2NQAA

Catalytic domain of human calpain 8
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
320
structure length
305
Chain Sequence
NALKYLGQDFKTLRQQCLDSGVLFKDPEFPAPSALGYTQGIIWKRPTELPSPQFIVGGATRTDIQGGLGDCWLLAAIASLTLNEELLYRVVPRDQDFQENYAGIFHFQFWQYGEWVEVVIDDRLPTKNGQLLFLHSEQGNEFWSALLEKAYAKLNGYEALAGGSTVEGFEDFTGGISEFYDLKKPPANLYQIIRKALAGSLLGCSIDVYSAAEAEAITSQKLVKSHAYSVTGVEEVNFQGHPEKLIRLRNPWGEEWSGAWSDDAPEWNHIDPRRKEELDKKVEDGEFWMSLSDFVRQFSRLEICN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Calpain 8
publication title Structure of Human Calpain 8
rcsb
source organism Homo sapiens
total genus 76
structure length 305
sequence length 320
chains with identical sequence B
ec nomenclature ec 3.4.22.53: Calpain-2.
pdb deposition date 2006-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00648 Peptidase_C2 Calpain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2nqaA02
3I3TA 3IHPA 1U9XA 2AUXA 3V6CA 1AYUA 2VHSA 3HD3A 1CTEA 2DZZA 2XU4A 3ERVA 1YT7A 3D6SA 1QMYA 3QT4A 4W5BA 5CVOB 5JA7A 3KX1A 2FO5A 1PCIA 3H8BA 4DMYA 2R9CA 4Q8HA 4CDFB 2OULA 3P5UA 2NQAA 2AVWA 1QDQA 4FIPA 1A6RA 1IWDA 5F02A 1PPPA 1AECA 4W5CA 1EWPA 4YYUA 4X6HA 3F75A 2FRQA 2DC9A 3PBHA 4BS6A 2G7YA 3LXSA 1PPNA 4MZSA 1AYWA 3MHSA 1X9YA 2DZYA 4YVAA 2AYNA 1GCBA 5CVMA 1ME3A 3HHIA 1QXPA 4G54A 4YYQA 4BS5A 4X6IA 3N3GA 4CZWA 1GECE 2OZ2A 3CH3X 2YJ2A 4N79A 1GMYA 2R9OA 9PAPA 1F29A 2ACTA 5CHVA 1F2BA 4P6EA 2O6XA 1BP4A 1YK8A 1ATKA 3LFYA 2FQ9A 1QOLA 3PNRA 2ARYA 3RVVA 2VHFA 1Q6KA 2R6NA 1VSNA 4BQVA 3QSDA 4MZOA 6PADA 2PREA 3K24A 4QBBA 1AU2A 3RVXA 2NQDB 1JQPA 2AU1A 4YYWA 2XU5A 2R9MA 1TLOA 2E03A 4YYVA 3RVWA 2AIMA 3E1ZB 1CSBB 4QRGA 1SNKA 3IUTA 3V6EA 1HUCB 2AUZA 2R9FA 3IEJA 2YJCA 3H6SA 1MEMA 1PADA 2B1NA 2DJFB 1TU6A 1PIPA 2DCBA 4FK5A 1SP4B 1VJVA 2FUDA 1Y08A 3DF0A 3OF8A 3IOQA 2DCCA 1NPZA 3H8CA 1ICFA 1YALA 1NLJA 1AYVA 2DC6A 1F2CA 1CB5A 1YK7A 3KSEA 5CVNB 1PBHA 3OF9A 3MHHA 4BPVA 3OISA 3H89A 1PPOA 3BPFA 3B79A 3C9EA 5CHTA 4OEMA 3OVXA 2NQGA 4WA6A 3IMAA 1AU3A 1ITOA 4PI3A 2E00A 2P86A 5A24A 2CB5A 2AS8A 1EWLA 1Y4HA 1KFXL 1CV8A 1THEA 2F1GA 2PADA 2DC8A 3I06A 2FT2A 2XU1A 3USVA 1GLOA 1EWOA 1DF0A 3BWKA 3HWNA 3BC3A 2FTDA 2JQGR 5FPWA 1EWMA 3AI8A 3F5VA 4I07A 1ZCMA 4YYSA 1CVZA 2CIOA 5J94A 2AYOA 3HHAA 4ZUXU 1K3BB 1KHPA 3TNXA 4CDDB 7PCKA 3N4CA 2G8JA 3P5WA 4PADA 3WXGA 2JQFR 4CDEB 3BCNA 4W4UA 2BDZA 4QRXA 3CH2X 1NL6A 8PCHA 2PNSA 2E02A 4XUIA 2GFOA 4BSQA 2Y6EA 1O0EA 5K16A 3M99A 1BQIA 2YJ8A 2G6DA 1FH0A 2F7DA 5JH3A 4PP2E 1YVBA 3OVZA 2C0YA 4N8WA 3H7DA 2P7UA 3KFQA 4RY2A 1U5IA 1NB5A 1CJLA 1AIMA 4I04A 