2NQAA

Catalytic domain of human calpain 8
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
320
structure length
305
Chain Sequence
NALKYLGQDFKTLRQQCLDSGVLFKDPEFPAPSALGYTQGIIWKRPTELPSPQFIVGGATRTDIQGGLGDCWLLAAIASLTLNEELLYRVVPRDQDFQENYAGIFHFQFWQYGEWVEVVIDDRLPTKNGQLLFLHSEQGNEFWSALLEKAYAKLNGYEALAGGSTVEGFEDFTGGISEFYDLKKPPANLYQIIRKALAGSLLGCSIDVYSAAEAEAITSQKLVKSHAYSVTGVEEVNFQGHPEKLIRLRNPWGEEWSGAWSDDAPEWNHIDPRRKEELDKKVEDGEFWMSLSDFVRQFSRLEICN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Human Calpain 8
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Calpain 8
total genus 76
structure length 305
sequence length 320
chains with identical sequence B
ec nomenclature ec 3.4.22.53: Calpain-2.
pdb deposition date 2006-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00648 Peptidase_C2 Calpain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2nqaA02
4CDEB 3LXSA 3BC3A 1ME4A 1SP4B 3USVA 2FRQA 1YK7A 3M99A 2VHSA 3QJ3A 2AYNA 2AUZA 2DC7A 3MHSA 4YYWA 4G54A 1YALA 6PADA 3IHPA 1GMYA 3IEJA 4BS5A 1ATKA 2DC9A 1BY8A 2DJFB 1U5IA 3RVXA 2BDLA 2AS8A 5K16A 2DCCA 1QDQA 1MEGA 9PAPA 1JQPA 2Y6EA 1EWMA 5PADA 1AYUA 2DC6A 5JH3A 1ME3A 2ARYA 3ZUAA 3E1ZB 4AXLA 4BPVA 3HD3A 3WXEA 4I04A 2DZYA 4Q8GA 1MEMA 3OISA 3PNRA 2XU5A 3DF0A 3MTNA 1U9WA 4YYRA 1TU6A 1CVZA 3N4CA 4KLBA 3OF9A 3BPMA 3CH2X 3PBHA 1CPJA 1IWDA 2G8JA 4PP2E 2P7UA 1KHPA 1PPNA 3TNXA 3U8EA 3WXFA 1HUCB 2PADA 2HHNA 1O0EA 4BQVA 3OF8A 2NQIA 2FRAA 1THEA 3LFYA 4PADA 2JQGR 2R6NA 1ICFA 2H7JA 4YYVA 1TL9A 1Y4HA 2AUXA 1GCBA 1PBHA 3KW9A 1F2BA 1TLOA 2G8EA 1XKGA 3P5UA 2E01A 2OULA 1NLJA 2G7YA 2FYEA 4DMYA 5F02A 1FH0A 2YJ2A 1A6RA 1ZIVA 1GECE 2GFOA 4X6IA 1PPPA 2WBFX 1NQCA 4AXMA 2P0RA 4RY2A 4CDFB 3OVZA 4MSXA 4XUIA 2B1NA 4BS6A 4OELA 2AVWA 3BWKA 2DC8A 2AYOA 2B1MA 3F5VA 1CS8A 2PNSA 2HH5A 4OEMA 3P5XA 1VSNA 3RVWA 4N4ZA 4QRVA 4FK5A 2XU1A 2OP3A 2NQGA 1KHQA 1QOLA 7PCKA 4QH6A 3HWNA 3O0UA 4N8WA 5CHVA 1YVBA 1BGOA 3S3RA 3P5VA 5EGWA 3KSEA 3D6SA 3ERVA 3K24A 4P6EA 4W5CA 3BPFA 2YJ9A 2YJBA 4PI3A 5CVMA 1U9XA 2R9FA 2PREA 2YJCA 2FUDA 1CV8A 3C9EA 3K9MA 1AU0A 2O6XA 1AECA 1NB3A 3NHEA 3QSDA 3KFQA 2R9CA 1PE6A 2ACTA 5J94A 3WXGA 2NQAA 2R9OA 4HWYA 4XR7A 3I06A 2ATOA 2E02A 3KWBX 2DZZA 1DEUA 2P86A 2XU4A 1AU3A 4X6HA 3O1GA 3BCNA 1PCIA 1DF0A 1BP4A 1BQIA 3CBKA 2DCAA 1GLOA 1AIMA 2GHUA 1U9VA 3N3GA 2PBHA 1PPOA 2OZ2A 4WA6A 1AU2A 2E00A 3KKUA 4N79A 4Q8HA 2AU1A 2DCBA 1X9YA 2BDZA 1Y08A 4YYSA 4CDDB 1EWPA 1MS6A 1Q6KA 3PDFA 4W4UA 3RVVA 4X6JA 2AIMA 1NB5A 1QXPA 1M6DA 3H8BA 2NQDB 1EWLA 4CDCB 5CVOB 4FIPA 2FTDA 3KWZA 3CBJA 3P5WA 