2NQAA

Catalytic domain of human calpain 8
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
320
structure length
305
Chain Sequence
b'NALKYLGQDFKTLRQQCLDSGVLFKDPEFPAPSALGYTQGIIWKRPTELPSPQFIVGGATRTDIQGGLGDCWLLAAIASLTLNEELLYRVVPRDQDFQENYAGIFHFQFWQYGEWVEVVIDDRLPTKNGQLLFLHSEQGNEFWSALLEKAYAKLNGYEALAGGSTVEGFEDFTGGISEFYDLKKPPANLYQIIRKALAGSLLGCSIDVYSAAEAEAITSQKLVKSHAYSVTGVEEVNFQGHPEKLIRLRNPWGEEWSGAWSDDAPEWNHIDPRRKEELDKKVEDGEFWMSLSDFVRQFSRLEICN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calpain 8
publication title Structure of Human Calpain 8
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 76
structure length 305
sequence length 320
chains with identical sequence B
ec nomenclature ec 3.4.22.53: Calpain-2.
pdb deposition date 2006-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00648 Peptidase_C2 Calpain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2nqaA02
2B1MA 2DC6A 3K24A 4YYQA 2VHFA 2F1GA 4X6JA 4YYVA 1IWDA 2BDZA 1F2CA 4ZUXU 1Y08A 2H7JA 2DJFB 2DCBA 2DCCA 4RY2A 2XU1A 2NQGA 2XU3A 1PBHA 5A24A 2DZYA 2E02A 4YYRA 3MORA 2YJ8A 2CIOA 5JA7A 4PADA 2P86A 2PNSA 2G8EA 5PADA 3WXEA 4N79A 3IEJA 3USVA 1SP4B 3QT4A 2R9MA 3PDFA 3BPFA 2AUXA 1PPOA 1HUCB 1KFXL 1MIRA 1X9YA 1ZCMA 3KX1A 1NB3A 3HWNA 3P5WA 3V6EA 1YK8A 3NHEA 1DEUA 2R9OA 4W5BA 3OVZA 2PBHA 1U9WA 1EF7A 4W5CA 4X6HA 1AU0A 1CS8A 1VSNA 2F7DA 3BWKA 2IPPB 3WXGA 4Q8HA 2YJ9A 3M99A 3IV2A 3H8CA 1STFE 3BPMA 1PPDA 1XKGA 3N3KA 1CTEA 4CDFB 4DMXA 2WBFX 1AYVA 4DMYA 1Q6KA 2OZ2A 3CH2X 1M6DA 1NL6A 3OVXA 3IHPA 1NB5A 2CB5A 3N4CA 3S3RA 1NLJA 1KXRA 1A6RA 2NQIA 4W4UA 3I06A 3BC3A 4I04A 1GCBA 4XR7A 1QMYA 2AVWA 2GFOA 1Y4HA 3B79A 4G54A 2NQAA 1CQDA 5CVMA 1CPJA 5K16A 1TLOA 2FUDA 3MTNA 1NPZA 2OULA 1AYUA 4P6GA 2HHNA 4BS5A 2YJCA 4BSQA 1BP4A 1PXVA 3D6SA 1MS6A 2R9NA 6PADA 4KLBA 3WXFA 3P5XA 5J94A 1CSBB 2OP3A 2HH5A 3QSDA 1EWMA 1VJVA 2JQFR 3MHHA 2DC7A 3I3TA 2FRAA 5EGWA 1SNKA 2FT2A 3PW3A 2O6XA 1AU4A 4N8WA 4YVAA 1PPPA 2FYEA 1AU2A 2DZZA 4XUIA 3ZUAA 2Y5BA 1F2BA 3P5VA 4MZOA 3RVXA 3OISA 1U9VA 4AXMA 1CVZA 1GLOA 