  2F7D A;  1ME3 A;  3WXE A;  3KKU A;  1AU2 A;  1ME4 A;  4CDE B;  3IHP A;  2AU1 A;  3H89 A;  3K24 A;  2DZZ A;  1U9V A;  1EWP A;  3QJ3 A;  2DJG B;  1YK7 A;  1YK8 A;  3S3R A;  3GCB A;  1U9W A;  1U9X A;  3WXF A;  3KSE A;  3HD3 A;  1SNK A;  2XU5 A;  4CDC B;  3CBJ A;  1VSN A;  2VHS A;  3KFQ A;  1U5I A;  4XR7 A;  2FTD A;  1GEC E;  3BCN A;  2E01 A;  4W5C A;  5CHV A;  1AU3 A;  1ATK A;  5CVM A;  3PNR A;  4AXM A;  2IPP B;  2R6N A;  4QH6 A;  8PCH A;  1AU0 A;  4P6G A;  2DC6 A;  3IMA A;  4K7C A;  1DF0 A;  3RVW A;  4YYS A;  2GHU A;  1CPJ A;  2R9F A;  7PCK A;  3OF9 A;  2Y5B A;  3LXS A;  4G54 A;  3F75 A;  1BQI A;  1PIP A;  3K9M A;  4X6J A;  2E02 A;  4QRX A;  2E03 A;  3PW3 A;  1POP A;  1PPO A;  2VHF A;  2CIO A;  4YYR A;  5EGW A;  1QXP A;  2DC9 A;  3S3Q A;  4XUI A;  4Q8H A;  2DC8 A;  4HWY A;  2G6D A;  1M6D A;  1EWM A;  2F1G A;  1Q6K A;  2NQI A;  3IEJ A;  1MS6 A;  4W4U A;  1MHW A;  1F2B A;  6PAD A;  2G7Y A;  4QRV A;  1BY8 A;  1TL9 A;  2FYE A;  1CJL A;  1MIR A;  1ITO A;  4YVA A;  4BS5 A;  1BP4 A;  3MHS A;  1BGO A;  1CVZ A;  3P5V A;  2DZY A;  1CTE A;  1CQD A;  5CHT A;  3O0U A;  1KFX L;  3KX1 A;  2NQA A;  5JH3 A;  3O1G A;  4OEL A;  4YYQ A;  1SP4 B;  3H6S A;  1F2A A;  1PE6 A;  2XU1 A;  1EWO A;  1ICF A;  1XKG A;  3PDF A;  3RVX A;  1F29 A;  3K8U A;  2O6X A; 
#chains in the Genus database with same CATH topology
 2AUX A;  2HHN A;  1U9Q X;  1KFU L;  1YT7 A;  1DKI A;  1PPD A;  2R9N A;  3RNV A;  3I3T A;  4N4Z A;  3OVZ A;  5A24 A;  3USV A;  1AU4 A;  4YYW A;  2NQD B;  4P6E A;  4W5B A;  3OF8 A;  1CV8 A;  2YJB A;  1MDW A;  1AYU A;  1YVB A;  4REZ A;  3PRP A;  2DOS A;  4BOU A;  3H8C A;  2AIM A;  4I05 A;  3I06 A;  1UKF A;  1DEU A;  2HXZ A;  4I04 A;  1QMY A;  3KW9 A;  2AGA A;  2C0Y A;  2BDZ A;  4IP3 A;  4MSX A;  1CSB B;  4BOS A;  5J94 A;  1Y4H A;  3W30 A;  2PBH A;  3KWB X;  3BC3 A;  4WA6 A;  2JQG R;  4YV8 A;  4HXD B;  1Y08 A;  4N8W A;  4YYV A;  1VJV A;  3PHU A;  3N4C A;  3E1Z B;  2BDL A;  4Q8G A;  3OVX A;  3BPF A;  3PT2 A;  2DCC A;  2Z84 A;  2XU4 A;  3DF0 A;  1KHP A;  3MOR A;  1AIM A;  2AVW A;  2B1M A;  1FH0 A;  1AYV A;  1GCB A;  2ACT A;  4M0W A;  2AYO A;  2XU3 A;  2R9O A;  2FQ9 A;  3MTN A;  4KLB A;  3HHI A;  4DMX A;  2FO5 A;  4DMY A;  4OVZ A;  2DC7 A;  2PRE A;  4CDD B;  1ZCM A;  1TLO A;  2P0R A;  2YJ2 A;  3E9S A;  4YYU A;  3RVV A;  2CB5 A;  2P7U A;  