1PADA 3V6EA 1F2AA 4P6GA 1MIRA 1KFXL 3HHAA 2HXZA 1K3BB 4W5BA 1F2CA 1F29A 3B79A 2JQFR 2F1GA 4QBBA 1AYWA 1ZCMA 4MZOA 1AYVA 3CH3X 4YV8A 1QMYA 3GCBA 1PXVA 1S4VA 1KXRA 8PCHA 2C0YA 4PP1A 3IV2A 3BOWA 3HHIA 4K7CA 4I05A 1STFE 1POPA 2Y5BA 1SNKA 1YK8A 3H7DA 5EF4A 3IOQA 5A24A 1U9QX 2FQ9A 2R9MA 2R9NA 3H6SA 3QT4A 5JA7A 1EF7A 5CHTA 1AU4A 1CJLA 1NPZA 4FJCA 2IBIA 3PW3A 3I3TA 2G6DA 1ITOA 1MHWA 4YVAA 2CB5A 2VHFA 4YYQA 1PPDA 1KFUL 2IPPB 1CQDA 1CTEA 2DCDA 4ZUXU 5FPWA 1VJVA 4QRXA 1PIPA 4CZWA 3K8UA 3N3KA 3MHHA 3OVXA 2YJ8A 4I07A 2DJGB 2CIOA 1CSBB 2FT2A 3H8CA 3MORA 1EWOA 3S3QA 3KX1A 1CB5A 4MZSA 3IUTA 1MDWA 2F7DA 3H89A 1NL6A 4YYUA 2E03A 5CVNB 4BSQA 3IMAA 2XU3A 3AI8A 3V6CA 4DMXA 2HD5A 1YT7A 2FO5A 3F75A 4QRGA
chains in the Genus database with same CATH superfamily
4CDEB 4BOSA 3LXSA 3W30A 1YZBA 3BC3A 1ME4A 1SP4B 3USVA 5KO3A 2FRQA 1YK7A 3M99A 2VHSA 3QJ3A 2AYNA 2BU3A 2AUZA 2DC7A 4D8BA 4XZXA 3MHSA 4OVZA 4R3DA 4YYWA 4G54A 1YALA 6PADA 3IHPA 1GMYA 3IEJA 4BS5A 3MTVA 1ATKA 2DC9A 1BY8A 2DJFB 1U5IA 3RVXA 2BDLA 2AS8A 5K16A 2DCCA 1QDQA 1MEGA 9PAPA 1JQPA 2Y6EA 1EWMA 3BBAA 1AYUA 5PADA 2DC6A 3PRMA 5JH3A 1ME3A 3PT2A 4D8EA 2ARYA 3TRKA 3ZUAA 3E1ZB 4AXLA 4BPVA 4RF0A 3HD3A 3WXEA 4I04A 2DZYA 4Q8GA 1MEMA 3OISA 3PNRA 2XU5A 3DF0A 4HXDB 3MTNA 4OVZB 1U9WA 4YYRA 1TU6A 1CVZA 3N4CA 4KLBA 3OF9A 3BPMA 3CH2X 3PBHA 5E6JA 1CPJA 4PT5A 1IWDA 3ZNHA 2G8JA 4PP2E 2P7UA 1KHPA 1PPNA 3TNXA 4BOZA 3U8EA 3WXFA 1HUCB 2PADA 2HHNA 1O0EA 4BQVA 3OF8A 2NQIA 2FRAA 1THEA 3LFYA 4PADA 2JQGR 2R6NA 1ICFA 2H7JA 4YYVA 3RNVA 2JTCA 4BOUA 1TL9A 2Z84A 2JRIA 1Y4HA 2AUXA 1GCBA 4RKXA 1PBHA 3KW9A 1F2BA 1TLOA 1UKFA 2G8EA 1XKGA 3MJ5A 3P5UA 2E01A 2OULA 2J7QC 1NLJA 2G7YA 2FYEA 4D8IA 4DMYA 5F02A 3PHUA 1FH0A 2YJ2A 1A6RA 1ZIVA 1GECE 2GFOA 4IUMA 4X6IA 1PPPA 2WBFX 1NQCA 4AXMA 1PVJA 3E9SA 2P0RA 4RY2A 4CDFB 3OVZA 4MSXA 4XUIA 2B1NA 4BS6A 4OELA 2AVWA 1DKIA 3BWKA 2DC8A 2AYOA 2B1MA 3F5VA 1CS8A 2PNSA 2HH5A 4OEMA 3P5XA 1VSNA 3RVWA 4N4ZA 4QRVA 4BOPA 4BOQA 4FK5A 2XU1A 2OP3A 2NQGA 1KHQA 1QOLA 3TMPA 7PCKA 4QH6A 3HWNA 3O0UA 4MM3B 4N8WA 5CHVA 1YVBA 4RNAA 1BGOA 3S3RA 3P5VA 3MP2A 5EGWA 3PSEA 3KSEA 3D6SA 3ERVA 3K24A 4P6EA 4W5CA 3BPFA 2YJ9A 4IP3A 2YJBA 4PI3A 5CVMA 3C0RA 1U9XA 2R9FA 2PREA 2YJCA 2FUDA 1CV8A 3C9EA 3K9MA 1AU0A 2O6XA 1AECA 1NB3A 4P16A 3NHEA 3QSDA 3KFQA 2R9CA 3BB7A 1PE6A 3BY4A 2ACTA 5J94A 3WXGA 2NQAA 2R9OA 4HWYA 2DOSA 4XR7A 3I06A 2FE8A 2ATOA 2E02A 3IFUA 3PHXA 3KWBX 2DZZA 1DEUA 2P86A 2XU4A 1AU3A 4X6HA 3O1GA 3BCNA 1PCIA 1DF0A 2UZJA 4OW0A 1BP4A 1BQIA 5JZEA 3CBKA 2DCAA 1GLOA 1AIMA 2GHUA 3B21A 1U9VA 3N3GA 2PBHA 