3CH3X 1AIMA 1BQIA 1AECA 2AYOA 1EWLA 3KSEA 1O0EA 2E00A 1YVBA 1BY8A 4QH6A 3HHAA 3RVVA 4YYWA 3H7DA 4CDCB 3U8EA 5FPWA 3OF8A 1AYWA 1GMYA 1QDQA 5F02A 2YJ2A 4OEMA 3PNRA 5CHVA 5JH3A 4QRXA 1ATKA 2AUZA 4CDEB 3HD3A 3BOWA 3CBKA 2E03A 4BS6A 4PI3A 1F2AA 2NQDB 2PREA 1EWOA 3F75A 1U5IA 3H89A 3HHIA 3O1GA 1POPA 1ZIVA 3ERVA 3H6SA 2G8JA 3O0UA 1ME3A 1S4VA 3IOQA 2G7YA 1GECE 2JQGR 1CV8A 2ARYA 1THEA 1MDWA 2G6DA 1PADA 1QXPA 3P5UA 1YT7A 2DCAA 4HWYA 2FQ9A 4YYSA 1PE6A 1BGOA 1EWPA 1CJLA 3GCBA 2PADA 4MZSA 1F29A 1TL9A 2R9CA 2BDLA 5EF4A 4CDDB 1NQCA 1MEMA 2B1NA 2AU1A 2XU4A 1ICFA 3E1ZB 7PCKA 2HXZA 2E01A 2DCDA 3C9EA 2FTDA 3KW9A 1DF0A 1PIPA 4BQVA 2ATOA 4QRVA 2FO5A 4CZWA 3OF9A 3S3QA 1YALA 1FH0A 2Y6EA 2FRQA 2AIMA 1KFUL 2AYNA 3V6CA 3LXSA 4BPVA 4PP2E 2HD5A 4N4ZA 1JQPA 1MHWA 4MSXA 4AXLA 3LFYA 4YYUA 4Q8GA 2XU5A 3MHSA 2R9FA 5CVNB 1MEGA 2P7UA 1AU3A 4X6IA 1ITOA 2DC8A 3F5VA 4I07A 1KHQA 4FJCA 3CBJA 3IMAA 2P0RA 3PBHA 4OELA 3KKUA 2VHSA 4PP1A 4FK5A 2DJGB 3KWBX 1TU6A 2AS8A 3AI8A 1U9QX 2IBIA 5CHTA 3KWZA 2ACTA 3H8BA 9PAPA 2YJBA 4FIPA 3IUTA 1CB5A 4P6EA 3TNXA 3KFQA 3K9MA 3N3GA 4K7CA 4QRGA 1PPNA 3DF0A 4QBBA 4I05A 3RVWA 3K8UA 1ME4A 4YV8A 3QJ3A 3BCNA 1PCIA 8PCHA 1YK7A 1K3BB 5CVOB 2C0YA 1U9XA 2GHUA 1QOLA 4WA6A 2R6NA 2DC9A 1KHPA
chains in the Genus database with same CATH superfamily
5EZSA 2B1MA 2DC6A 3K24A 4P16A 4YYQA 2VHFA 2F1GA 4X6JA 4YYVA 1IWDA 2BDZA 1F2CA 4ZUXU 1Y08A 4ZTBA 2H7JA 2DJFB 2DCBA 2DCCA 4RY2A 2XU1A 2NQGA 2XU3A 1PBHA 5A24A 2DZYA 2E02A 4YYRA 3MORA 4IUMA 2YJ8A 2CIOA 5JA7A 4PADA 2P86A 2PNSA 2G8EA 2HWKA 5PADA 3WXEA 4N79A 3IEJA 3USVA 1SP4B 3QT4A 2R9MA 3PDFA 3BPFA 3MJ5A 2AUXA 1PPOA 3PHUA 3PT2A 1HUCB 1KFXL 1MIRA 1X9YA 1ZCMA 3KX1A 1NB3A 2BU3A 3HWNA 3P5WA 3V6EA 1YK8A 3NHEA 1DEUA 2J7QC 2R9OA 4W5BA 3OVZA 2PBHA 1U9WA 4HXDB 1YZBA 4BOSA 3IFUA 1EF7A 4W5CA 4X6HA 1AU0A 1CS8A 1VSNA 2F7DA 3BWKA 3B21A 3OQCA 2IPPB 3WXGA 4Q8HA 2YJ9A 3M99A 3IV2A 3H8CA 1STFE 3BPMA 1PPDA 1XKGA 4D8BA 3N3KA 1UKFA 4M0WA 1CTEA 4CDFB 4DMXA 2WBFX 1AYVA 4DMYA 1Q6KA 4MI7A 2OZ2A 3CH2X 1M6DA 1NL6A 3OVXA 3PHWA 3IHPA 2DOSA 