3BWK A;  1S4V A;  3QT4 A;  4BOP A;  2G8J A;  4ZUX U;  5FPW A;  3C9E A;  3BB7 A;  4D8I A;  1MEM A;  4QBB A;  2JTC A;  3CH3 X;  4PP1 A;  1F2C A;  5PAD A;  5K16 A;  1NB5 A;  2HH5 A;  4QRG A;  4X6I A;  5F02 A;  4PP2 E;  3CBK A;  2AYN A;  4ZTB A;  1NLJ A;  1K3B B;  4BQV A;  2J7Q A;  2AUZ A;  4BPV A;  3V6E A;  2JQF R;  4D8B A;  5JA7 A;  3ZUA A;  3B79 A;  3LFY A;  1A6R A;  3CH2 X;  2FRQ A;  3BOW A;  3QSD A;  2FT2 A;  4CZW A;  4MZS A;  3AI8 A;  3P5X A;  2OUL A;  2WBF X;  1HUC B;  3BPM A;  5EF4 A;  1THE A;  2DCB A;  3IUT A;  4FIP A;  4MI7 A;  3V6C A;  2PNS A;  3H8B A;  3ZNH A;  4BS6 A;  3TNX A;  1KHQ A;  1PAD A;  2FUD A;  4OEM A;  4MZO A;  4GUA A;  1NB3 A;  1PCI A;  3WXG A;  5EZS A;  1STF E;  2ARY A;  1EF7 A;  3HWN A;  3F5V A;  1AYW A;  1KXR A;  3BBA A;  4P16 A;  1PXV A;  3N3K A;  2R9M A;  3PRM A;  3MP2 A;  3W31 A;  3PSE A;  3NHE A;  2YJ8 A;  2R9C A;  3P5W A;  1QDQ A;  3P5U A;  2AS8 A;  3D6S A;  4PT5 A;  3TRK A;  3PBH A;  2Y6E A;  4RY2 A;  4PAD A;  4FJC A;  1CS8 A;  1JQP A;  1NPZ A;  1CB5 A;  4I07 A;  2G8E A;  1PPP A;  1X9Y A;  3U8E A;  3ERV A;  3C0R A;  2FRA A;  2IBI A;  2YJC A;  3IOQ A;  1TU6 A;  2B1N A;  3BY4 A;  4CDF B;  2PAD A;  2ATO A;  1O0E A;  3M99 A;  2J7Q C;  2OP3 A;  2DJF B;  3H7D A;  1YZB A;  1IWD A;  3N3G A;  4FK5 A;  1GLO A;  4D8E A;  4R3D A;  4BOQ A;  2DCA A;  1GMY A;  3B21 A;  4PI3 A;  4IUM A;  4AXL A;  1NQC A;  1EWL A;  1NL6 A;  4N79 A;  2HD5 A;  2YJ9 A;  2E00 A;  3OIS A;  5CVO B;  3MHH A;  4X6H A;  2GFO A;  1AEC A;  1MEG A;  4A5U A;  2H7J A;  1ZIV A;  2DCD A;  2HWK A;  3IV2 A;  4BSQ A;  3HHA A;  1PPN A;  1QOL A;  2NQG A;  3PHX A;  9PAP A;  2OZ2 A;  1YAL A;  4RNA A;  3KWZ A;  2P86 A;  1PBH A;  5CVN B;  3TMP A;  2F7D A;  1ME3 A;  2BTW A;  3WXE A;  3KKU A;  1AU2 A;  4RF1 A;  1ME4 A;  4CDE B;  3IHP A;  2AU1 A;  3H89 A;  4MM3 B;  3K24 A;  2DZZ A;  1U9V A;  1EWP A;  3QJ3 A;  2DJG B;  1YK7 A;  1YK8 A;  3MJ5 A;  3PHW A;  3S3R A;  3GCB A;  1U9W A;  4WUR A;  1U9X A;  3WXF A;  3KSE A;  3HD3 A;  1SNK A;  2XU5 A;  4CDC B;  3CBJ A;  1VSN A;  2VHS A;  4XZX A;  3KFQ A;  1U5I A;  4XR7 A;  2FTD A;  1GEC E;  3BCN A;  2E01 A;  4W5C A;  5CHV A;  1AU3 A;  1ATK A;  5CVM A;  3PNR A;  4AXM A;  2IPP B;  2R6N A;  4QH6 A;  8PCH A;  1AU0 A;  4P6G A;  2DC6 A;  3IMA A;  4K7C A;  1DF0 A;  3RVW A;  4YYS A;  2BU3 A;  2GHU A;  1CPJ A;  5KO3 