3W31A 3O65A 1PPOA 2OZ2A 4WA6A 1AU2A 2BTWB 2E00A 3KKUA 5EZQA 4N79A 4Q8HA 2AU1A 2DCBA 1X9YA 4GUAA 2BDZA 1Y08A 4YYSA 4RF1A 4CDDB 1EWPA 1MS6A 1Q6KA 3PDFA 4W4UA 3RVVA 4X6JA 4A5UA 2AIMA 4MI7A 1NB5A 1QXPA 1M6DA 3H8BA 2NQDB 1EWLA 4CDCB 5CVOB 4FIPA 2FTDA 3KWZA 3CBJA 3P5WA 1PADA 3V6EA 1F2AA 4P6GA 1MIRA 1KFXL 3HHAA 2HXZA 1K3BB 4W5BA 1F2CA 1F29A 3B79A 2JQFR 2F1GA 1AYWA 4QBBA 1ZCMA 4MZOA 2AGAA 1AYVA 3CH3X 4YV8A 1QMYA 3GCBA 1PXVA 1S4VA 1KXRA 4ZTBA 8PCHA 2C0YA 5EZSA 4PP1A 2J7QA 3IV2A 3PHWA 3BOWA 3HHIA 4K7CA 4I05A 1STFE 1POPA 2Y5BA 1SNKA 1YK8A 3H7DA 5EF4A 3IOQA 5A24A 1U9QX 2BTWA 2FQ9A 2R9MA 2R9NA 3H6SA 3QT4A 5JA7A 1EF7A 2HWKA 5CHTA 1AU4A 1CJLA 1NPZA 4M0WA 4FJCA 2IBIA 3PRPA 3PW3A 3I3TA 2G6DA 1ITOA 1MHWA 4YVAA 2CB5A 2VHFA 4YYQA 1PPDA 1KFUL 2IPPB 1CQDA 1CTEA 2DCDA 4ZUXU 5FPWA 1VJVA 4QRXA 1PIPA 4CZWA 3K8UA 3N3KA 3MHHA 3OVXA 2YJ8A 4I07A 2DJGB 4REZA 2CIOA 1CSBB 2FT2A 3H8CA 3MORA 1EWOA 4WURA 3S3QA 3KX1A 1CB5A 4MZSA 3IUTA 1MDWA 2F7DA 3H89A 1NL6A 4YYUA 2E03A 5CVNB 3OQCA 3IMAA 2XU3A 4BSQA 3AI8A 3V6CA 4DMXA 2HD5A 1YT7A 2FO5A 3F75A 4QRGA
chains in the Genus database with same CATH topology
4CDEB 3LXSA 3BC3A 1ME4A 1SP4B 3USVA 2FRQA 1YK7A 3M99A 2VHSA 3QJ3A 2AYNA 2AUZA 2DC7A 3MHSA 4YYWA 4G54A 1YALA 6PADA 3IHPA 1GMYA 3IEJA 4BS5A 1ATKA 2DC9A 1BY8A 2DJFB 1U5IA 3RVXA 2BDLA 2AS8A 5K16A 2DCCA 1QDQA 1W4TA 1MEGA 9PAPA 1JQPA 2Y6EA 1EWMA 5PADA 1AYUA 4B55A 2DC6A 4BGFA 5JH3A 1ME3A 2ARYA 3ZUAA 3E1ZB 4AXLA 4BPVA 3HD3A 3WXEA 4I04A 2DZYA 4Q8GA 1MEMA 3OISA 3PNRA 2XU5A 3DF0A 3MTNA 1U9WA 4YYRA 1TU6A 1CVZA 3N4CA 4KLBA 3OF9A 3BPMA 3CH2X 3PBHA 1CPJA 1IWDA 2G8JA 4PP2E 2P7UA 1KHPA 1PPNA 3TNXA 1W5RA 3U8EA 3WXFA 1HUCB 2PADA 2HHNA 1O0EA 4BQVA 3OF8A 2NQIA 2FRAA 1THEA 3LFYA 4PADA 2JQGR 2R6NA 1ICFA 2H7JA 4YYVA 1TL9A 1Y4HA 4GUZA 2AUXA 1GCBA 1PBHA 3KW9A 1F2BA 1TLOA 2G8EA 3LTWA 1XKGA 3P5UA 2E01A 2OULA 1NLJA 2G7YA 2FYEA 4DMYA 5F02A 1FH0A 2YJ2A 1A6RA 1ZIVA 1GECE 2GFOA 4X6IA 1PPPA 2WBFX 1NQCA 4AXMA 2P0RA 4RY2A 4CDFB 3OVZA 4MSXA 4XUIA 4NV8A 2B1NA 4BS6A 4OELA 2AVWA 3BWKA 2DC8A 2AYOA 2B1MA 3F5VA 1CS8A 2PNSA 2HH5A 4OEMA 3P5XA 1VSNA 3RVWA 4N4ZA 4QRVA 4FK5A 2XU1A 2OP3A 2NQGA 1KHQA 1QOLA 7PCKA 4QH6A 3HWNA 3O0UA 4N8WA 5CHVA 1YVBA 2VFCA 1BGOA 3S3RA 3P5VA 5EGWA 3KSEA 3D6SA 3ERVA 3K24A 4P6EA 4W5CA 3BPFA 2YJ9A 2YJBA 4PI3A 5CVMA 1U9XA 2R9FA 2PREA 2YJCA 2FUDA 1CV8A 3C9EA 3K9MA 1AU0A 2O6XA 1AECA 1NB3A 3NHEA 3QSDA 3KFQA 2R9CA 1PE6A 1W6FA 2ACTA 5J94A 3WXGA 2NQAA 2R9OA 4HWYA 4XR7A 3I06A 2ATOA 2E02A 3KWBX 2DZZA 4NV7A 1DEUA 2P86A 2XU4A 1AU3A 4X6HA 3O1GA 3BCNA 1PCIA 1DF0A 1BP4A 1BQIA 