2NQAA

Catalytic domain of human calpain 8
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
320
structure length
305
Chain Sequence
NALKYLGQDFKTLRQQCLDSGVLFKDPEFPAPSALGYTQGIIWKRPTELPSPQFIVGGATRTDIQGGLGDCWLLAAIASLTLNEELLYRVVPRDQDFQENYAGIFHFQFWQYGEWVEVVIDDRLPTKNGQLLFLHSEQGNEFWSALLEKAYAKLNGYEALAGGSTVEGFEDFTGGISEFYDLKKPPANLYQIIRKALAGSLLGCSIDVYSAAEAEAITSQKLVKSHAYSVTGVEEVNFQGHPEKLIRLRNPWGEEWSGAWSDDAPEWNHIDPRRKEELDKKVEDGEFWMSLSDFVRQFSRLEICN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calpain 8
publication title Structure of Human Calpain 8
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 76
structure length 305
sequence length 320
chains with identical sequence B
ec nomenclature ec 3.4.22.53: Calpain-2.
pdb deposition date 2006-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00648 Peptidase_C2 Calpain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2nqaA02
1HUCB 4YYUA 2DC7A 3MORA 2OULA 5J94A 4OEMA 3S3RA 4AXMA 2WBFX 1U9WA 3H7DA 3O0UA 1DF0A 2XU3A 3KFQA 4ZUXU 2NQIA 1ME3A 1Y08A 1NB3A 4MZOA 2DC9A 1SNKA 2AYNA 4YYRA 1Q6KA 2AU1A 5JH3A 1YT7A 1U9QX 4YYSA 3N3GA 1CQDA 2R9FA 4G54A 1PIPA 3F75A 1NB5A 3RVVA 3BCNA 1X9YA 2P0RA 1JQPA 2VHSA 2O6XA 1PCIA 3H6SA 4Q8HA 1GMYA 3MHHA 1K3BB 1STFE 2Y6EA 1EWMA 2DCCA 3KSEA 3K9MA 2C0YA 3OVZA 1U5IA 1F2CA 1PADA 3I06A 1POPA 4PADA 1YK8A 2F7DA 4BSQA 1QOLA 1CS8A 3BPMA 2YJ9A 2PBHA 3V6CA 1KHPA 3KWZA 1NQCA 4N8WA 3KX1A 7PCKA 1AU2A 3IUTA 9PAPA 3KW9A 1AU4A 3HHIA 2FRQA 1CJLA 2FO5A 2P86A 1MEMA 2PNSA 1CVZA 3NHEA 4YYVA 1AU3A 2DCAA 3IEJA 1AYWA 2G6DA 3IV2A 2AUXA 3K24A 1BQIA 4QH6A 3N4CA 1ITOA 4P6GA 2HD5A 1EF7A 5F02A 2R9MA 3P5XA 4W5CA 1ZIVA 1PXVA 2NQGA 2G7YA 1PPDA 2VHFA 2YJ8A 3OISA 3HHAA 2BDZA 1CTEA 1KFUL 3IOQA 1MHWA 2FQ9A 1YK7A 4BS6A 2NQAA 3P5UA 3CH3X 3MTNA 1MDWA 3TNXA 3BPFA 1YVBA 2DZYA 3CH2X 3M99A 2BDLA 2R6NA 2AUZA 2E02A 3H89A 3KWBX 3PNRA 3K8UA 3RVXA 4QRVA 2HXZA 3WXFA 4QBBA 2G8EA 3IMAA 4XR7A 3HD3A 4PP2E 4CZWA 4PP1A 4MZSA 2R9OA 1CPJA 2ACTA 4W5BA 1M6DA 1QXPA 1MEGA 3WXEA 1BGOA 1GECE 1THEA 3E1ZB 5PADA 3ZUAA 2FYEA 3D6SA 4YVAA 2XU4A 2CIOA 4X6HA 2DCBA 1ZCMA 3P5WA 1NLJA 2DJGB 2R9NA 3OF8A 4K7CA 2E00A 1ICFA 4FJCA 1GCBA 2XU1A 1AYUA 2YJ2A 1ME4A 4P6EA 5EF4A 1BP4A 3QJ3A 3F5VA 4QRXA 4W4UA 1KHQA 1MS6A 3N3KA 1ATKA 2NQDB 5CVNB 1NPZA 2GFOA 1A6RA 2AS8A 1QMYA 2YJBA 3WXGA 2F1GA 2YJCA 1U9XA 1TU6A 3S3QA 1PE6A 3ERVA 4YV8A 5CHTA 3USVA 4CDCB 2IPPB 1DEUA 4HWYA 2AVWA 3CBJA 1O0EA 1S4VA 4N4ZA 3DF0A 1SP4B 2GHUA 2P7UA 5JA7A 2DC6A 2FRAA 3U8EA 1Y4HA 2G8JA 1MIRA 4AXLA 2FT2A 4QRGA 2DC8A 2FUDA 1CV8A 4N79A 2OZ2A 5CVMA 