A;  2R9F A;  7PCK A;  3OF9 A;  2Y5B A;  3LXS A;  4G54 A;  3F75 A;  1BQI A;  1PIP A;  3K9M A;  4X6J A;  2E02 A;  4RKX A;  4QRX A;  2E03 A;  4RF0 A;  3PW3 A;  1POP A;  1PPO A;  2VHF A;  2JRI A;  2CIO A;  4YYR A;  5EGW A;  1QXP A;  2DC9 A;  3S3Q A;  4OW0 A;  4XUI A;  4Q8H A;  2DC8 A;  4OVZ B;  4HWY A;  2G6D A;  5JZE A;  1M6D A;  1EWM A;  2F1G A;  1Q6K A;  2NQI A;  3IEJ A;  3MTV A;  1MS6 A;  4W4U A;  1PVJ A;  1MHW A;  1F2B A;  6PAD A;  2G7Y A;  4QRV A;  1BY8 A;  3OQC A;  1TL9 A;  2FYE A;  1CJL A;  5EZQ A;  1MIR A;  1ITO A;  3O65 A;  4YVA A;  3IFU A;  4BS5 A;  1BP4 A;  3MHS A;  1BGO A;  2BTW B;  1CVZ A;  3P5V A;  2FE8 A;  2UZJ A;  2DZY A;  1CTE A;  1CQD A;  5CHT A;  3O0U A;  1KFX L;  3KX1 A;  2NQA A;  5JH3 A;  3O1G A;  4OEL A;  4YYQ A;  1SP4 B;  3H6S A;  1F2A A;  1PE6 A;  2XU1 A;  5E6J A;  1EWO A;  1ICF A;  4BOZ A;  1XKG A;  3PDF A;  3RVX A;  1F29 A;  3K8U A;  2O6X A; 
#chains in the Genus database with same CATH homology
 2AUX A;  2HHN A;  1U9Q X;  1KFU L;  1YT7 A;  1PPD A;  2R9N A;  3I3T A;  1W5R A;  3OVZ A;  4N4Z A;  5A24 A;  3LTW A;  3USV A;  1AU4 A;  4YYW A;  2NQD B;  4P6E A;  4W5B A;  3OF8 A;  1CV8 A;  2YJB A;  1MDW A;  1AYU A;  1YVB A;  3H8C A;  2AIM A;  4I05 A;  3I06 A;  1DEU A;  2HXZ A;  4I04 A;  1QMY A;  3KW9 A;  2C0Y A;  2BDZ A;  4MSX A;  1CSB B;  5J94 A;  1Y4H A;  2PBH A;  3KWB X;  3BC3 A;  4BGF A;  4WA6 A;  2JQG R;  4YV8 A;  1Y08 A;  4N8W A;  4YYV A;  1VJV A;  3N4C A;  3E1Z B;  2BDL A;  4Q8G A;  3OVX A;  3BPF A;  2DCC A;  2XU4 A;  3DF0 A;  1KHP A;  3MOR A;  1AIM A;  2AVW A;  2B1M A;  1FH0 A;  1AYV A;  1GCB A;  2ACT A;  2AYO A;  2XU3 A;  2R9O A;  2FQ9 A;  3MTN A;  4NV7 A;  4KLB A;  3HHI A;  4DMX A;  2FO5 A;  4DMY A;  2DC7 A;  2PRE A;  4CDD B;  1ZCM A;  1TLO A;  2P0R A;  2YJ2 A;  4YYU A;  3RVV A;  2CB5 A;  4NV8 A;  2P7U A;  3BWK A;  1S4V A;  3QT4 A;  2G8J A;  4ZUX U;  5FPW A;  3C9E A;  1MEM A;  4QBB A;  3CH3 X;  4PP1 A;  1W6F A;  1F2C A;  5PAD A;  5K16 A;  1NB5 A;  2HH5 A;  4QRG A;  4X6I A;  5F02 A;  4PP2 E;  3CBK A;  2AYN A;  1NLJ A;  1K3B B;  4BQV A;  2AUZ A;  4BPV A;  3V6E A;  2JQF R;  5JA7 A;  3ZUA A;  3B79 A;  3LFY A;  1A6R A;  3CH2 X;  2FRQ A;  3BOW A;  3QSD A;  2FT2 A;  4CZW A;  4MZS A;  1GX3 A;  3AI8 A;  3P5X A;  2OUL A;  2WBF X;  1HUC B;  3BPM A;  5EF4 A;  1THE A;  2DCB A;  3IUT A;  4FIP A;  3V6C A;  