3CBKA 2DCAA 1GLOA 1AIMA 2GHUA 1U9VA 3N3GA 2PBHA 1PPOA 2OZ2A 4WA6A 1AU2A 2E00A 3KKUA 4N79A 4Q8HA 2AU1A 2DCBA 1X9YA 2BDZA 1Y08A 4YYSA 4CDDB 1EWPA 1MS6A 1Q6KA 3PDFA 4W4UA 3RVVA 4X6JA 2AIMA 1NB5A 1QXPA 1M6DA 3H8BA 2NQDB 1EWLA 4CDCB 5CVOB 4FIPA 2FTDA 3KWZA 3CBJA 3P5WA 1PADA 3V6EA 1F2AA 4P6GA 1MIRA 1KFXL 3HHAA 2HXZA 1K3BB 4W5BA 1F2CA 1F29A 3B79A 2JQFR 2F1GA 3D9WA 4QBBA 1AYWA 1ZCMA 1GX3A 4MZOA 1AYVA 3CH3X 4YV8A 1QMYA 3GCBA 1PXVA 1S4VA 1KXRA 4C5PA 8PCHA 2C0YA 4PP1A 3IV2A 3BOWA 3HHIA 4K7CA 4I05A 1STFE 1POPA 2Y5BA 1SNKA 1YK8A 3H7DA 5EF4A 3IOQA 5A24A 1U9QX 2FQ9A 2R9MA 2R9NA 3H6SA 3QT4A 5JA7A 1EF7A 5CHTA 1AU4A 1CJLA 1NPZA 4FJCA 2IBIA 3PW3A 3I3TA 2G6DA 1ITOA 1MHWA 4YVAA 2CB5A 2VHFA 4YYQA 1PPDA 1KFUL 2VFBA 2IPPB 1CQDA 1CTEA 2DCDA 4ZUXU 5FPWA 1VJVA 4QRXA 1PIPA 4CZWA 3K8UA 2BSZA 3N3KA 3MHHA 3OVXA 2YJ8A 4I07A 2DJGB 2CIOA 1CSBB 2FT2A 3H8CA 3MORA 1EWOA 3S3QA 3KX1A 1CB5A 4MZSA 3IUTA 1MDWA 2F7DA 3H89A 1NL6A 4YYUA 2E03A 5CVNB 4BSQA 3IMAA 2XU3A 3AI8A 3V6CA 4DMXA 2HD5A 1YT7A 2FO5A 1E2TA 3F75A 4QRGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CDE B;  3LXS A;  3BC3 A;  1ME4 A;  1SP4 B;  3USV A;  2FRQ A;  1YK7 A;  3M99 A;  2VHS A;  3QJ3 A;  2AYN A;  2AUZ A;  2DC7 A;  3MHS A;  4YYW A;  4G54 A;  1YAL A;  6PAD A;  3IHP A;  1GMY A;  3IEJ A;  4BS5 A;  1ATK A;  2DC9 A;  1BY8 A;  2DJF B;  1U5I A;  3RVX A;  2BDL A;  2AS8 A;  5K16 A;  2DCC A;  1QDQ A;  1MEG A;  9PAP A;  1JQP A;  2Y6E A;  1EWM A;  5PAD A;  1AYU A;  2DC6 A;  5JH3 A;  1ME3 A;  2ARY A;  3ZUA A;  3E1Z B;  4AXL A;  4BPV A;  3HD3 A;  3WXE A;  4I04 A;  2DZY A;  4Q8G A;  1MEM A;  3OIS A;  3PNR A;  2XU5 A;  3DF0 A;  3MTN A;  1U9W A;  4YYR A;  1TU6 A;  1CVZ A;  3N4C A;  4KLB A;  3OF9 A;  3BPM A;  3CH2 X;  3PBH A;  1CPJ A;  1IWD A;  2G8J A;  4PP2 E;  2P7U A;  1KHP A;  1PPN A;  3TNX A;  3U8E A;  3WXF A;  1HUC B;  2PAD A;  2HHN A;  1O0E A;  4BQV A;  3OF8 A;  2NQI A;  2FRA A;  1THE A;  3LFY A;  4PAD A;  2JQG R;  2R6N A;  1ICF A;  2H7J A;  4YYV A;  1TL9 A;  1Y4H A;  2AUX A;  1GCB A;  1PBH A;  3KW9 A;  1F2B A;  1TLO A;  2G8E A;  1XKG A;  3P5U A;  2E01 A;  2OUL A;  1NLJ A;  2G7Y A;  2FYE A;  4DMY A;  5F02 A;  1FH0 A;  2YJ2 A;  1A6R A;  1ZIV A;  1GEC E;  2GFO A;  4X6I A;  1PPP A;  2WBF X;  1NQC A;  4AXM A;  2P0R A;  4RY2 A;  4CDF B;  3OVZ A;  4MSX A;  4XUI A;  2B1N A;  4BS6 A;  4OEL A;  2AVW A;  3BWK A;  2DC8 A;  2AYO A;  2B1M A;  3F5V A;  1CS8 A;  2PNS A;  2HH5 A;  4OEM A;  3P5X A;  1VSN A;  3RVW A;  4N4Z A;  4QRV A;  4FK5 A;  2XU1 A;  2OP3 A;  2NQG A;  1KHQ A;  1QOL A;  7PCK