4QRVA 2H7JA 2R9NA 1CS8A 3ZUAA 2HHNA 3QJ3A 1NQCA 3P5VA 3P5XA 4KLBA 1PXVA 1PPDA 4Q8GA 2E01A 2WBFX 3BOWA 4DMXA 3NHEA 4K7CA 4AXLA 3S3QA 1S4VA 3PW3A 1XKGA 2IBIA 1BGOA 3WXEA 5EF4A 2G8EA 3KW9A 1MDWA 3KWZA 1F2AA 1MIRA 2B1MA 4N4ZA 3O0UA 2NQIA 3KWBX 3N3KA 1BY8A 4MSXA 1MS6A 2HXZA 4FJCA 2OP3A 3IV2A 2Y5BA 1MHWA 1M6DA 1AU4A 1U9VA 1U9QX 4AXMA 2DCDA 2FRAA 1DEUA 5EGWA 4HWYA 1CQDA 3K9MA 1PE6A 3U8EA 4YYRA 1KXRA 1POPA 4P6GA 2DC7A 4XR7A 2BDLA 4CDCB 3BPMA 1MEGA 3CBJA 4QH6A 2P0RA 2XU3A 2DCAA 3S3RA 1EF7A 2GHUA 2YJ9A 2HD5A 1ZIVA 3WXFA 3GCBA 4X6JA 1TL9A 1KHQA 3PDFA 2IPPB 3KKUA 1ME4A 4YV8A 3CBKA 3K8UA 1U9WA 3O1GA 4OELA 2FYEA 1NB3A 4I05A 1STFE 4PP1A 1CPJA 2DJGB 3MTNA 1AU0A 2HH5A 2PBHA 2ATOA 2YJBA 1KFUL 5PADA 3MORA
chains in the Genus database with same CATH superfamily
3I3TA 3IHPA 1U9XA 2J7QC 2AUXA 3V6CA 1AYUA 2VHSA 3HD3A 1CTEA 4HXDB 2DZZA 2XU4A 3ERVA 1YT7A 3D6SA 1QMYA 3QT4A 4W5BA 5CVOB 5JA7A 3KX1A 2FO5A 1PCIA 3H8BA 3PHUA 3PSEA 4A5UA 4OW0A 2BU3A 4DMYA 2R9CA 4Q8HA 4CDFB 2OULA 3P5UA 2NQAA 2AVWA 1QDQA 4FIPA 1A6RA 1IWDA 5F02A 3TMPA 1PPPA 3W31A 1AECA 4W5CA 1EWPA 4YYUA 4X6HA 3F75A 2FRQA 3O65A 2DC9A 3PBHA 5EZQA 4BS6A 2G7YA 5JZEA 3LXSA 1PPNA 4MZSA 1AYWA 3MHSA 1X9YA 2DZYA 2FE8A 4YVAA 4RF1A 4BOUA 2AYNA 1GCBA 5CVMA 2BTWB 4OVZA 1ME3A 3HHIA 1QXPA 4G54A 2DOSA 4YYQA 4BS5A 4X6IA 3N3GA 4BOPA 4CZWA 1GECE 2OZ2A 3CH3X 2YJ2A 3PRMA 4N79A 1GMYA 2R9OA 9PAPA 1F29A 2ACTA 5CHVA 1F2BA 4P6EA 2O6XA 1BP4A 1YK8A 1ATKA 5E6JA 3LFYA 2FQ9A 1QOLA 3PNRA 2ARYA 3IFUA 3RVVA 2Z84A 2VHFA 4D8IA 1Q6KA 2R6NA 1VSNA 4BQVA 3QSDA 4MZOA 6PADA 2PREA 3K24A 4QBBA 1AU2A 3RVXA 2NQDB 1JQPA 2AU1A 4YYWA 2XU5A 4IP3A 4IUMA 2R9MA 1TLOA 2E03A 4YYVA 3RVWA 2AIMA 3E1ZB 1CSBB 4QRGA 1SNKA 3IUTA 3V6EA 1HUCB 2AUZA 2R9FA 3IEJA 2YJCA 2J7QA 3H6SA 1MEMA 1PADA 2B1NA 2DJFB 1TU6A 1PIPA 2DCBA 2AGAA 4FK5A 1SP4B 1VJVA 2FUDA 1Y08A 3DF0A 3OF8A 3IOQA 3PT2A 2DCCA 1NPZA 3H8CA 1ICFA 1YALA 1NLJA 1AYVA 2DC6A 1F2CA 1CB5A 1YK7A 3KSEA 5CVNB 4WURA 1PVJA 1PBHA 3MP2A 3OF9A 3MHHA 4BPVA 3OISA 3H89A 1PPOA 3BPFA 3B79A 3C9EA 5CHTA 4OEMA 3OVXA 2NQGA 4WA6A 3IMAA 1AU3A 1ITOA 4PI3A 2E00A 2P86A 5A24A 2CB5A 2AS8A 1EWLA 1Y4HA 1KFXL 1CV8A 1THEA 2F1GA 4GUAA 2PADA 2DC8A 3I06A 2FT2A 2XU1A 3USVA 3TRKA 1GLOA 2HWKA 3W30A 1EWOA 1DF0A 3BWKA 3HWNA 3BC3A 3C0RA 2FTDA 2JQGR 5FPWA 4BOZA 1EWMA 3AI8A 3MJ5A 3F5VA 4I07A 1ZCMA 4YYSA 1CVZA 1DKIA 2CIOA 5J94A 2AYOA 4OVZB 4RF0A 3HHAA 4ZUXU 1K3BB 1KHPA 3TNXA 4CDDB 7PCKA 3N4CA 2G8JA 4MI7A 3P5WA 4PADA 3WXGA 4XZXA 3PHXA 2JQFR 4CDEB 3BCNA 4W4UA 2BDZA 4QRXA 3CH2X 1NL6A 8PCHA 2PNSA 4REZA 4MM3B 3BBAA 2E02A 