1NB5A 2CB5A 3N4CA 3S3RA 3BBAA 1NLJA 1KXRA 1A6RA 2NQIA 4W4UA 3I06A 3BC3A 4I04A 1GCBA 3RNVA 4XR7A 1QMYA 2AVWA 2GFOA 1Y4HA 3B79A 4G54A 2NQAA 1CQDA 5CVMA 1CPJA 3O65A 4RNAA 5K16A 1TLOA 2FUDA 3MTNA 1NPZA 2OULA 1AYUA 4P6GA 2HHNA 4BS5A 2YJCA 4BSQA 1BP4A 2FE8A 1PXVA 3D6SA 4BOPA 1MS6A 2R9NA 6PADA 4RF1A 4IP3A 4KLBA 3WXFA 3P5XA 5J94A 1CSBB 2OP3A 2HH5A 3QSDA 3MP2A 1EWMA 1VJVA 2JQFR 3MHHA 2DC7A 3I3TA 2J7QA 2FRAA 5EGWA 4A5UA 1SNKA 2FT2A 3PW3A 4MM3B 2O6XA 1AU4A 4N8WA 4R3DA 4YVAA 1PPPA 2FYEA 1AU2A 2DZZA 4XUIA 3ZUAA 2Y5BA 1F2BA 3P5VA 4MZOA 3RVXA 2BTWB 3OISA 1U9VA 4AXMA 1CVZA 1GLOA 3CH3X 1AIMA 1BQIA 1AECA 2AYOA 1EWLA 3KSEA 1O0EA 2E00A 1YVBA 1BY8A 4QH6A 4D8EA 3HHAA 3RVVA 4YYWA 3H7DA 4CDCB 2BTWA 5KO3A 3U8EA 5FPWA 4D8IA 3ZNHA 3OF8A 1AYWA 2AGAA 1GMYA 1QDQA 5F02A 2YJ2A 4OEMA 3PNRA 5CHVA 5JH3A 4QRXA 1ATKA 2AUZA 4CDEB 3TMPA 3HD3A 3BOWA 3CBKA 2E03A 4BS6A 4PI3A 1F2AA 2NQDB 2PREA 1EWOA 3F75A 1U5IA 3H89A 3HHIA 3O1GA 3MTVA 1POPA 1ZIVA 3ERVA 3W31A 3BB7A 3H6SA 2G8JA 3O0UA 1ME3A 1S4VA 3PHXA 4OVZB 3IOQA 2G7YA 1GECE 1DKIA 3W30A 2JQGR 1CV8A 2ARYA 4OW0A 1THEA 1MDWA 2G6DA 1PADA 1QXPA 2UZJA 3P5UA 1YT7A 2DCAA 3PRPA 4HWYA 5E6JA 2FQ9A 3BY4A 4YYSA 1PE6A 1BGOA 1EWPA 1CJLA 3GCBA 4OVZA 2JRIA 2PADA 4MZSA 4XZXA 1F29A 1TL9A 4PT5A 2R9CA 1PVJA 2BDLA 5EF4A 4CDDB 1NQCA 4BOQA 1MEMA 2B1NA 2AU1A 2XU4A 1ICFA 3E1ZB 7PCKA 2HXZA 2E01A 2DCDA 3C9EA 2FTDA 3KW9A 1DF0A 1PIPA 4BQVA 2ATOA 4QRVA 2FO5A 4CZWA 3OF9A 3S3QA 1YALA 1FH0A 2Y6EA 2FRQA 2AIMA 1KFUL 2AYNA 3V6CA 3LXSA 4BPVA 4PP2E 2HD5A 4N4ZA 1JQPA 1MHWA 4MSXA 4AXLA 3LFYA 4YYUA 4Q8GA 2XU5A 3MHSA 2R9FA 4BOUA 5CVNB 5EZQA 1MEGA 2P7UA 1AU3A 4X6IA 1ITOA 2DC8A 3F5VA 4I07A 1KHQA 4FJCA 3CBJA 4GUAA 3IMAA 2P0RA 3C0RA 3PBHA 4OELA 3PRMA 3KKUA 2VHSA 4PP1A 4FK5A 2DJGB 3KWBX 1TU6A 2AS8A 3AI8A 1U9QX 2IBIA 5CHTA 3KWZA 2ACTA 3H8BA 9PAPA 2YJBA 3E9SA 4FIPA 4RF0A 3IUTA 1CB5A 4P6EA 3TNXA 3KFQA 3K9MA 3N3GA 4K7CA 4QRGA 1PPNA 3DF0A 4QBBA 4I05A 3RVWA 5JZEA 3K8UA 1ME4A 4YV8A 3QJ3A 3BCNA 1PCIA 8PCHA 1YK7A 1K3BB 5CVOB 3PSEA 2C0YA 1U9XA 2GHUA 4REZA 1QOLA 4WURA 4RKXA 4WA6A 2R6NA 2DC9A 2Z84A 3TRKA 4BOZA 1KHPA 2JTCA