A;  4QH6 A;  3HWN A;  3O0U A;  4N8W A;  5CHV A;  1YVB A;  1BGO A;  3S3R A;  3P5V A;  5EGW A;  3KSE A;  3D6S A;  3ERV A;  3K24 A;  4P6E A;  4W5C A;  3BPF A;  2YJ9 A;  2YJB A;  4PI3 A;  5CVM A;  1U9X A;  2R9F A;  2PRE A;  2YJC A;  2FUD A;  1CV8 A;  3C9E A;  3K9M A;  1AU0 A;  2O6X A;  1AEC A;  1NB3 A;  3NHE A;  3QSD A;  3KFQ A;  2R9C A;  1PE6 A;  2ACT A;  5J94 A;  3WXG A;  2NQA A;  2R9O A;  4HWY A;  4XR7 A;  3I06 A;  2ATO A;  2E02 A;  3KWB X;  2DZZ A;  1DEU A;  2P86 A;  2XU4 A;  1AU3 A;  4X6H A;  3O1G A;  3BCN A;  1PCI A;  1DF0 A;  1BP4 A;  1BQI A;  3CBK A;  2DCA A;  1GLO A;  1AIM A;  2GHU A;  1U9V A;  3N3G A;  2PBH A;  1PPO A;  2OZ2 A;  4WA6 A;  1AU2 A;  2E00 A;  3KKU A;  4N79 A;  4Q8H A;  2AU1 A;  2DCB A;  1X9Y A;  2BDZ A;  1Y08 A;  4YYS A;  4CDD B;  1EWP A;  1MS6 A;  1Q6K A;  3PDF A;  4W4U A;  3RVV A;  4X6J A;  2AIM A;  1NB5 A;  1QXP A;  1M6D A;  3H8B A;  2NQD B;  1EWL A;  4CDC B;  5CVO B;  4FIP A;  2FTD A;  3KWZ A;  3CBJ A;  3P5W A;  1PAD A;  3V6E A;  1F2A A;  4P6G A;  1MIR A;  1KFX L;  3HHA A;  2HXZ A;  1K3B B;  4W5B A;  1F2C A;  1F29 A;  3B79 A;  2JQF R;  2F1G A;  4QBB A;  1AYW A;  1ZCM A;  4MZO A;  1AYV A;  3CH3 X;  4YV8 A;  1QMY A;  3GCB A;  1PXV A;  1S4V A;  1KXR A;  8PCH A;  2C0Y A;  4PP1 A;  3IV2 A;  3BOW A;  3HHI A;  4K7C A;  4I05 A;  1STF E;  1POP A;  2Y5B A;  1SNK A;  1YK8 A;  3H7D A;  5EF4 A;  3IOQ A;  5A24 A;  1U9Q X;  2FQ9 A;  2R9M A;  2R9N A;  3H6S A;  3QT4 A;  5JA7 A;  1EF7 A;  5CHT A;  1AU4 A;  1CJL A;  1NPZ A;  4FJC A;  2IBI A;  3PW3 A;  3I3T A;  2G6D A;  1ITO A;  1MHW A;  4YVA A;  2CB5 A;  2VHF A;  4YYQ A;  1PPD A;  1KFU L;  2IPP B;  1CQD A;  1CTE A;  2DCD A;  4ZUX U;  5FPW A;  1VJV A;  4QRX A;  1PIP A;  4CZW A;  3K8U A;  3N3K A;  3MHH A;  3OVX A;  2YJ8 A;  4I07 A;  2DJG B;  2CIO A;  1CSB B;  2FT2 A;  3H8C A;  3MOR A;  1EWO A;  3S3Q A;  3KX1 A;  1CB5 A;  4MZS A;  3IUT A;  1MDW A;  2F7D A;  3H89 A;  1NL6 A;  4YYU A;  2E03 A;  5CVN B;  4BSQ A;  3IMA A;  2XU3 A;  3AI8 A;  3V6C A;  4DMX A;  2HD5 A;  1YT7 A;  2FO5 A;  3F75 A;  4QRG A; 
#chains in the Genus database with same CATH topology
 4CDE B;  4BOS A;  3LXS A;  3W30 A;  1YZB A;  3BC3 A;  1ME4 A;  1SP4 B;  3USV A;  5KO3 A;  2FRQ A;  1YK7 A;  3M99 A;  2VHS A;  3QJ3 A;  2AYN A;  2BU3 A;  2AUZ A;  2DC7 A;  4D8B A;  4XZX A;  3MHS A;  4OVZ A;  4R3D A;  4YYW A;  4G54 A;  1YAL A;  6PAD A;  3IHP A;  1GMY A;  3IEJ A;  4BS5 A;  3MTV A;  1ATK A;  2DC9 A;  1BY8 A;  2DJF B;  1U5I A;  3RVX A;  2BDL A;  2AS8 A;  5K16 A;  2DCC A;  1QDQ A;  