4CDDB 1U9VA 5CVOB 1PBHA 3PBHA 4DMYA 1QDQA 2HH5A 2OP3A 5EGWA 1AIMA 6PADA 1EWOA 1NL6A 2B1NA 3LFYA 1YALA 3KKUA 2DZZA 1EWPA 1TLOA 1KXRA 5CHVA 1F2AA 1CSBB 3QT4A 3C9EA 3BOWA 1AU0A 2DJFB 1FH0A 3AI8A 4BPVA 4WA6A 2JQGR 3H8CA 1AECA 1XKGA 4BQVA 3P5VA 3BWKA 3RVWA 1BY8A 4KLBA 1PPOA 5K16A 2AYOA 4I07A 3I3TA 4FIPA 2CB5A 1F29A 1TL9A 5A24A 4I04A 3O1GA 2E01A 2E03A 4RY2A 3IHPA 3BC3A 1PPNA 2ARYA 1VSNA 3GCBA 1PPPA 2PADA 4XUIA 4OELA 3LXSA 4FK5A 3OVXA 4X6IA 3HWNA 2XU5A 3H8BA 3OF9A 4DMXA 1VJVA 1CB5A 2Y5BA 4YYQA 1GLOA 5FPWA 1KFXL 4CDEB 4BS5A 4CDFB 8PCHA 2AIMA 2JQFR 2IBIA 2HHNA 4MSXA 3CBKA 4I05A 1AYVA 3B79A 3QSDA 2R9CA 2B1MA 2DCDA 2ATOA 1IWDA 3PW3A 3PDFA 4Q8GA 1F2BA 1EWLA 2PREA 4X6JA 3V6EA 3MHSA 2H7JA 4YYWA 2FTDA 4PI3A
chains in the Genus database with same CATH superfamily
2DOSA 1HUCB 4YYUA 5KO3A 4D8BA 2DC7A 3MORA 2OULA 5J94A 4OEMA 3S3RA 4AXMA 3W30A 2WBFX 1U9WA 3H7DA 3O0UA 1DF0A 4RF0A 2XU3A 3KFQA 3ZNHA 2NQIA 4ZUXU 1ME3A 1Y08A 1NB3A 4MZOA 4BOUA 2DC9A 1SNKA 3W31A 2AYNA 4YYRA 1Q6KA 2AU1A 1DKIA 4OVZB 5JH3A 1YT7A 1U9QX 3E9SA 4P16A 4YYSA 3N3GA 1CQDA 2R9FA 4G54A 4GUAA 4R3DA 1PIPA 3F75A 1NB5A 3RVVA 3BCNA 1X9YA 2P0RA 1JQPA 3PHXA 2VHSA 2O6XA 3RNVA 1PCIA 1YZBA 3C0RA 3H6SA 4Q8HA 1GMYA 3MHHA 1K3BB 1STFE 2Y6EA 1EWMA 2DCCA 3KSEA 3K9MA 2C0YA 3OVZA 1U5IA 1F2CA 1PADA 1UKFA 3I06A 1POPA 4PADA 1YK8A 2F7DA 3MTVA 4BSQA 1QOLA 1CS8A 3BPMA 4BOZA 2YJ9A 2PBHA 3V6CA 2J7QC 1KHPA 3KWZA 1NQCA 4N8WA 3KX1A 7PCKA 1AU2A 3IUTA 9PAPA 3KW9A 1AU4A 3HHIA 3O65A 2FRQA 1CJLA 2FO5A 2P86A 3BB7A 1MEMA 2PNSA 1CVZA 1PVJA 3NHEA 4YYVA 1AU3A 2DCAA 3IEJA 1AYWA 2G6DA 3IV2A 4IP3A 2AUXA 3K24A 1BQIA 2BU3A 4QH6A 2BTWA 3N4CA 1ITOA 4P6GA 2HD5A 1EF7A 5F02A 2R9MA 3P5XA 3TMPA 4W5CA 1ZIVA 1PXVA 2NQGA 2G7YA 3PRPA 1PPDA 2VHFA 2YJ8A 3OISA 3HHAA 2BDZA 3IFUA 1CTEA 1KFUL 4HXDB 3IOQA 1MHWA 2FQ9A 1YK7A 4IUMA 4BS6A 2NQAA 3P5UA 3CH3X 3MTNA 3PHWA 1MDWA 3TNXA 3BPFA 1YVBA 2DZYA 3TRKA 3CH2X 3M99A 2BDLA 2R6NA 2AUZA 4MI7A 2E02A 3BBAA 3H89A 3KWBX 3PNRA 3K8UA 3RVXA 4QRVA 2HXZA 3WXFA 4QBBA 2G8EA 4REZA 3IMAA 4XR7A 3HD3A 4PP2E 5EZQA 4CZWA 4PP1A 4MZSA 2R9OA 1CPJA 3BY4A 2ACTA 4MM3B 4W5BA 1M6DA 1QXPA 3PT2A 1MEGA 3WXEA 2J7QA 1BGOA 1GECE 1THEA 3E1ZB 5PADA 3ZUAA 2FYEA 3D6SA 4YVAA 2XU4A 2CIOA 3MJ5A 4X6HA 4D8EA 2DCBA 4PT5A 1ZCMA 3P5WA 1NLJA 2DJGB 2R9NA 3OF8A 4K7CA 2E00A 1ICFA 2JTCA 4FJCA 1GCBA 2XU1A 1AYUA 4XZXA 2YJ2A 1ME4A 4P6EA 5EF4A 1BP4A 3QJ3A 3F5VA 4QRXA 4W4UA 1KHQA 1MS6A 4M0WA 3N3KA 1ATKA 2NQDB 5CVNB 1NPZA 2GFOA 1A6RA 2AS8A 1QMYA 2YJBA 4ZTBA 3WXGA 2F1GA 2YJCA 1U9XA 1TU6A 3S3QA 1PE6A 3PHUA 3ERVA 4YV8A 3PRMA 