chains in the Genus database with same CATH topology
2B1MA 2DC6A 3K24A 4YYQA 2VHFA 2F1GA 4X6JA 4YYVA 1IWDA 2BDZA 1F2CA 4ZUXU 1Y08A 2H7JA 2DJFB 2DCBA 2DCCA 4RY2A 2XU1A 2NQGA 3D9WA 2XU3A 1PBHA 5A24A 2DZYA 2E02A 4YYRA 3MORA 2YJ8A 2CIOA 5JA7A 4PADA 2P86A 2PNSA 2G8EA 5PADA 3WXEA 4N79A 3IEJA 3USVA 1SP4B 3QT4A 2R9MA 3PDFA 3BPFA 2AUXA 1PPOA 1HUCB 1KFXL 1MIRA 1X9YA 1ZCMA 3KX1A 1NB3A 4NV8A 3HWNA 3P5WA 3V6EA 1YK8A 3NHEA 1DEUA 2R9OA 4W5BA 3OVZA 2PBHA 1U9WA 1EF7A 4W5CA 4X6HA 1AU0A 1CS8A 1VSNA 2F7DA 3BWKA 2IPPB 3WXGA 4Q8HA 2YJ9A 3M99A 3IV2A 3H8CA 1STFE 3BPMA 1PPDA 1XKGA 3N3KA 1CTEA 4CDFB 4DMXA 2WBFX 1AYVA 4DMYA 1Q6KA 1W6FA 2OZ2A 3CH2X 1M6DA 1NL6A 3OVXA 3IHPA 1NB5A 2CB5A 3N4CA 3S3RA 1NLJA 1KXRA 1A6RA 2NQIA 4W4UA 3I06A 3BC3A 4I04A 1GCBA 4XR7A 1QMYA 2AVWA 2GFOA 1Y4HA 3B79A 4G54A 2NQAA 1CQDA 5CVMA 1CPJA 5K16A 1TLOA 2FUDA 3MTNA 1NPZA 2OULA 1AYUA 4P6GA 2HHNA 4BS5A 2YJCA 4BSQA 1BP4A 1PXVA 3D6SA 1MS6A 2R9NA 6PADA 1GX3A 4KLBA 3WXFA 3P5XA 5J94A 1CSBB 2OP3A 2HH5A 3QSDA 1EWMA 1VJVA 2JQFR 3MHHA 2DC7A 3I3TA 2FRAA 5EGWA 1SNKA 2FT2A 3PW3A 2O6XA 1AU4A 4C5PA 4N8WA 4YVAA 1PPPA 2FYEA 1AU2A 2DZZA 4XUIA 3ZUAA 2Y5BA 1F2BA 3P5VA 4MZOA 3RVXA 3OISA 1U9VA 4AXMA 1CVZA 1GLOA 3CH3X 1AIMA 1BQIA 1AECA 2AYOA 1EWLA 3KSEA 1O0EA 2E00A 1YVBA 1BY8A 4BGFA 1E2TA 4QH6A 3HHAA 3RVVA 4YYWA 3H7DA 4NV7A 4CDCB 3U8EA 5FPWA 3OF8A 1AYWA 1GMYA 1QDQA 3LTWA 5F02A 2YJ2A 4OEMA 3PNRA 5CHVA 5JH3A 4QRXA 1ATKA 2AUZA 4CDEB 3HD3A 2VFBA 3BOWA 3CBKA 2E03A 4BS6A 4PI3A 1F2AA 2NQDB 2PREA 1EWOA 3F75A 1U5IA 2VFCA 3H89A 3HHIA 3O1GA 1POPA 1ZIVA 3ERVA 3H6SA 2G8JA 3O0UA 1ME3A 1S4VA 3IOQA 2G7YA 1GECE 2JQGR 1CV8A 2ARYA 1THEA 1MDWA 2G6DA 1PADA 4GUZA 1QXPA 3P5UA 1YT7A 2DCAA 4HWYA 2FQ9A 4YYSA 1PE6A 1BGOA 2BSZA 1EWPA 1CJLA 3GCBA 2PADA 4B55A 4MZSA 1F29A 1TL9A 2R9CA 2BDLA 5EF4A 4CDDB 1NQCA 1MEMA 2B1NA 2AU1A 2XU4A 1ICFA 3E1ZB 7PCKA 2HXZA 2E01A 2DCDA 3C9EA 2FTDA 3KW9A 1DF0A 1PIPA 4BQVA 2ATOA 4QRVA 2FO5A 4CZWA 3OF9A 3S3QA 1YALA 1FH0A 2Y6EA 2FRQA 2AIMA 1KFUL 2AYNA 3V6CA 3LXSA 4BPVA 