1MEG A;  9PAP A;  1JQP A;  2Y6E A;  1EWM A;  3BBA A;  1AYU A;  5PAD A;  2DC6 A;  3PRM A;  5JH3 A;  1ME3 A;  3PT2 A;  4D8E A;  2ARY A;  3TRK A;  3ZUA A;  3E1Z B;  4AXL A;  4BPV A;  4RF0 A;  3HD3 A;  3WXE A;  4I04 A;  2DZY A;  4Q8G A;  1MEM A;  3OIS A;  3PNR A;  2XU5 A;  3DF0 A;  4HXD B;  3MTN A;  4OVZ B;  1U9W A;  4YYR A;  1TU6 A;  1CVZ A;  3N4C A;  4KLB A;  3OF9 A;  3BPM A;  3CH2 X;  3PBH A;  5E6J A;  1CPJ A;  4PT5 A;  1IWD A;  3ZNH A;  2G8J A;  4PP2 E;  2P7U A;  1KHP A;  1PPN A;  3TNX A;  4BOZ A;  3U8E A;  3WXF A;  1HUC B;  2PAD A;  2HHN A;  1O0E A;  4BQV A;  3OF8 A;  2NQI A;  2FRA A;  1THE A;  3LFY A;  4PAD A;  2JQG R;  2R6N A;  1ICF A;  2H7J A;  4YYV A;  3RNV A;  2JTC A;  4BOU A;  1TL9 A;  2Z84 A;  2JRI A;  1Y4H A;  2AUX A;  1GCB A;  4RKX A;  1PBH A;  3KW9 A;  1F2B A;  1TLO A;  1UKF A;  2G8E A;  1XKG A;  3MJ5 A;  3P5U A;  2E01 A;  2OUL A;  2J7Q C;  1NLJ A;  2G7Y A;  2FYE A;  4D8I A;  4DMY A;  5F02 A;  3PHU A;  1FH0 A;  2YJ2 A;  1A6R A;  1ZIV A;  1GEC E;  2GFO A;  4IUM A;  4X6I A;  1PPP A;  2WBF X;  1NQC A;  4AXM A;  1PVJ A;  3E9S A;  2P0R A;  4RY2 A;  4CDF B;  3OVZ A;  4MSX A;  4XUI A;  2B1N A;  4BS6 A;  4OEL A;  2AVW A;  1DKI A;  3BWK A;  2DC8 A;  2AYO A;  2B1M A;  3F5V A;  1CS8 A;  2PNS A;  2HH5 A;  4OEM A;  3P5X A;  1VSN A;  3RVW A;  4N4Z A;  4QRV A;  4BOP A;  4BOQ A;  4FK5 A;  2XU1 A;  2OP3 A;  2NQG A;  1KHQ A;  1QOL A;  3TMP A;  7PCK A;  4QH6 A;  3HWN A;  3O0U A;  4MM3 B;  4N8W A;  5CHV A;  1YVB A;  4RNA A;  1BGO A;  3S3R A;  3P5V A;  3MP2 A;  5EGW A;  3PSE A;  3KSE A;  3D6S A;  3ERV A;  3K24 A;  4P6E A;  4W5C A;  3BPF A;  2YJ9 A;  4IP3 A;  2YJB A;  4PI3 A;  5CVM A;  3C0R A;  1U9X A;  2R9F A;  2PRE A;  2YJC A;  2FUD A;  1CV8 A;  3C9E A;  3K9M A;  1AU0 A;  2O6X A;  1AEC A;  1NB3 A;  4P16 A;  3NHE A;  3QSD A;  3KFQ A;  2R9C A;  3BB7 A;  1PE6 A;  3BY4 A;  2ACT A;  5J94 A;  3WXG A;  2NQA A;  2R9O A;  4HWY A;  2DOS A;  4XR7 A;  3I06 A;  2FE8 A;  2ATO A;  2E02 A;  3IFU A;  3PHX A;  3KWB X;  2DZZ A;  1DEU A;  2P86 A;  2XU4 A;  1AU3 A;  4X6H A;  3O1G A;  3BCN A;  1PCI A;  1DF0 A;  2UZJ A;  4OW0 A;  1BP4 A;  1BQI A;  5JZE A;  3CBK A;  2DCA A;  1GLO A;  1AIM A;  2GHU A;  3B21 A;  1U9V A;  3N3G A;  2PBH A;  3W31 A;  3O65 A;  1PPO A;  2OZ2 A;  4WA6 A;  1AU2 A;  2BTW B;  2E00 A;  3KKU A;  5EZQ A;  4N79 A;  4Q8H A;  2AU1 A;  2DCB A;  1X9Y A;  4GUA A;  2BDZ A;  1Y08 A;  4YYS A;  4RF1 A;  4CDD B;  1EWP A;  1MS6 A;  1Q6K A;  3PDF A;  4W4U A;  3RVV A;  4X6J A;  4A5U A;  2AIM A;  4MI7 A;  1NB5 A;  1QXP A;  