4XUIA 2GFOA 4BSQA 2Y6EA 1O0EA 5K16A 3M99A 4PT5A 3E9SA 1BQIA 2YJ8A 2G6DA 1FH0A 2F7DA 5JH3A 4PP2E 1YVBA 3OVZA 2C0YA 4N8WA 3H7DA 4R3DA 2P7UA 3KFQA 4RY2A 1U5IA 3BB7A 1NB5A 1CJLA 1AIMA 3PHWA 4I04A 4RKXA 4QRVA 2H7JA 3ZNHA 4D8EA 2R9NA 1CS8A 3ZUAA 2HHNA 3QJ3A 1NQCA 3P5VA 1UKFA 3P5XA 4KLBA 1PXVA 1PPDA 4RNAA 4Q8GA 2E01A 2WBFX 1YZBA 3BOWA 4DMXA 3NHEA 4K7CA 3BY4A 4AXLA 3S3QA 1S4VA 3PW3A 1XKGA 2IBIA 3PRPA 1BGOA 3WXEA 5EF4A 2G8EA 3KW9A 1MDWA 3KWZA 1F2AA 1MIRA 3RNVA 2B1MA 4N4ZA 4M0WA 3O0UA 2NQIA 3KWBX 3N3KA 1BY8A 4MSXA 1MS6A 2HXZA 3MTVA 4FJCA 5EZSA 2JTCA 2OP3A 3IV2A 2Y5BA 1MHWA 1M6DA 1AU4A 1U9VA 2BTWA 1U9QX 4AXMA 2DCDA 2FRAA 1DEUA 5EGWA 4HWYA 1CQDA 3K9MA 1PE6A 3U8EA 4YYRA 1KXRA 1POPA 4P6GA 2DC7A 4BOQA 4P16A 4XR7A 2BDLA 4CDCB 3BPMA 1MEGA 3CBJA 4QH6A 2P0RA 2XU3A 2DCAA 4BOSA 2UZJA 3S3RA 1EF7A 2GHUA 2YJ9A 2HD5A 1ZIVA 3WXFA 3GCBA 4X6JA 4ZTBA 2JRIA 1TL9A 1KHQA 3PDFA 2IPPB 3KKUA 1ME4A 5KO3A 4YV8A 3CBKA 3K8UA 1U9WA 3O1GA 4OELA 2FYEA 1NB3A 4I05A 1STFE 4PP1A 1CPJA 3B21A 2DJGB 3MTNA 3OQCA 4D8BA 1AU0A 2HH5A 2PBHA 2ATOA 2YJBA 1KFUL 5PADA 3MORA
chains in the Genus database with same CATH topology
3I3TA 3IHPA 1U9XA 2AUXA 3V6CA 1AYUA 2VHSA 3HD3A 1CTEA 2DZZA 2XU4A 3ERVA 1YT7A 3D6SA 1QMYA 3QT4A 4W5BA 5CVOB 5JA7A 3KX1A 2FO5A 1PCIA 3H8BA 4DMYA 2R9CA 4Q8HA 4CDFB 2OULA 3P5UA 2NQAA 2AVWA 1QDQA 4FIPA 1A6RA 1IWDA 5F02A 1PPPA 2VFCA 1W6FA 1AECA 4W5CA 1EWPA 4YYUA 4X6HA 3F75A 2FRQA 2DC9A 1E2TA 3PBHA 4BS6A 2G7YA 3LXSA 1PPNA 4MZSA 1AYWA 3MHSA 1X9YA 2DZYA 4YVAA 2AYNA 1GCBA 5CVMA 3D9WA 1ME3A 3HHIA 1QXPA 4G54A 4YYQA 4BS5A 4X6IA 1W4TA 3N3GA 4CZWA 4B55A 1GECE 2OZ2A 3CH3X 2YJ2A 4N79A 1GMYA 2R9OA 9PAPA 1F29A 2ACTA 5CHVA 1F2BA 4P6EA 2O6XA 1BP4A 1YK8A 1ATKA 3LFYA 2FQ9A 1QOLA 3PNRA 2ARYA 3RVVA 2VHFA 1Q6KA 2R6NA 1VSNA 4BQVA 3QSDA 4MZOA 6PADA 2PREA 3K24A 4QBBA 4NV8A 1AU2A 3RVXA 2NQDB 1JQPA 2AU1A 4YYWA 2XU5A 2R9MA 1TLOA 2E03A 4YYVA 3RVWA 2AIMA 3E1ZB 1CSBB 4QRGA 1SNKA 3IUTA 3V6EA 1HUCB 2AUZA 2R9FA 3IEJA 2YJCA 3H6SA 1MEMA 1PADA 2B1NA 2DJFB 1TU6A 1PIPA 2DCBA 4FK5A 1SP4B 1VJVA 2FUDA 1Y08A 3DF0A 3OF8A 3IOQA 2DCCA 1NPZA 3H8CA 1ICFA 1YALA 1NLJA 1AYVA 2DC6A 1F2CA 1CB5A 1YK7A 3KSEA 5CVNB 1PBHA 2VFBA 3OF9A 3MHHA 4BPVA 3OISA 3H89A 1PPOA 3BPFA 3B79A 3C9EA 1W5RA 5CHTA 4OEMA 3OVXA 2NQGA 4WA6A 3IMAA 1AU3A 1ITOA 4PI3A 2E00A 2P86A 5A24A 2CB5A 2AS8A 1EWLA 1Y4HA 1KFXL 1CV8A 1THEA 2F1GA 2PADA 2DC8A 3I06A 2FT2A 2XU1A 3USVA 1GLOA 1EWOA 1DF0A 3BWKA 3HWNA 3BC3A 2FTDA 2JQGR 5FPWA 1EWMA 3AI8A 3F5VA 4I07A 1ZCMA 4YYSA 1CVZA 2CIOA 5J94A 2AYOA 3HHAA 4ZUXU 1K3BB 1KHPA 3TNXA 4CDDB 7PCKA 