4PP2E 2HD5A 4N4ZA 1JQPA 1MHWA 4MSXA 4AXLA 3LFYA 4YYUA 4Q8GA 2XU5A 3MHSA 2R9FA 5CVNB 1MEGA 2P7UA 1AU3A 4X6IA 1ITOA 2DC8A 3F5VA 4I07A 1KHQA 4FJCA 3CBJA 3IMAA 2P0RA 3PBHA 1W5RA 4OELA 3KKUA 2VHSA 4PP1A 4FK5A 1W4TA 2DJGB 3KWBX 1TU6A 2AS8A 3AI8A 1U9QX 2IBIA 5CHTA 3KWZA 2ACTA 3H8BA 9PAPA 2YJBA 4FIPA 3IUTA 1CB5A 4P6EA 3TNXA 3KFQA 3K9MA 3N3GA 4K7CA 4QRGA 1PPNA 3DF0A 4QBBA 4I05A 3RVWA 3K8UA 1ME4A 4YV8A 3QJ3A 3BCNA 1PCIA 8PCHA 1YK7A 1K3BB 5CVOB 2C0YA 1U9XA 2GHUA 1QOLA 4WA6A 2R6NA 2DC9A 1KHPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B1M A;  2DC6 A;  3K24 A;  4YYQ A;  2VHF A;  2F1G A;  4X6J A;  4YYV A;  1IWD A;  2BDZ A;  1F2C A;  4ZUX U;  1Y08 A;  2H7J A;  2DJF B;  2DCB A;  2DCC A;  4RY2 A;  2XU1 A;  2NQG A;  2XU3 A;  1PBH A;  5A24 A;  2DZY A;  2E02 A;  4YYR A;  3MOR A;  2YJ8 A;  2CIO A;  5JA7 A;  4PAD A;  2P86 A;  2PNS A;  2G8E A;  5PAD A;  3WXE A;  4N79 A;  3IEJ A;  3USV A;  1SP4 B;  3QT4 A;  2R9M A;  3PDF A;  3BPF A;  2AUX A;  1PPO A;  1HUC B;  1KFX L;  1MIR A;  1X9Y A;  1ZCM A;  3KX1 A;  1NB3 A;  3HWN A;  3P5W A;  3V6E A;  1YK8 A;  3NHE A;  1DEU A;  2R9O A;  4W5B A;  3OVZ A;  2PBH A;  1U9W A;  1EF7 A;  4W5C A;  4X6H A;  1AU0 A;  1CS8 A;  1VSN A;  2F7D A;  3BWK A;  2IPP B;  3WXG A;  4Q8H A;  2YJ9 A;  3M99 A;  3IV2 A;  3H8C A;  1STF E;  3BPM A;  1PPD A;  1XKG A;  3N3K A;  1CTE A;  4CDF B;  4DMX A;  2WBF X;  1AYV A;  4DMY A;  1Q6K A;  2OZ2 A;  3CH2 X;  1M6D A;  1NL6 A;  3OVX A;  3IHP A;  1NB5 A;  2CB5 A;  3N4C A;  3S3R A;  1NLJ A;  1KXR A;  1A6R A;  2NQI A;  4W4U A;  3I06 A;  3BC3 A;  4I04 A;  1GCB A;  4XR7 A;  1QMY A;  2AVW A;  2GFO A;  1Y4H A;  3B79 A;  4G54 A;  2NQA A;  1CQD A;  5CVM A;  1CPJ A;  5K16 A;  1TLO A;  2FUD A;  3MTN A;  1NPZ A;  2OUL A;  1AYU A;  4P6G A;  2HHN A;  4BS5 A;  2YJC A;  4BSQ A;  1BP4 A;  1PXV A;  3D6S A;  1MS6 A;  2R9N A;  6PAD A;  4KLB A;  3WXF A;  3P5X A;  5J94 A;  1CSB B;  2OP3 A;  2HH5 A;  3QSD A;  1EWM A;  1VJV A;  2JQF R;  3MHH A;  2DC7 A;  3I3T A;  2FRA A;  5EGW A;  1SNK A;  2FT2 A;  3PW3 A;  