5CHTA 3USVA 4CDCB 2IPPB 1DEUA 4HWYA 2FE8A 2AVWA 3CBJA 1O0EA 1S4VA 2Z84A 4N4ZA 3DF0A 1SP4B 2GHUA 2P7UA 5JA7A 2DC6A 5EZSA 2FRAA 3U8EA 1Y4HA 2G8JA 1MIRA 4AXLA 2FT2A 4QRGA 2DC8A 2FUDA 1CV8A 4N79A 2OZ2A 5CVMA 4CDDB 1U9VA 5CVOB 1PBHA 3PBHA 4DMYA 1QDQA 2HH5A 2OP3A 5EGWA 1AIMA 6PADA 1EWOA 1NL6A 2B1NA 3PSEA 4OW0A 3LFYA 1YALA 3KKUA 2DZZA 1EWPA 1TLOA 1KXRA 5CHVA 1F2AA 1CSBB 3QT4A 4A5UA 3B21A 3C9EA 3BOWA 3MP2A 1AU0A 2DJFB 1FH0A 3AI8A 4BPVA 4WA6A 2JQGR 3H8CA 1AECA 1XKGA 4BQVA 2BTWB 3P5VA 3BWKA 3RVWA 1BY8A 4KLBA 1PPOA 5K16A 4WURA 2AYOA 4I07A 3I3TA 4FIPA 2CB5A 1F29A 1TL9A 5A24A 4I04A 3O1GA 2E01A 2E03A 4RY2A 3IHPA 5JZEA 3BC3A 1PPNA 4BOPA 2ARYA 2JRIA 3OQCA 1VSNA 3GCBA 1PPPA 2PADA 4XUIA 4OELA 3LXSA 4FK5A 3OVXA 4D8IA 4X6IA 4OVZA 3HWNA 2XU5A 4BOQA 3H8BA 2UZJA 3OF9A 4DMXA 1VJVA 1CB5A 2Y5BA 4BOSA 4YYQA 1GLOA 5FPWA 1KFXL 4CDEB 4BS5A 4CDFB 8PCHA 2AIMA 2AGAA 2JQFR 2IBIA 2HHNA 4MSXA 3CBKA 4I05A 1AYVA 3B79A 4RNAA 3QSDA 2R9CA 2HWKA 2B1MA 5E6JA 2DCDA 2ATOA 1IWDA 3PW3A 3PDFA 4Q8GA 4RKXA 1F2BA 4RF1A 1EWLA 2PREA 4X6JA 3V6EA 3MHSA 2H7JA 4YYWA 2FTDA 4PI3A
chains in the Genus database with same CATH topology
1HUCB 4YYUA 2DC7A 3MORA 2OULA 5J94A 4OEMA 3S3RA 4AXMA 2WBFX 1U9WA 3H7DA 3O0UA 1DF0A 2XU3A 3KFQA 4ZUXU 2NQIA 1ME3A 1Y08A 1NB3A 4MZOA 2DC9A 1SNKA 2AYNA 4YYRA 1Q6KA 2AU1A 5JH3A 1YT7A 1U9QX 4YYSA 3N3GA 1CQDA 2R9FA 4G54A 1PIPA 3F75A 1NB5A 3RVVA 3BCNA 1X9YA 2P0RA 1JQPA 2VHSA 2O6XA 1PCIA 4C5PA 3H6SA 4Q8HA 1GMYA 3MHHA 1K3BB 1STFE 2Y6EA 1EWMA 2DCCA 3KSEA 3K9MA 2C0YA 3OVZA 1U5IA 1F2CA 1PADA 3I06A 1POPA 4PADA 1YK8A 2F7DA 4BSQA 1QOLA 1CS8A 3BPMA 2YJ9A 2PBHA 3V6CA 1KHPA 3KWZA 1NQCA 4N8WA 2VFCA 3KX1A 7PCKA 1AU2A 3IUTA 9PAPA 3KW9A 1AU4A 3HHIA 2FRQA 1CJLA 2FO5A 2P86A 1MEMA 2PNSA 1CVZA 3NHEA 4YYVA 1AU3A 2DCAA 3IEJA 1AYWA 2G6DA 3IV2A 2AUXA 1GX3A 3K24A 1BQIA 4QH6A 3N4CA 1ITOA 4P6GA 2HD5A 1EF7A 5F02A 2R9MA 3P5XA 4W5CA 1ZIVA 1PXVA 2NQGA 2G7YA 1PPDA 2VHFA 2YJ8A 3OISA 3HHAA 2BDZA 1CTEA 1KFUL 3IOQA 1MHWA 1W6FA 2FQ9A 1YK7A 4BS6A 4NV8A 2BSZA 2NQAA 3P5UA 3CH3X 3MTNA 1MDWA 3TNXA 3BPFA 1YVBA 2DZYA 3CH2X 3M99A 2BDLA 2R6NA 2AUZA 2E02A 3H89A 3KWBX 3PNRA 3K8UA 3RVXA 4QRVA 1E2TA 2HXZA 3WXFA 4QBBA 2G8EA 3IMAA 4XR7A 4B55A 3HD3A 4PP2E 4CZWA 4PP1A 4MZSA 2R9OA 1CPJA 2ACTA 4W5BA 1M6DA 1QXPA 1MEGA 3WXEA 1BGOA 1GECE 1THEA 3E1ZB 5PADA 3ZUAA 2FYEA 3D6SA 4YVAA 2XU4A 2CIOA 4X6HA 2DCBA 1ZCMA 3P5WA 1NLJA 2DJGB 2R9NA 3OF8A 4K7CA 2E00A 1ICFA 4FJCA 1GCBA 2XU1A 1AYUA 2YJ2A 1ME4A 4P6EA 5EF4A 1BP4A 3QJ3A 3F5VA 4QRXA 4W4UA 1KHQA 1MS6A 3N3KA 1ATKA 2NQDB 5CVNB 1NPZA 2GFOA 1A6RA 2AS8A 