3N4CA 2G8JA 3P5WA 4PADA 4C5PA 3WXGA 2JQFR 4CDEB 3BCNA 4W4UA 2BDZA 4QRXA 3CH2X 1NL6A 8PCHA 2PNSA 2E02A 4XUIA 2GFOA 4BSQA 2Y6EA 1O0EA 5K16A 3M99A 1BQIA 2YJ8A 2G6DA 1FH0A 2F7DA 5JH3A 4PP2E 1YVBA 3OVZA 2C0YA 4N8WA 3H7DA 2P7UA 4GUZA 3KFQA 4RY2A 1U5IA 1NB5A 1CJLA 3LTWA 1AIMA 4I04A 4QRVA 2H7JA 2R9NA 1CS8A 3ZUAA 2HHNA 3QJ3A 1NQCA 3P5VA 3P5XA 4KLBA 1PXVA 1PPDA 4Q8GA 2E01A 2WBFX 3BOWA 4DMXA 3NHEA 4K7CA 4AXLA 3S3QA 1S4VA 3PW3A 1XKGA 2IBIA 1BGOA 3WXEA 5EF4A 2G8EA 3KW9A 1MDWA 3KWZA 1F2AA 1MIRA 2B1MA 4N4ZA 3O0UA 2NQIA 3KWBX 3N3KA 1BY8A 4MSXA 1MS6A 2HXZA 4FJCA 4NV7A 2OP3A 3IV2A 2Y5BA 1MHWA 1M6DA 1AU4A 1U9VA 1U9QX 4AXMA 2DCDA 2BSZA 1DEUA 2FRAA 5EGWA 4HWYA 1CQDA 3K9MA 1PE6A 3U8EA 4YYRA 1KXRA 1POPA 4P6GA 2DC7A 4XR7A 2BDLA 4CDCB 3BPMA 1MEGA 3CBJA 4QH6A 2P0RA 2XU3A 2DCAA 3S3RA 1EF7A 2GHUA 2YJ9A 2HD5A 1ZIVA 3WXFA 3GCBA 4X6JA 1TL9A 1KHQA 3PDFA 2IPPB 3KKUA 1ME4A 4YV8A 3CBKA 3K8UA 1U9WA 3O1GA 4OELA 2FYEA 1NB3A 4I05A 1STFE 4PP1A 1CPJA 2DJGB 3MTNA 1AU0A 2HH5A 2PBHA 2ATOA 2YJBA 4BGFA 1KFUL 5PADA 1GX3A 3MORA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I3T A;  3IHP A;  1U9X A;  2AUX A;  3V6C A;  1AYU A;  2VHS A;  3HD3 A;  1CTE A;  2DZZ A;  2XU4 A;  3ERV A;  1YT7 A;  3D6S A;  1QMY A;  3QT4 A;  4W5B A;  5CVO B;  5JA7 A;  3KX1 A;  2FO5 A;  1PCI A;  3H8B A;  4DMY A;  2R9C A;  4Q8H A;  4CDF B;  2OUL A;  3P5U A;  2NQA A;  2AVW A;  1QDQ A;  4FIP A;  1A6R A;  1IWD A;  5F02 A;  1PPP A;  1AEC A;  4W5C A;  1EWP A;  4YYU A;  4X6H A;  3F75 A;  2FRQ A;  2DC9 A;  3PBH A;  4BS6 A;  2G7Y A;  3LXS A;  1PPN A;  4MZS A;  1AYW A;  3MHS A;  1X9Y A;  2DZY A;  4YVA A;  2AYN A;  1GCB A;  5CVM A;  1ME3 A;  3HHI A;  1QXP A;  4G54 A;  4YYQ A;  4BS5 A;  4X6I A;  3N3G A;  4CZW A;  1GEC E;  2OZ2 A;  3CH3 X;  2YJ2 A;  4N79 A;  1GMY A;  2R9O A;  9PAP A;  1F29 A;  2ACT A;  5CHV A;  1F2B A;  4P6E A;  2O6X A;  1BP4 A;  1YK8 A;  1ATK A;  3LFY A;  2FQ9 A;  1QOL A;  3PNR A;  2ARY A;  3RVV A;  2VHF A;  1Q6K A;  2R6N A;  1VSN A;  4BQV A;  3QSD A;  4MZO A;  6PAD A;  2PRE A;  3K24 A;  4QBB A;  1AU2 A;  3RVX A;  2NQD B;  1JQP A;  2AU1 A;  4YYW A;  2XU5 A;  2R9M A;  1TLO A;  2E03 A;  4YYV A;  3RVW A;  2AIM A;  3E1Z B;  1CSB B;  4QRG A;  1SNK A;  3IUT A;  3V6E A;  1HUC B;  2AUZ A;  2R9F A;  3IEJ A;  2YJC A;  3H6S A;  1MEM A;  1PAD A;  2B1N A;  2DJF B;  1TU6 A;  1PIP A;  2DCB A;  4FK5 A;  1SP4 B;  1VJV A;  2FUD A;  1Y08 A;  3DF0 A;  3OF8 A;  3IOQ A;  2DCC A;  1NPZ A;  3H8C A;  1ICF A;  1YAL A;  1NLJ A;  1AYV A;  2DC6 A;  1F2C A;  1CB5 A;  1YK7 A;  3KSE A;  5CVN