2O6X A;  1AU4 A;  4N8W A;  4YVA A;  1PPP A;  2FYE A;  1AU2 A;  2DZZ A;  4XUI A;  3ZUA A;  2Y5B A;  1F2B A;  3P5V A;  4MZO A;  3RVX A;  3OIS A;  1U9V A;  4AXM A;  1CVZ A;  1GLO A;  3CH3 X;  1AIM A;  1BQI A;  1AEC A;  2AYO A;  1EWL A;  3KSE A;  1O0E A;  2E00 A;  1YVB A;  1BY8 A;  4QH6 A;  3HHA A;  3RVV A;  4YYW A;  3H7D A;  4CDC B;  3U8E A;  5FPW A;  3OF8 A;  1AYW A;  1GMY A;  1QDQ A;  5F02 A;  2YJ2 A;  4OEM A;  3PNR A;  5CHV A;  5JH3 A;  4QRX A;  1ATK A;  2AUZ A;  4CDE B;  3HD3 A;  3BOW A;  3CBK A;  2E03 A;  4BS6 A;  4PI3 A;  1F2A A;  2NQD B;  2PRE A;  1EWO A;  3F75 A;  1U5I A;  3H89 A;  3HHI A;  3O1G A;  1POP A;  1ZIV A;  3ERV A;  3H6S A;  2G8J A;  3O0U A;  1ME3 A;  1S4V A;  3IOQ A;  2G7Y A;  1GEC E;  2JQG R;  1CV8 A;  2ARY A;  1THE A;  1MDW A;  2G6D A;  1PAD A;  1QXP A;  3P5U A;  1YT7 A;  2DCA A;  4HWY A;  2FQ9 A;  4YYS A;  1PE6 A;  1BGO A;  1EWP A;  1CJL A;  3GCB A;  2PAD A;  4MZS A;  1F29 A;  1TL9 A;  2R9C A;  2BDL A;  5EF4 A;  4CDD B;  1NQC A;  1MEM A;  2B1N A;  2AU1 A;  2XU4 A;  1ICF A;  3E1Z B;  7PCK A;  2HXZ A;  2E01 A;  2DCD A;  3C9E A;  2FTD A;  3KW9 A;  1DF0 A;  1PIP A;  4BQV A;  2ATO A;  4QRV A;  2FO5 A;  4CZW A;  3OF9 A;  3S3Q A;  1YAL A;  1FH0 A;  2Y6E A;  2FRQ A;  2AIM A;  1KFU L;  2AYN A;  3V6C A;  3LXS A;  4BPV A;  4PP2 E;  2HD5 A;  4N4Z A;  1JQP A;  1MHW A;  4MSX A;  4AXL A;  3LFY A;  4YYU A;  4Q8G A;  2XU5 A;  3MHS A;  2R9F A;  5CVN B;  1MEG A;  2P7U A;  1AU3 A;  4X6I A;  1ITO A;  2DC8 A;  3F5V A;  4I07 A;  1KHQ A;  4FJC A;  3CBJ A;  3IMA A;  2P0R A;  3PBH A;  4OEL A;  3KKU A;  2VHS A;  4PP1 A;  4FK5 A;  2DJG B;  3KWB X;  1TU6 A;  2AS8 A;  3AI8 A;  1U9Q X;  2IBI A;  5CHT A;  3KWZ A;  2ACT A;  3H8B A;  9PAP A;  2YJB A;  4FIP A;  3IUT A;  1CB5 A;  4P6E A;  3TNX A;  3KFQ A;  3K9M A;  3N3G A;  4K7C A;  4QRG A;  1PPN A;  3DF0 A;  4QBB A;  4I05 A;  3RVW A;  3K8U A;  1ME4 A;  4YV8 A;  3QJ3 A;  3BCN A;  1PCI A;  8PCH A;  1YK7 A;  1K3B B;  5CVO B;  2C0Y A;  1U9X A;  2GHU A;  1QOL A;  4WA6 A;  2R6N A;  2DC9 A;  1KHP A; 