1QMYA 2YJBA 3LTWA 3WXGA 2F1GA 2YJCA 1U9XA 1TU6A 3S3QA 1PE6A 3ERVA 4YV8A 5CHTA 3USVA 4CDCB 2IPPB 1DEUA 4HWYA 2AVWA 3CBJA 1O0EA 1S4VA 4N4ZA 3DF0A 1SP4B 2GHUA 2P7UA 5JA7A 2DC6A 2FRAA 3U8EA 1Y4HA 2G8JA 4BGFA 1MIRA 4AXLA 2FT2A 4QRGA 2DC8A 2FUDA 1CV8A 4N79A 2OZ2A 5CVMA 2VFBA 4CDDB 1U9VA 5CVOB 1PBHA 3PBHA 4DMYA 1QDQA 2HH5A 2OP3A 5EGWA 1AIMA 6PADA 1EWOA 1NL6A 2B1NA 3LFYA 4NV7A 1YALA 3KKUA 2DZZA 1EWPA 1TLOA 1KXRA 5CHVA 1F2AA 1CSBB 3QT4A 3C9EA 3BOWA 1AU0A 2DJFB 1FH0A 3AI8A 4BPVA 4WA6A 2JQGR 3H8CA 1AECA 1XKGA 4BQVA 3P5VA 3BWKA 3RVWA 1BY8A 4KLBA 1PPOA 5K16A 2AYOA 4I07A 3I3TA 4FIPA 2CB5A 4GUZA 1F29A 1TL9A 5A24A 4I04A 3O1GA 2E01A 2E03A 4RY2A 3IHPA 3BC3A 1PPNA 2ARYA 1VSNA 3GCBA 1PPPA 2PADA 4XUIA 4OELA 3LXSA 4FK5A 3OVXA 4X6IA 1W4TA 3HWNA 2XU5A 3H8BA 1W5RA 3OF9A 4DMXA 1VJVA 1CB5A 2Y5BA 4YYQA 1GLOA 3D9WA 5FPWA 1KFXL 4CDEB 4BS5A 4CDFB 8PCHA 2AIMA 2JQFR 2IBIA 2HHNA 4MSXA 3CBKA 4I05A 1AYVA 3B79A 3QSDA 2R9CA 2B1MA 2DCDA 2ATOA 1IWDA 3PW3A 3PDFA 4Q8GA 1F2BA 1EWLA 2PREA 4X6JA 3V6EA 3MHSA 2H7JA 4YYWA 2FTDA 4PI3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HUC B;  4YYU A;  2DC7 A;  3MOR A;  2OUL A;  5J94 A;  4OEM A;  3S3R A;  4AXM A;  2WBF X;  1U9W A;  3H7D A;  3O0U A;  1DF0 A;  2XU3 A;  3KFQ A;  4ZUX U;  2NQI A;  1ME3 A;  1Y08 A;  1NB3 A;  4MZO A;  2DC9 A;  1SNK A;  2AYN A;  4YYR A;  1Q6K A;  2AU1 A;  5JH3 A;  1YT7 A;  1U9Q X;  4YYS A;  3N3G A;  1CQD A;  2R9F A;  4G54 A;  1PIP A;  3F75 A;  1NB5 A;  3RVV A;  3BCN A;  1X9Y A;  2P0R A;  1JQP A;  2VHS A;  2O6X A;  1PCI A;  3H6S A;  4Q8H A;  1GMY A;  3MHH A;  1K3B B;  1STF E;  2Y6E A;  1EWM A;  2DCC A;  3KSE A;  3K9M A;  2C0Y A;  3OVZ A;  1U5I A;  1F2C A;  1PAD A;  3I06 A;  1POP A;  4PAD A;  1YK8 A;  2F7D A;  4BSQ A;  1QOL A;  1CS8 A;  3BPM A;  2YJ9 A;  2PBH A;  3V6C A;  1KHP A;  3KWZ A;  1NQC A;  4N8W A;  3KX1 A;  7PCK A;  1AU2 A;  3IUT A;  9PAP A;  3KW9 A;  1AU4 A;  3HHI A;  2FRQ A;  1CJL A;  2FO5 A;  2P86 A;  1MEM A;  2PNS A;  1CVZ A;  3NHE A;  4YYV A;  1AU3 A;  2DCA A;  3IEJ A;  1AYW A;  2G6D A;  3IV2 A;  2AUX A;  3K24 A;  1BQI A;  4QH6 A;  3N4C A;  1ITO A;  4P6G A;  2HD5 A;  1EF7 A;  5F02 A;  2R9M A;  3P5X A;  4W5C A;  1ZIV A;  1PXV A;  2NQG A;  2G7Y A;  1PPD A;  2VHF A;  2YJ8 A;  3OIS A;  3HHA A;  2BDZ A;  1CTE A;  1KFU L;  3IOQ A;  1MHW A;  2FQ9 A;  1YK7 A;  4BS6 A;  2NQA A;  3P5U A;  3CH3 X;  3MTN A;  1MDW A;  3TNX A;  3BPF A;  1YVB A;  2DZY A;  3CH2 X;  3M99 A;  2BDL A;  2R6N A;  2AUZ A;  2E02 A;  3H89 A;  3KWB X;  3PNR A;  3K8U A;  3RVX A;  4QRV A;  2HXZ A;  