B;  1PBH A;  3OF9 A;  3MHH A;  4BPV A;  3OIS A;  3H89 A;  1PPO A;  3BPF A;  3B79 A;  3C9E A;  5CHT A;  4OEM A;  3OVX A;  2NQG A;  4WA6 A;  3IMA A;  1AU3 A;  1ITO A;  4PI3 A;  2E00 A;  2P86 A;  5A24 A;  2CB5 A;  2AS8 A;  1EWL A;  1Y4H A;  1KFX L;  1CV8 A;  1THE A;  2F1G A;  2PAD A;  2DC8 A;  3I06 A;  2FT2 A;  2XU1 A;  3USV A;  1GLO A;  1EWO A;  1DF0 A;  3BWK A;  3HWN A;  3BC3 A;  2FTD A;  2JQG R;  5FPW A;  1EWM A;  3AI8 A;  3F5V A;  4I07 A;  1ZCM A;  4YYS A;  1CVZ A;  2CIO A;  5J94 A;  2AYO A;  3HHA A;  4ZUX U;  1K3B B;  1KHP A;  3TNX A;  4CDD B;  7PCK A;  3N4C A;  2G8J A;  3P5W A;  4PAD A;  3WXG A;  2JQF R;  4CDE B;  3BCN A;  4W4U A;  2BDZ A;  4QRX A;  3CH2 X;  1NL6 A;  8PCH A;  2PNS A;  2E02 A;  4XUI A;  2GFO A;  4BSQ A;  2Y6E A;  1O0E A;  5K16 A;  3M99 A;  1BQI A;  2YJ8 A;  2G6D A;  1FH0 A;  2F7D A;  5JH3 A;  4PP2 E;  1YVB A;  3OVZ A;  2C0Y A;  4N8W A;  3H7D A;  2P7U A;  3KFQ A;  4RY2 A;  1U5I A;  1NB5 A;  1CJL A;  1AIM A;  4I04 A;  4QRV A;  2H7J A;  2R9N A;  1CS8 A;  3ZUA A;  2HHN A;  3QJ3 A;  1NQC A;  3P5V A;  3P5X A;  4KLB A;  1PXV A;  1PPD A;  4Q8G A;  2E01 A;  2WBF X;  3BOW A;  4DMX A;  3NHE A;  4K7C A;  4AXL A;  3S3Q A;  1S4V A;  3PW3 A;  1XKG A;  2IBI A;  1BGO A;  3WXE A;  5EF4 A;  2G8E A;  3KW9 A;  1MDW A;  3KWZ A;  1F2A A;  1MIR A;  2B1M A;  4N4Z A;  3O0U A;  2NQI A;  3KWB X;  3N3K A;  1BY8 A;  4MSX A;  1MS6 A;  2HXZ A;  4FJC A;  2OP3 A;  3IV2 A;  2Y5B A;  1MHW A;  1M6D A;  1AU4 A;  1U9V A;  1U9Q X;  4AXM A;  2DCD A;  2FRA A;  1DEU A;  5EGW A;  4HWY A;  1CQD A;  3K9M A;  1PE6 A;  3U8E A;  4YYR A;  1KXR A;  1POP A;  4P6G A;  2DC7 A;  4XR7 A;  2BDL A;  4CDC B;  3BPM A;  1MEG A;  3CBJ A;  4QH6 A;  2P0R A;  2XU3 A;  2DCA A;  3S3R A;  1EF7 A;  2GHU A;  2YJ9 A;  2HD5 A;  1ZIV A;  3WXF A;  3GCB A;  4X6J A;  1TL9 A;  1KHQ A;  3PDF A;  2IPP B;  3KKU A;  1ME4 A;  4YV8 A;  3CBK A;  3K8U A;  1U9W A;  3O1G A;  4OEL A;  2FYE A;  1NB3 A;  4I05 A;  1STF E;  4PP1 A;  1CPJ A;  2DJG B;  3MTN A;  1AU0 A;  2HH5 A;  2PBH A;  2ATO A;  2YJB A;  1KFU L;  5PAD A;  3MOR A; 
#chains in the Genus database with same CATH topology
 3I3T A;  3IHP A;  1U9X A;  2J7Q C;  2AUX A;  3V6C A;  1AYU A;  2VHS A;  3HD3 A;  1CTE A;  4HXD B;  2DZZ A;  2XU4 A;  3ERV A;  1YT7 A;  3D6S A;  1QMY A;  3QT4 A;  4W5B A;  5CVO B;  5JA7 A;  3KX1 A;  2FO5 A;  1PCI A;  3H8B A;  3PHU A;  3PSE A;  4A5U A;  4OW0 A;  2BU3 A;  4DMY A;  2R9C A;  4Q8H A;  4CDF B;  2OUL A;  3P5U A;  2NQA A;  2AVW A;  1QDQ A;  4FIP A;  1A6R A;  1IWD A;  5F02 A;  3TMP