#chains in the Genus database with same CATH topology
 5EZS A;  2B1M A;  2DC6 A;  3K24 A;  4P16 A;  4YYQ A;  2VHF A;  2F1G A;  4X6J A;  4YYV A;  1IWD A;  2BDZ A;  1F2C A;  4ZUX U;  1Y08 A;  4ZTB A;  2H7J A;  2DJF B;  2DCB A;  2DCC A;  4RY2 A;  2XU1 A;  2NQG A;  2XU3 A;  1PBH A;  5A24 A;  2DZY A;  2E02 A;  4YYR A;  3MOR A;  4IUM A;  2YJ8 A;  2CIO A;  5JA7 A;  4PAD A;  2P86 A;  2PNS A;  2G8E A;  2HWK A;  5PAD A;  3WXE A;  4N79 A;  3IEJ A;  3USV A;  1SP4 B;  3QT4 A;  2R9M A;  3PDF A;  3BPF A;  3MJ5 A;  2AUX A;  1PPO A;  3PHU A;  3PT2 A;  1HUC B;  1KFX L;  1MIR A;  1X9Y A;  1ZCM A;  3KX1 A;  1NB3 A;  2BU3 A;  3HWN A;  3P5W A;  3V6E A;  1YK8 A;  3NHE A;  1DEU A;  2J7Q C;  2R9O A;  4W5B A;  3OVZ A;  2PBH A;  1U9W A;  4HXD B;  1YZB A;  4BOS A;  3IFU A;  1EF7 A;  4W5C A;  4X6H A;  1AU0 A;  1CS8 A;  1VSN A;  2F7D A;  3BWK A;  3B21 A;  3OQC A;  2IPP B;  3WXG A;  4Q8H A;  2YJ9 A;  3M99 A;  3IV2 A;  3H8C A;  1STF E;  3BPM A;  1PPD A;  1XKG A;  4D8B A;  3N3K A;  1UKF A;  4M0W A;  1CTE A;  4CDF B;  4DMX A;  2WBF X;  1AYV A;  4DMY A;  1Q6K A;  4MI7 A;  2OZ2 A;  3CH2 X;  1M6D A;  1NL6 A;  3OVX A;  3PHW A;  3IHP A;  2DOS A;  1NB5 A;  2CB5 A;  3N4C A;  3S3R A;  3BBA A;  1NLJ A;  1KXR A;  1A6R A;  2NQI A;  4W4U A;  3I06 A;  3BC3 A;  4I04 A;  1GCB A;  3RNV A;  4XR7 A;  1QMY A;  2AVW A;  2GFO A;  1Y4H A;  3B79 A;  4G54 A;  2NQA A;  1CQD A;  5CVM A;  1CPJ A;  3O65 A;  4RNA A;  5K16 A;  1TLO A;  2FUD A;  3MTN A;  1NPZ A;  2OUL A;  1AYU A;  4P6G A;  2HHN A;  4BS5 A;  2YJC A;  4BSQ A;  1BP4 A;  2FE8 A;  1PXV A;  3D6S A;  4BOP A;  1MS6 A;  2R9N A;  6PAD A;  4RF1 A;  4IP3 A;  4KLB A;  3WXF A;  3P5X A;  5J94 A;  1CSB B;  2OP3 A;  2HH5 A;  3QSD A;  3MP2 A;  1EWM A;  1VJV A;  2JQF R;  3MHH A;  2DC7 A;  3I3T A;  2J7Q A;  2FRA A;  5EGW A;  4A5U A;  1SNK A;  2FT2 A;  3PW3 A;  4MM3 B;  2O6X A;  1AU4 A;  4N8W A;  4R3D A;  4YVA A;  1PPP A;  2FYE A;  1AU2 A;  2DZZ A;  4XUI A;  3ZUA A;  2Y5B A;  1F2B A;  3P5V A;  4MZO A;  3RVX A;  2BTW B;  3OIS A;  1U9V A;  4AXM