3WXF A;  4QBB A;  2G8E A;  3IMA A;  4XR7 A;  3HD3 A;  4PP2 E;  4CZW A;  4PP1 A;  4MZS A;  2R9O A;  1CPJ A;  2ACT A;  4W5B A;  1M6D A;  1QXP A;  1MEG A;  3WXE A;  1BGO A;  1GEC E;  1THE A;  3E1Z B;  5PAD A;  3ZUA A;  2FYE A;  3D6S A;  4YVA A;  2XU4 A;  2CIO A;  4X6H A;  2DCB A;  1ZCM A;  3P5W A;  1NLJ A;  2DJG B;  2R9N A;  3OF8 A;  4K7C A;  2E00 A;  1ICF A;  4FJC A;  1GCB A;  2XU1 A;  1AYU A;  2YJ2 A;  1ME4 A;  4P6E A;  5EF4 A;  1BP4 A;  3QJ3 A;  3F5V A;  4QRX A;  4W4U A;  1KHQ A;  1MS6 A;  3N3K A;  1ATK A;  2NQD B;  5CVN B;  1NPZ A;  2GFO A;  1A6R A;  2AS8 A;  1QMY A;  2YJB A;  3WXG A;  2F1G A;  2YJC A;  1U9X A;  1TU6 A;  3S3Q A;  1PE6 A;  3ERV A;  4YV8 A;  5CHT A;  3USV A;  4CDC B;  2IPP B;  1DEU A;  4HWY A;  2AVW A;  3CBJ A;  1O0E A;  1S4V A;  4N4Z A;  3DF0 A;  1SP4 B;  2GHU A;  2P7U A;  5JA7 A;  2DC6 A;  2FRA A;  3U8E A;  1Y4H A;  2G8J A;  1MIR A;  4AXL A;  2FT2 A;  4QRG A;  2DC8 A;  2FUD A;  1CV8 A;  4N79 A;  2OZ2 A;  5CVM A;  4CDD B;  1U9V A;  5CVO B;  1PBH A;  3PBH A;  4DMY A;  1QDQ A;  2HH5 A;  2OP3 A;  5EGW A;  1AIM A;  6PAD A;  1EWO A;  1NL6 A;  2B1N A;  3LFY A;  1YAL A;  3KKU A;  2DZZ A;  1EWP A;  1TLO A;  1KXR A;  5CHV A;  1F2A A;  1CSB B;  3QT4 A;  3C9E A;  3BOW A;  1AU0 A;  2DJF B;  1FH0 A;  3AI8 A;  4BPV A;  4WA6 A;  2JQG R;  3H8C A;  1AEC A;  1XKG A;  4BQV A;  3P5V A;  3BWK A;  3RVW A;  1BY8 A;  4KLB A;  1PPO A;  5K16 A;  2AYO A;  4I07 A;  3I3T A;  4FIP A;  2CB5 A;  1F29 A;  1TL9 A;  5A24 A;  4I04 A;  3O1G A;  2E01 A;  2E03 A;  4RY2 A;  3IHP A;  3BC3 A;  1PPN A;  2ARY A;  1VSN A;  3GCB A;  1PPP A;  2PAD A;  4XUI A;  4OEL A;  3LXS A;  4FK5 A;  3OVX A;  4X6I A;  3HWN A;  2XU5 A;  3H8B A;  3OF9 A;  4DMX A;  1VJV A;  1CB5 A;  2Y5B A;  4YYQ A;  1GLO A;  5FPW A;  1KFX L;  4CDE B;  4BS5 A;  4CDF B;  8PCH A;  2AIM A;  2JQF R;  2IBI A;  2HHN A;  4MSX A;  3CBK A;  4I05 A;  1AYV A;  3B79 A;  3QSD A;  2R9C A;  2B1M A;  2DCD A;  2ATO A;  1IWD A;  3PW3 A;  3PDF A;  4Q8G A;  1F2B A;  1EWL A;  2PRE A;  4X6J A;  3V6E A;  3MHS A;  2H7J A;  4YYW A;  2FTD A;  4PI3 A; 
#chains in the Genus database with same CATH topology
 2DOS A;  1HUC B;  4YYU A;  5KO3 A;  4D8B A;  2DC7 A;  3MOR A;  2OUL A;  5J94 A;  4OEM A;  3S3R A;  4AXM A;  3W30 A;  2WBF X;  1U9W A;  3H7D A;  3O0U A;  1DF0 A;  4RF0 A;  2XU3 A;  3KFQ A;  3ZNH A;  2NQI A;  4ZUX U;  1ME3 A;  1Y08 A;  1NB3 A;  4MZO A;  4BOU A;  2DC9 A;  1SNK A;  3W31 A;  2AYN A;  4YYR A;  1Q6K A;  2AU1 A;  1DKI A;  4OVZ B;  5JH3 A;  1YT7 A;  1U9Q X;  3E9S A;  4P16 A;  