A;  1PPP A;  3W31 A;  1AEC A;  4W5C A;  1EWP A;  4YYU A;  4X6H A;  3F75 A;  2FRQ A;  3O65 A;  2DC9 A;  3PBH A;  5EZQ A;  4BS6 A;  2G7Y A;  5JZE A;  3LXS A;  1PPN A;  4MZS A;  1AYW A;  3MHS A;  1X9Y A;  2DZY A;  2FE8 A;  4YVA A;  4RF1 A;  4BOU A;  2AYN A;  1GCB A;  5CVM A;  2BTW B;  4OVZ A;  1ME3 A;  3HHI A;  1QXP A;  4G54 A;  2DOS A;  4YYQ A;  4BS5 A;  4X6I A;  3N3G A;  4BOP A;  4CZW A;  1GEC E;  2OZ2 A;  3CH3 X;  2YJ2 A;  3PRM A;  4N79 A;  1GMY A;  2R9O A;  9PAP A;  1F29 A;  2ACT A;  5CHV A;  1F2B A;  4P6E A;  2O6X A;  1BP4 A;  1YK8 A;  1ATK A;  5E6J A;  3LFY A;  2FQ9 A;  1QOL A;  3PNR A;  2ARY A;  3IFU A;  3RVV A;  2Z84 A;  2VHF A;  4D8I A;  1Q6K A;  2R6N A;  1VSN A;  4BQV A;  3QSD A;  4MZO A;  6PAD A;  2PRE A;  3K24 A;  4QBB A;  1AU2 A;  3RVX A;  2NQD B;  1JQP A;  2AU1 A;  4YYW A;  2XU5 A;  4IP3 A;  4IUM A;  2R9M A;  1TLO A;  2E03 A;  4YYV A;  3RVW A;  2AIM A;  3E1Z B;  1CSB B;  4QRG A;  1SNK A;  3IUT A;  3V6E A;  1HUC B;  2AUZ A;  2R9F A;  3IEJ A;  2YJC A;  2J7Q A;  3H6S A;  1MEM A;  1PAD A;  2B1N A;  2DJF B;  1TU6 A;  1PIP A;  2DCB A;  2AGA A;  4FK5 A;  1SP4 B;  1VJV A;  2FUD A;  1Y08 A;  3DF0 A;  3OF8 A;  3IOQ A;  3PT2 A;  2DCC A;  1NPZ A;  3H8C A;  1ICF A;  1YAL A;  1NLJ A;  1AYV A;  2DC6 A;  1F2C A;  1CB5 A;  1YK7 A;  3KSE A;  5CVN B;  4WUR A;  1PVJ A;  1PBH A;  3MP2 A;  3OF9 A;  3MHH A;  4BPV A;  3OIS A;  3H89 A;  1PPO A;  3BPF A;  3B79 A;  3C9E A;  5CHT A;  4OEM A;  3OVX A;  2NQG A;  4WA6 A;  3IMA A;  1AU3 A;  1ITO A;  4PI3 A;  2E00 A;  2P86 A;  5A24 A;  2CB5 A;  2AS8 A;  1EWL A;  1Y4H A;  1KFX L;  1CV8 A;  1THE A;  2F1G A;  4GUA A;  2PAD A;  2DC8 A;  3I06 A;  2FT2 A;  2XU1 A;  3USV A;  3TRK A;  1GLO A;  2HWK A;  3W30 A;  1EWO A;  1DF0 A;  3BWK A;  3HWN A;  3BC3 A;  3C0R A;  2FTD A;  2JQG R;  5FPW A;  4BOZ A;  1EWM A;  3AI8 A;  3MJ5 A;  3F5V A;  4I07 A;  1ZCM A;  4YYS A;  1CVZ A;  1DKI A;  2CIO A;  5J94 A;  2AYO A;  4OVZ B;  4RF0 A;  3HHA A;  4ZUX U;  1K3B B;  1KHP A;  3TNX A;  4CDD B;  7PCK A;  3N4C A;  2G8J A;  4MI7 A;  3P5W A;  4PAD A;  3WXG A;  4XZX A;  3PHX A;  2JQF R;  4CDE B;  3BCN A;  4W4U A;  2BDZ A;  4QRX A;  3CH2 X;  1NL6 A;  8PCH A;  2PNS A;  4REZ A;  4MM3 B;  3BBA A;  2E02 A;  4XUI A;  2GFO A;  4BSQ A;  2Y6E A;  1O0E A;  5K16 A;  3M99 A;  4PT5 A;  3E9S A;  1BQI A;  2YJ8 A;  2G6D A;  1FH0 A;  2F7D A;  5JH3 A;  4PP2 E;  1YVB A;  3OVZ A;  2C0Y A;  4N8W A;  3H7D A;  4R3D A;  2P7U A;  3KFQ A;  4RY2 A;  1U5I A;  3BB7 A;  1NB5 A;  1CJL A;  1AIM A;  3PHW A;  4I04 A;  4RKX A;  4QRV