1M6D A;  3H8B A;  2NQD B;  1EWL A;  4CDC B;  5CVO B;  4FIP A;  2FTD A;  3KWZ A;  3CBJ A;  3P5W A;  1PAD A;  3V6E A;  1F2A A;  4P6G A;  1MIR A;  1KFX L;  3HHA A;  2HXZ A;  1K3B B;  4W5B A;  1F2C A;  1F29 A;  3B79 A;  2JQF R;  2F1G A;  1AYW A;  4QBB A;  1ZCM A;  4MZO A;  2AGA A;  1AYV A;  3CH3 X;  4YV8 A;  1QMY A;  3GCB A;  1PXV A;  1S4V A;  1KXR A;  4ZTB A;  8PCH A;  2C0Y A;  5EZS A;  4PP1 A;  2J7Q A;  3IV2 A;  3PHW A;  3BOW A;  3HHI A;  4K7C A;  4I05 A;  1STF E;  1POP A;  2Y5B A;  1SNK A;  1YK8 A;  3H7D A;  5EF4 A;  3IOQ A;  5A24 A;  1U9Q X;  2BTW A;  2FQ9 A;  2R9M A;  2R9N A;  3H6S A;  3QT4 A;  5JA7 A;  1EF7 A;  2HWK A;  5CHT A;  1AU4 A;  1CJL A;  1NPZ A;  4M0W A;  4FJC A;  2IBI A;  3PRP A;  3PW3 A;  3I3T A;  2G6D A;  1ITO A;  1MHW A;  4YVA A;  2CB5 A;  2VHF A;  4YYQ A;  1PPD A;  1KFU L;  2IPP B;  1CQD A;  1CTE A;  2DCD A;  4ZUX U;  5FPW A;  1VJV A;  4QRX A;  1PIP A;  4CZW A;  3K8U A;  3N3K A;  3MHH A;  3OVX A;  2YJ8 A;  4I07 A;  2DJG B;  4REZ A;  2CIO A;  1CSB B;  2FT2 A;  3H8C A;  3MOR A;  1EWO A;  4WUR A;  3S3Q A;  3KX1 A;  1CB5 A;  4MZS A;  3IUT A;  1MDW A;  2F7D A;  3H89 A;  1NL6 A;  4YYU A;  2E03 A;  5CVN B;  3OQC A;  3IMA A;  2XU3 A;  4BSQ A;  3AI8 A;  3V6C A;  4DMX A;  2HD5 A;  1YT7 A;  2FO5 A;  3F75 A;  4QRG A; 
#chains in the Genus database with same CATH homology
 4CDE B;  3LXS A;  3BC3 A;  1ME4 A;  1SP4 B;  3USV A;  2FRQ A;  1YK7 A;  3M99 A;  2VHS A;  3QJ3 A;  2AYN A;  2AUZ A;  2DC7 A;  3MHS A;  4YYW A;  4G54 A;  1YAL A;  6PAD A;  3IHP A;  1GMY A;  3IEJ A;  4BS5 A;  1ATK A;  2DC9 A;  1BY8 A;  2DJF B;  1U5I A;  3RVX A;  2BDL A;  2AS8 A;  5K16 A;  2DCC A;  1QDQ A;  1W4T A;  1MEG A;  9PAP A;  1JQP A;  2Y6E A;  1EWM A;  5PAD A;  1AYU A;  4B55 A;  2DC6 A;  4BGF A;  5JH3 A;  1ME3 A;  2ARY A;  3ZUA A;  3E1Z B;  4AXL A;  4BPV A;  3HD3 A;  3WXE A;  4I04 A;  2DZY A;  4Q8G A;  1MEM A;  3OIS A;  3PNR A;  2XU5 A;  3DF0 A;  3MTN A;  1U9W A;  4YYR A;  1TU6 A;  1CVZ A;  3N4C A;  4KLB A;  3OF9 A;  3BPM A;  3CH2 X;  3PBH A;  1CPJ A;  1IWD A;  2G8J A;  4PP2 E;  2P7U A;  1KHP A;  1PPN A;  3TNX A;  1W5R A;  3U8E A;  3WXF A;  1HUC B;  2PAD A;  2HHN A;  1O0E A;  4BQV A;  3OF8 A;  2NQI A;  2FRA A;  1THE A;  3LFY A;  4PAD A;  2JQG R;  2R6N A;  1ICF A;  2H7J A;  4YYV A;  1TL9 A;  1Y4H A;  4GUZ A;  2AUX A;  1GCB A;  1PBH A;  3KW9 A;  1F2B A;  1TLO A;  2G8E A;  3LTW A;  1XKG A;  3P5U A;  2E01 A;  2OUL A;  1NLJ A;  2G7Y A;  2FYE A;  4DMY A;  5F02 A;  1FH0 A;  2YJ2 A;  1A6R A;  1ZIV A;  1GEC E;  2GFO A;  4X6I