2PNS A;  3H8B A;  4BS6 A;  3TNX A;  1KHQ A;  1PAD A;  2FUD A;  4OEM A;  4MZO A;  1NB3 A;  1PCI A;  3WXG A;  1STF E;  2ARY A;  1EF7 A;  3HWN A;  3F5V A;  1AYW A;  1KXR A;  1PXV A;  3N3K A;  2R9M A;  3NHE A;  2YJ8 A;  2R9C A;  3P5W A;  1QDQ A;  3P5U A;  2AS8 A;  3D6S A;  3PBH A;  2Y6E A;  4RY2 A;  4PAD A;  4FJC A;  1CS8 A;  1JQP A;  1NPZ A;  1CB5 A;  2G8E A;  4I07 A;  1PPP A;  1X9Y A;  3U8E A;  2VFC A;  3ERV A;  4C5P A;  4B55 A;  2FRA A;  2IBI A;  2YJC A;  3IOQ A;  1TU6 A;  2B1N A;  4CDF B;  2PAD A;  2ATO A;  1O0E A;  3M99 A;  2OP3 A;  2DJF B;  3H7D A;  1IWD A;  3N3G A;  4FK5 A;  1GLO A;  2DCA A;  1GMY A;  4PI3 A;  4AXL A;  1NQC A;  1EWL A;  1NL6 A;  4N79 A;  2HD5 A;  2YJ9 A;  2E00 A;  3OIS A;  5CVO B;  3MHH A;  4X6H A;  2GFO A;  1AEC A;  1MEG A;  2H7J A;  1ZIV A;  2DCD A;  3IV2 A;  4BSQ A;  3HHA A;  1PPN A;  1QOL A;  2NQG A;  9PAP A;  2OZ2 A;  1YAL A;  3KWZ A;  2P86 A;  1PBH A;  5CVN B;  2F7D A;  1ME3 A;  3WXE A;  3KKU A;  1AU2 A;  1ME4 A;  4CDE B;  3IHP A;  2AU1 A;  3H89 A;  3K24 A;  2DZZ A;  1U9V A;  1EWP A;  2BSZ A;  2DJG B;  3QJ3 A;  1YK7 A;  1YK8 A;  3S3R A;  3GCB A;  1E2T A;  1U9W A;  1U9X A;  3WXF A;  3KSE A;  3HD3 A;  1SNK A;  2XU5 A;  4CDC B;  3CBJ A;  1VSN A;  2VHS A;  3KFQ A;  1U5I A;  4XR7 A;  2FTD A;  1GEC E;  3BCN A;  4GUZ A;  2E01 A;  4W5C A;  5CHV A;  1AU3 A;  1ATK A;  5CVM A;  3D9W A;  3PNR A;  4AXM A;  2IPP B;  2R6N A;  4QH6 A;  8PCH A;  1AU0 A;  4P6G A;  2DC6 A;  3IMA A;  4K7C A;  1DF0 A;  3RVW A;  4YYS A;  2GHU A;  1CPJ A;  2R9F A;  7PCK A;  3OF9 A;  2Y5B A;  3LXS A;  4G54 A;  3F75 A;  1BQI A;  1PIP A;  2VFB A;  3K9M A;  4X6J A;  2E02 A;  4QRX A;  2E03 A;  1W4T A;  3PW3 A;  1POP A;  1PPO A;  2VHF A;  2CIO A;  4YYR A;  5EGW A;  1QXP A;  2DC9 A;  3S3Q A;  4XUI A;  4Q8H A;  2DC8 A;  4HWY A;  2G6D A;  1M6D A;  1EWM A;  2F1G A;  1Q6K A;  2NQI A;  3IEJ A;  1MS6 A;  4W4U A;  1MHW A;  1F2B A;  6PAD A;  2G7Y A;  4QRV A;  1BY8 A;  1TL9 A;  2FYE A;  1CJL A;  1MIR A;  1ITO A;  4YVA A;  4BS5 A;  1BP4 A;  3MHS A;  1BGO A;  1CVZ A;  3P5V A;  2DZY A;  1CTE A;  1CQD A;  5CHT A;  3O0U A;  1KFX L;  3KX1 A;  2NQA A;  5JH3 A;  3O1G A;  4OEL A;  4YYQ A;  1SP4 B;  3H6S A;  1F2A A;  1PE6 A;  2XU1 A;  1EWO A;  1ICF A;  1XKG A;  3PDF A;  3RVX A;  1F29 A;  3K8U A;  2O6X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...