A;  2H7J A;  3ZNH A;  4D8E A;  2R9N A;  1CS8 A;  3ZUA A;  2HHN A;  3QJ3 A;  1NQC A;  3P5V A;  1UKF A;  3P5X A;  4KLB A;  1PXV A;  1PPD A;  4RNA A;  4Q8G A;  2E01 A;  2WBF X;  1YZB A;  3BOW A;  4DMX A;  3NHE A;  4K7C A;  3BY4 A;  4AXL A;  3S3Q A;  1S4V A;  3PW3 A;  1XKG A;  2IBI A;  3PRP A;  1BGO A;  3WXE A;  5EF4 A;  2G8E A;  3KW9 A;  1MDW A;  3KWZ A;  1F2A A;  1MIR A;  3RNV A;  2B1M A;  4N4Z A;  4M0W A;  3O0U A;  2NQI A;  3KWB X;  3N3K A;  1BY8 A;  4MSX A;  1MS6 A;  2HXZ A;  3MTV A;  4FJC A;  5EZS A;  2JTC A;  2OP3 A;  3IV2 A;  2Y5B A;  1MHW A;  1M6D A;  1AU4 A;  1U9V A;  2BTW A;  1U9Q X;  4AXM A;  2DCD A;  2FRA A;  1DEU A;  5EGW A;  4HWY A;  1CQD A;  3K9M A;  1PE6 A;  3U8E A;  4YYR A;  1KXR A;  1POP A;  4P6G A;  2DC7 A;  4BOQ A;  4P16 A;  4XR7 A;  2BDL A;  4CDC B;  3BPM A;  1MEG A;  3CBJ A;  4QH6 A;  2P0R A;  2XU3 A;  2DCA A;  4BOS A;  2UZJ A;  3S3R A;  1EF7 A;  2GHU A;  2YJ9 A;  2HD5 A;  1ZIV A;  3WXF A;  3GCB A;  4X6J A;  4ZTB A;  2JRI A;  1TL9 A;  1KHQ A;  3PDF A;  2IPP B;  3KKU A;  1ME4 A;  5KO3 A;  4YV8 A;  3CBK A;  3K8U A;  1U9W A;  3O1G A;  4OEL A;  2FYE A;  1NB3 A;  4I05 A;  1STF E;  4PP1 A;  1CPJ A;  3B21 A;  2DJG B;  3MTN A;  3OQC A;  4D8B A;  1AU0 A;  2HH5 A;  2PBH A;  2ATO A;  2YJB A;  1KFU L;  5PAD A;  3MOR A; 
#chains in the Genus database with same CATH homology
 3I3T A;  3IHP A;  1U9X A;  2AUX A;  3V6C A;  1AYU A;  2VHS A;  3HD3 A;  1CTE A;  2DZZ A;  2XU4 A;  3ERV A;  1YT7 A;  3D6S A;  1QMY A;  3QT4 A;  4W5B A;  5CVO B;  5JA7 A;  3KX1 A;  2FO5 A;  1PCI A;  3H8B A;  4DMY A;  2R9C A;  4Q8H A;  4CDF B;  2OUL A;  3P5U A;  2NQA A;  2AVW A;  1QDQ A;  4FIP A;  1A6R A;  1IWD A;  5F02 A;  1PPP A;  2VFC A;  1W6F A;  1AEC A;  4W5C A;  1EWP A;  4YYU A;  4X6H A;  3F75 A;  2FRQ A;  2DC9 A;  1E2T A;  3PBH A;  4BS6 A;  2G7Y A;  3LXS A;  1PPN A;  4MZS A;  1AYW A;  3MHS A;  1X9Y A;  2DZY A;  4YVA A;  2AYN A;  1GCB A;  5CVM A;  3D9W A;  1ME3 A;  3HHI A;  1QXP A;  4G54 A;  4YYQ A;  4BS5 A;  4X6I A;  1W4T A;  3N3G A;  4CZW A;  4B55 A;  1GEC E;  2OZ2 A;  3CH3 X;  2YJ2 A;  4N79 A;  1GMY A;  2R9O A;  9PAP A;  1F29 A;  2ACT A;  5CHV A;  1F2B A;  4P6E A;  2O6X A;  1BP4 A;  1YK8 A;  1ATK A;  3LFY A;  2FQ9 A;  1QOL A;  3PNR A;  2ARY A;  3RVV A;  2VHF A;  1Q6K A;  2R6N A;  1VSN A;  4BQV A;  3QSD A;  4MZO A;  6PAD A;  2PRE A;  3K24 A;  4QBB A;  4NV8 A;  1AU2 A;  3RVX A;  2NQD B;  1JQP A;  2AU1 A;  4YYW A;  2XU5 A;  2R9M A;  1TLO A;  2E03 A;  4YYV A;  3RVW A;  2AIM A;  3E1Z B;  1CSB B;  4QRG A;  1SNK A;  3IUT