4YYS A;  3N3G A;  1CQD A;  2R9F A;  4G54 A;  4GUA A;  4R3D A;  1PIP A;  3F75 A;  1NB5 A;  3RVV A;  3BCN A;  1X9Y A;  2P0R A;  1JQP A;  3PHX A;  2VHS A;  2O6X A;  3RNV A;  1PCI A;  1YZB A;  3C0R A;  3H6S A;  4Q8H A;  1GMY A;  3MHH A;  1K3B B;  1STF E;  2Y6E A;  1EWM A;  2DCC A;  3KSE A;  3K9M A;  2C0Y A;  3OVZ A;  1U5I A;  1F2C A;  1PAD A;  1UKF A;  3I06 A;  1POP A;  4PAD A;  1YK8 A;  2F7D A;  3MTV A;  4BSQ A;  1QOL A;  1CS8 A;  3BPM A;  4BOZ A;  2YJ9 A;  2PBH A;  3V6C A;  2J7Q C;  1KHP A;  3KWZ A;  1NQC A;  4N8W A;  3KX1 A;  7PCK A;  1AU2 A;  3IUT A;  9PAP A;  3KW9 A;  1AU4 A;  3HHI A;  3O65 A;  2FRQ A;  1CJL A;  2FO5 A;  2P86 A;  3BB7 A;  1MEM A;  2PNS A;  1CVZ A;  1PVJ A;  3NHE A;  4YYV A;  1AU3 A;  2DCA A;  3IEJ A;  1AYW A;  2G6D A;  3IV2 A;  4IP3 A;  2AUX A;  3K24 A;  1BQI A;  2BU3 A;  4QH6 A;  2BTW A;  3N4C A;  1ITO A;  4P6G A;  2HD5 A;  1EF7 A;  5F02 A;  2R9M A;  3P5X A;  3TMP A;  4W5C A;  1ZIV A;  1PXV A;  2NQG A;  2G7Y A;  3PRP A;  1PPD A;  2VHF A;  2YJ8 A;  3OIS A;  3HHA A;  2BDZ A;  3IFU A;  1CTE A;  1KFU L;  4HXD B;  3IOQ A;  1MHW A;  2FQ9 A;  1YK7 A;  4IUM A;  4BS6 A;  2NQA A;  3P5U A;  3CH3 X;  3MTN A;  3PHW A;  1MDW A;  3TNX A;  3BPF A;  1YVB A;  2DZY A;  3TRK A;  3CH2 X;  3M99 A;  2BDL A;  2R6N A;  2AUZ A;  4MI7 A;  2E02 A;  3BBA A;  3H89 A;  3KWB X;  3PNR A;  3K8U A;  3RVX A;  4QRV A;  2HXZ A;  3WXF A;  4QBB A;  2G8E A;  4REZ A;  3IMA A;  4XR7 A;  3HD3 A;  4PP2 E;  5EZQ A;  4CZW A;  4PP1 A;  4MZS A;  2R9O A;  1CPJ A;  3BY4 A;  2ACT A;  4MM3 B;  4W5B A;  1M6D A;  1QXP A;  3PT2 A;  1MEG A;  3WXE A;  2J7Q A;  1BGO A;  1GEC E;  1THE A;  3E1Z B;  5PAD A;  3ZUA A;  2FYE A;  3D6S A;  4YVA A;  2XU4 A;  2CIO A;  3MJ5 A;  4X6H A;  4D8E A;  2DCB A;  4PT5 A;  1ZCM A;  3P5W A;  1NLJ A;  2DJG B;  2R9N A;  3OF8 A;  4K7C A;  2E00 A;  1ICF A;  2JTC A;  4FJC A;  1GCB A;  2XU1 A;  1AYU A;  4XZX A;  2YJ2 A;  1ME4 A;  4P6E A;  5EF4 A;  1BP4 A;  3QJ3 A;  3F5V A;  4QRX A;  4W4U A;  1KHQ A;  1MS6 A;  4M0W A;  3N3K A;  1ATK A;  2NQD B;  5CVN B;  1NPZ A;  2GFO A;  1A6R A;  2AS8 A;  1QMY A;  2YJB A;  4ZTB A;  3WXG A;  2F1G A;  2YJC A;  1U9X A;  1TU6 A;  3S3Q A;  1PE6 A;  3PHU A;  3ERV A;  4YV8 A;  3PRM A;  5CHT A;  3USV A;  4CDC B;  2IPP B;  1DEU A;  4HWY A;  2FE8 A;  2AVW A;  3CBJ A;  1O0E A;  1S4V A;  2Z84 A;  4N4Z A;  3DF0 A;  1SP4 B;  2GHU A;  2P7U A;  5JA7 A;  2DC6 A;  5EZS A;  2FRA A;  3U8E A;  1Y4H A;  2G8J A;  1MIR A;  4AXL A;  2FT2 A;  4QRG A;  2DC8 A;  2FUD A;  1CV8 A;  4N79 A;  2OZ2 A;  5CVM A;  4CDD