A;  1PPP A;  2WBF X;  1NQC A;  4AXM A;  2P0R A;  4RY2 A;  4CDF B;  3OVZ A;  4MSX A;  4XUI A;  4NV8 A;  2B1N A;  4BS6 A;  4OEL A;  2AVW A;  3BWK A;  2DC8 A;  2AYO A;  2B1M A;  3F5V A;  1CS8 A;  2PNS A;  2HH5 A;  4OEM A;  3P5X A;  1VSN A;  3RVW A;  4N4Z A;  4QRV A;  4FK5 A;  2XU1 A;  2OP3 A;  2NQG A;  1KHQ A;  1QOL A;  7PCK A;  4QH6 A;  3HWN A;  3O0U A;  4N8W A;  5CHV A;  1YVB A;  2VFC A;  1BGO A;  3S3R A;  3P5V A;  5EGW A;  3KSE A;  3D6S A;  3ERV A;  3K24 A;  4P6E A;  4W5C A;  3BPF A;  2YJ9 A;  2YJB A;  4PI3 A;  5CVM A;  1U9X A;  2R9F A;  2PRE A;  2YJC A;  2FUD A;  1CV8 A;  3C9E A;  3K9M A;  1AU0 A;  2O6X A;  1AEC A;  1NB3 A;  3NHE A;  3QSD A;  3KFQ A;  2R9C A;  1PE6 A;  1W6F A;  2ACT A;  5J94 A;  3WXG A;  2NQA A;  2R9O A;  4HWY A;  4XR7 A;  3I06 A;  2ATO A;  2E02 A;  3KWB X;  2DZZ A;  4NV7 A;  1DEU A;  2P86 A;  2XU4 A;  1AU3 A;  4X6H A;  3O1G A;  3BCN A;  1PCI A;  1DF0 A;  1BP4 A;  1BQI A;  3CBK A;  2DCA A;  1GLO A;  1AIM A;  2GHU A;  1U9V A;  3N3G A;  2PBH A;  1PPO A;  2OZ2 A;  4WA6 A;  1AU2 A;  2E00 A;  3KKU A;  4N79 A;  4Q8H A;  2AU1 A;  2DCB A;  1X9Y A;  2BDZ A;  1Y08 A;  4YYS A;  4CDD B;  1EWP A;  1MS6 A;  1Q6K A;  3PDF A;  4W4U A;  3RVV A;  4X6J A;  2AIM A;  1NB5 A;  1QXP A;  1M6D A;  3H8B A;  2NQD B;  1EWL A;  4CDC B;  5CVO B;  4FIP A;  2FTD A;  3KWZ A;  3CBJ A;  3P5W A;  1PAD A;  3V6E A;  1F2A A;  4P6G A;  1MIR A;  1KFX L;  3HHA A;  2HXZ A;  1K3B B;  4W5B A;  1F2C A;  1F29 A;  3B79 A;  2JQF R;  2F1G A;  3D9W A;  4QBB A;  1AYW A;  1ZCM A;  1GX3 A;  4MZO A;  1AYV A;  3CH3 X;  4YV8 A;  1QMY A;  3GCB A;  1PXV A;  1S4V A;  1KXR A;  4C5P A;  8PCH A;  2C0Y A;  4PP1 A;  3IV2 A;  3BOW A;  3HHI A;  4K7C A;  4I05 A;  1STF E;  1POP A;  2Y5B A;  1SNK A;  1YK8 A;  3H7D A;  5EF4 A;  3IOQ A;  5A24 A;  1U9Q X;  2FQ9 A;  2R9M A;  2R9N A;  3H6S A;  3QT4 A;  5JA7 A;  1EF7 A;  5CHT A;  1AU4 A;  1CJL A;  1NPZ A;  4FJC A;  2IBI A;  3PW3 A;  3I3T A;  2G6D A;  1ITO A;  1MHW A;  4YVA A;  2CB5 A;  2VHF A;  4YYQ A;  1PPD A;  1KFU L;  2VFB A;  2IPP B;  1CQD A;  1CTE A;  2DCD A;  4ZUX U;  5FPW A;  1VJV A;  4QRX A;  1PIP A;  4CZW A;  3K8U A;  2BSZ A;  3N3K A;  3MHH A;  3OVX A;  2YJ8 A;  4I07 A;  2DJG B;  2CIO A;  1CSB B;  2FT2 A;  3H8C A;  3MOR A;  1EWO A;  3S3Q A;  3KX1 A;  1CB5 A;  4MZS A;  3IUT A;  1MDW A;  2F7D A;  3H89 A;  1NL6 A;  4YYU A;  2E03 A;  5CVN B;  4BSQ A;  3IMA A;  2XU3 A;  3AI8 A;  3V6C A;  4DMX A;  2HD5 A;  1YT7 A;  2FO5 A;  1E2T A;  3F75 A;  4QRG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...