A;  3V6E A;  1HUC B;  2AUZ A;  2R9F A;  3IEJ A;  2YJC A;  3H6S A;  1MEM A;  1PAD A;  2B1N A;  2DJF B;  1TU6 A;  1PIP A;  2DCB A;  4FK5 A;  1SP4 B;  1VJV A;  2FUD A;  1Y08 A;  3DF0 A;  3OF8 A;  3IOQ A;  2DCC A;  1NPZ A;  3H8C A;  1ICF A;  1YAL A;  1NLJ A;  1AYV A;  2DC6 A;  1F2C A;  1CB5 A;  1YK7 A;  3KSE A;  5CVN B;  1PBH A;  2VFB A;  3OF9 A;  3MHH A;  4BPV A;  3OIS A;  3H89 A;  1PPO A;  3BPF A;  3B79 A;  3C9E A;  1W5R A;  5CHT A;  4OEM A;  3OVX A;  2NQG A;  4WA6 A;  3IMA A;  1AU3 A;  1ITO A;  4PI3 A;  2E00 A;  2P86 A;  5A24 A;  2CB5 A;  2AS8 A;  1EWL A;  1Y4H A;  1KFX L;  1CV8 A;  1THE A;  2F1G A;  2PAD A;  2DC8 A;  3I06 A;  2FT2 A;  2XU1 A;  3USV A;  1GLO A;  1EWO A;  1DF0 A;  3BWK A;  3HWN A;  3BC3 A;  2FTD A;  2JQG R;  5FPW A;  1EWM A;  3AI8 A;  3F5V A;  4I07 A;  1ZCM A;  4YYS A;  1CVZ A;  2CIO A;  5J94 A;  2AYO A;  3HHA A;  4ZUX U;  1K3B B;  1KHP A;  3TNX A;  4CDD B;  7PCK A;  3N4C A;  2G8J A;  3P5W A;  4PAD A;  4C5P A;  3WXG A;  2JQF R;  4CDE B;  3BCN A;  4W4U A;  2BDZ A;  4QRX A;  3CH2 X;  1NL6 A;  8PCH A;  2PNS A;  2E02 A;  4XUI A;  2GFO A;  4BSQ A;  2Y6E A;  1O0E A;  5K16 A;  3M99 A;  1BQI A;  2YJ8 A;  2G6D A;  1FH0 A;  2F7D A;  5JH3 A;  4PP2 E;  1YVB A;  3OVZ A;  2C0Y A;  4N8W A;  3H7D A;  2P7U A;  4GUZ A;  3KFQ A;  4RY2 A;  1U5I A;  1NB5 A;  1CJL A;  3LTW A;  1AIM A;  4I04 A;  4QRV A;  2H7J A;  2R9N A;  1CS8 A;  3ZUA A;  2HHN A;  3QJ3 A;  1NQC A;  3P5V A;  3P5X A;  4KLB A;  1PXV A;  1PPD A;  4Q8G A;  2E01 A;  2WBF X;  3BOW A;  4DMX A;  3NHE A;  4K7C A;  4AXL A;  3S3Q A;  1S4V A;  3PW3 A;  1XKG A;  2IBI A;  1BGO A;  3WXE A;  5EF4 A;  2G8E A;  3KW9 A;  1MDW A;  3KWZ A;  1F2A A;  1MIR A;  2B1M A;  4N4Z A;  3O0U A;  2NQI A;  3KWB X;  3N3K A;  1BY8 A;  4MSX A;  1MS6 A;  2HXZ A;  4FJC A;  4NV7 A;  2OP3 A;  3IV2 A;  2Y5B A;  1MHW A;  1M6D A;  1AU4 A;  1U9V A;  1U9Q X;  4AXM A;  2DCD A;  2BSZ A;  1DEU A;  2FRA A;  5EGW A;  4HWY A;  1CQD A;  3K9M A;  1PE6 A;  3U8E A;  4YYR A;  1KXR A;  1POP A;  4P6G A;  2DC7 A;  4XR7 A;  2BDL A;  4CDC B;  3BPM A;  1MEG A;  3CBJ A;  4QH6 A;  2P0R A;  2XU3 A;  2DCA A;  3S3R A;  1EF7 A;  2GHU A;  2YJ9 A;  2HD5 A;  1ZIV A;  3WXF A;  3GCB A;  4X6J A;  1TL9 A;  1KHQ A;  3PDF A;  2IPP B;  3KKU A;  1ME4 A;  4YV8 A;  3CBK A;  3K8U A;  1U9W A;  3O1G A;  4OEL A;  2FYE A;  1NB3 A;  4I05 A;  1STF E;  4PP1 A;  1CPJ A;  2DJG B;  3MTN A;  1AU0 A;  2HH5 A;  2PBH A;  2ATO A;  2YJB A;  4BGF A;  1KFU L;  5PAD A;  1GX3 A;  3MOR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...