B;  1U9V A;  5CVO B;  1PBH A;  3PBH A;  4DMY A;  1QDQ A;  2HH5 A;  2OP3 A;  5EGW A;  1AIM A;  6PAD A;  1EWO A;  1NL6 A;  2B1N A;  3PSE A;  4OW0 A;  3LFY A;  1YAL A;  3KKU A;  2DZZ A;  1EWP A;  1TLO A;  1KXR A;  5CHV A;  1F2A A;  1CSB B;  3QT4 A;  4A5U A;  3B21 A;  3C9E A;  3BOW A;  3MP2 A;  1AU0 A;  2DJF B;  1FH0 A;  3AI8 A;  4BPV A;  4WA6 A;  2JQG R;  3H8C A;  1AEC A;  1XKG A;  4BQV A;  2BTW B;  3P5V A;  3BWK A;  3RVW A;  1BY8 A;  4KLB A;  1PPO A;  5K16 A;  4WUR A;  2AYO A;  4I07 A;  3I3T A;  4FIP A;  2CB5 A;  1F29 A;  1TL9 A;  5A24 A;  4I04 A;  3O1G A;  2E01 A;  2E03 A;  4RY2 A;  3IHP A;  5JZE A;  3BC3 A;  1PPN A;  4BOP A;  2ARY A;  2JRI A;  3OQC A;  1VSN A;  3GCB A;  1PPP A;  2PAD A;  4XUI A;  4OEL A;  3LXS A;  4FK5 A;  3OVX A;  4D8I A;  4X6I A;  4OVZ A;  3HWN A;  2XU5 A;  4BOQ A;  3H8B A;  2UZJ A;  3OF9 A;  4DMX A;  1VJV A;  1CB5 A;  2Y5B A;  4BOS A;  4YYQ A;  1GLO A;  5FPW A;  1KFX L;  4CDE B;  4BS5 A;  4CDF B;  8PCH A;  2AIM A;  2AGA A;  2JQF R;  2IBI A;  2HHN A;  4MSX A;  3CBK A;  4I05 A;  1AYV A;  3B79 A;  4RNA A;  3QSD A;  2R9C A;  2HWK A;  2B1M A;  5E6J A;  2DCD A;  2ATO A;  1IWD A;  3PW3 A;  3PDF A;  4Q8G A;  4RKX A;  1F2B A;  4RF1 A;  1EWL A;  2PRE A;  4X6J A;  3V6E A;  3MHS A;  2H7J A;  4YYW A;  2FTD A;  4PI3 A; 
#chains in the Genus database with same CATH homology
 1HUC B;  4YYU A;  2DC7 A;  3MOR A;  2OUL A;  5J94 A;  4OEM A;  3S3R A;  4AXM A;  2WBF X;  1U9W A;  3H7D A;  3O0U A;  1DF0 A;  2XU3 A;  3KFQ A;  4ZUX U;  2NQI A;  1ME3 A;  1Y08 A;  1NB3 A;  4MZO A;  2DC9 A;  1SNK A;  2AYN A;  4YYR A;  1Q6K A;  2AU1 A;  5JH3 A;  1YT7 A;  1U9Q X;  4YYS A;  3N3G A;  1CQD A;  2R9F A;  4G54 A;  1PIP A;  3F75 A;  1NB5 A;  3RVV A;  3BCN A;  1X9Y A;  2P0R A;  1JQP A;  2VHS A;  2O6X A;  1PCI A;  4C5P A;  3H6S A;  4Q8H A;  1GMY A;  3MHH A;  1K3B B;  1STF E;  2Y6E A;  1EWM A;  2DCC A;  3KSE A;  3K9M A;  2C0Y A;  3OVZ A;  1U5I A;  1F2C A;  1PAD A;  3I06 A;  1POP A;  4PAD A;  1YK8 A;  2F7D A;  4BSQ A;  1QOL A;  1CS8 A;  3BPM A;  2YJ9 A;  2PBH A;  3V6C A;  1KHP A;  3KWZ A;  1NQC A;  4N8W A;  2VFC A;  3KX1 A;  7PCK A;  1AU2 A;  3IUT A;  9PAP A;  3KW9 A;  1AU4 A;  3HHI A;  2FRQ A;  1CJL A;  2FO5 A;  2P86 A;  1MEM A;  2PNS A;  1CVZ A;  3NHE A;  4YYV A;  1AU3 A;  2DCA A;  3IEJ A;  1AYW A;  2G6D A;  3IV2 A;  2AUX A;  1GX3 A;  3K24 A;  1BQI A;  4QH6 A;  3N4C A;  1ITO A;  4P6G A;  2HD5 A;  1EF7 A;  5F02 A;  2R9M A;  3P5X A;  4W5C A;  1ZIV A;  1PXV A;  2NQG A;  2G7Y A;  1PPD A;  2VHF A;  2YJ8 A;  3OIS A;  3HHA A;  2BDZ A;  1CTE A;  1KFU L;  3IOQ A;  1MHW A;  1W6F A;  2FQ9 A;  1YK7 A;  4BS6 A;  4NV8 A;  2BSZ A;  2NQA A;  3P5U A;  3CH3 X;  3MTN A;  1MDW A;  3TNX A;  3BPF A;  1YVB A;  2DZY A;  3CH2 X;  3M99 A;  2BDL A;  2R6N A;  2AUZ A;  2E02 A;  3H89 A;  3KWB X;  3PNR A;  3K8U A;  3RVX A;  4QRV A;  1E2T A;  2HXZ A;  3WXF A;  4QBB A;  2G8E A;  3IMA A;  4XR7 A;  4B55 A;  3HD3 A;  4PP2 E;  4CZW A;  4PP1 A;  4MZS A;  2R9O A;  1CPJ A;  2ACT A;  4W5B A;  1M6D A;  1QXP A;  1MEG A;  3WXE A;  1BGO A;  1GEC E;  1THE A;  3E1Z B;  5PAD A;  3ZUA A;  2FYE A;  3D6S A;  4YVA A;  2XU4 A;  2CIO A;  4X6H A;  2DCB A;  1ZCM A;  3P5W A;  1NLJ A;  2DJG B;  2R9N A;  3OF8 A;  4K7C A;  2E00 A;  1ICF A;  4FJC A;  1GCB A;  2XU1 A;  1AYU A;  2YJ2 A;  1ME4 A;  4P6E A;  5EF4 A;  1BP4 A;  3QJ3 A;  3F5V A;  4QRX A;  4W4U A;  1KHQ A;  1MS6 A;  3N3K A;  1ATK A;  2NQD B;  5CVN B;  1NPZ A;  2GFO A;  1A6R A;  2AS8 A;  1QMY A;  2YJB A;  3LTW A;  3WXG A;  2F1G A;  2YJC A;  1U9X A;  1TU6 A;  3S3Q A;  1PE6 A;  3ERV A;  4YV8 A;  5CHT A;  3USV A;  4CDC B;  2IPP B;  1DEU A;  4HWY A;  2AVW A;  3CBJ A;  1O0E A;  1S4V A;  4N4Z A;  3DF0 A;  1SP4 B;  2GHU A;  2P7U A;  5JA7 A;  2DC6 A;  2FRA A;  3U8E A;  1Y4H A;  2G8J A;  4BGF A;  1MIR A;  4AXL A;  2FT2 A;  4QRG A;  2DC8 A;  2FUD A;  1CV8 A;  4N79 A;  2OZ2 A;  5CVM A;  2VFB A;  4CDD B;  1U9V A;  5CVO B;  1PBH A;  3PBH A;  4DMY A;  1QDQ A;  2HH5 A;  2OP3 A;  5EGW A;  1AIM A;  6PAD A;  1EWO A;  1NL6 A;  2B1N A;  3LFY A;  4NV7 A;  1YAL A;  3KKU A;  2DZZ A;  1EWP A;  1TLO A;  1KXR A;  5CHV A;  1F2A A;  1CSB B;  3QT4 A;  3C9E A;  3BOW A;  1AU0 A;  2DJF B;  1FH0 A;  3AI8 A;  4BPV A;  4WA6 A;  2JQG R;  3H8C A;  1AEC A;  1XKG A;  4BQV A;  3P5V A;  3BWK A;  3RVW A;  1BY8 A;  4KLB A;  1PPO A;  5K16 A;  2AYO A;  4I07 A;  3I3T A;  4FIP A;  2CB5 A;  4GUZ A;  1F29 A;  1TL9 A;  5A24 A;  4I04 A;  3O1G A;  2E01 A;  2E03 A;  4RY2 A;  3IHP A;  3BC3 A;  1PPN A;  2ARY A;  1VSN A;  3GCB A;  1PPP A;  2PAD A;  4XUI A;  4OEL A;  3LXS A;  4FK5 A;  3OVX A;  4X6I A;  1W4T A;  3HWN A;  2XU5 A;  3H8B A;  1W5R A;  3OF9 A;  4DMX A;  1VJV A;  1CB5 A;  2Y5B A;  4YYQ A;  1GLO A;  3D9W A;  5FPW A;  1KFX L;  4CDE B;  4BS5 A;  4CDF B;  8PCH A;  2AIM A;  2JQF R;  2IBI A;  2HHN A;  4MSX A;  3CBK A;  4I05 A;  1AYV A;  3B79 A;  3QSD A;  2R9C A;  2B1M A;  2DCD A;  2ATO A;  1IWD A;  3PW3 A;  3PDF A;  4Q8G A;  1F2B A;  1EWL A;  2PRE A;  4X6J A;  3V6E A;  3MHS A;  2H7J A;  4YYW A;  2FTD A;  4PI3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...