A;  1CVZ A;  1GLO A;  3CH3 X;  1AIM A;  1BQI A;  1AEC A;  2AYO A;  1EWL A;  3KSE A;  1O0E A;  2E00 A;  1YVB A;  1BY8 A;  4QH6 A;  4D8E A;  3HHA A;  3RVV A;  4YYW A;  3H7D A;  4CDC B;  2BTW A;  5KO3 A;  3U8E A;  5FPW A;  4D8I A;  3ZNH A;  3OF8 A;  1AYW A;  2AGA A;  1GMY A;  1QDQ A;  5F02 A;  2YJ2 A;  4OEM A;  3PNR A;  5CHV A;  5JH3 A;  4QRX A;  1ATK A;  2AUZ A;  4CDE B;  3TMP A;  3HD3 A;  3BOW A;  3CBK A;  2E03 A;  4BS6 A;  4PI3 A;  1F2A A;  2NQD B;  2PRE A;  1EWO A;  3F75 A;  1U5I A;  3H89 A;  3HHI A;  3O1G A;  3MTV A;  1POP A;  1ZIV A;  3ERV A;  3W31 A;  3BB7 A;  3H6S A;  2G8J A;  3O0U A;  1ME3 A;  1S4V A;  3PHX A;  4OVZ B;  3IOQ A;  2G7Y A;  1GEC E;  1DKI A;  3W30 A;  2JQG R;  1CV8 A;  2ARY A;  4OW0 A;  1THE A;  1MDW A;  2G6D A;  1PAD A;  1QXP A;  2UZJ A;  3P5U A;  1YT7 A;  2DCA A;  3PRP A;  4HWY A;  5E6J A;  2FQ9 A;  3BY4 A;  4YYS A;  1PE6 A;  1BGO A;  1EWP A;  1CJL A;  3GCB A;  4OVZ A;  2JRI A;  2PAD A;  4MZS A;  4XZX A;  1F29 A;  1TL9 A;  4PT5 A;  2R9C A;  1PVJ A;  2BDL A;  5EF4 A;  4CDD B;  1NQC A;  4BOQ A;  1MEM A;  2B1N A;  2AU1 A;  2XU4 A;  1ICF A;  3E1Z B;  7PCK A;  2HXZ A;  2E01 A;  2DCD A;  3C9E A;  2FTD A;  3KW9 A;  1DF0 A;  1PIP A;  4BQV A;  2ATO A;  4QRV A;  2FO5 A;  4CZW A;  3OF9 A;  3S3Q A;  1YAL A;  1FH0 A;  2Y6E A;  2FRQ A;  2AIM A;  1KFU L;  2AYN A;  3V6C A;  3LXS A;  4BPV A;  4PP2 E;  2HD5 A;  4N4Z A;  1JQP A;  1MHW A;  4MSX A;  4AXL A;  3LFY A;  4YYU A;  4Q8G A;  2XU5 A;  3MHS A;  2R9F A;  4BOU A;  5CVN B;  5EZQ A;  1MEG A;  2P7U A;  1AU3 A;  4X6I A;  1ITO A;  2DC8 A;  3F5V A;  4I07 A;  1KHQ A;  4FJC A;  3CBJ A;  4GUA A;  3IMA A;  2P0R A;  3C0R A;  3PBH A;  4OEL A;  3PRM A;  3KKU A;  2VHS A;  4PP1 A;  4FK5 A;  2DJG B;  3KWB X;  1TU6 A;  2AS8 A;  3AI8 A;  1U9Q X;  2IBI A;  5CHT A;  3KWZ A;  2ACT A;  3H8B A;  9PAP A;  2YJB A;  3E9S A;  4FIP A;  4RF0 A;  3IUT A;  1CB5 A;  4P6E A;  3TNX A;  3KFQ A;  3K9M A;  3N3G A;  4K7C A;  4QRG A;  1PPN A;  3DF0 A;  4QBB A;  4I05 A;  3RVW A;  5JZE A;  3K8U A;  1ME4 A;  4YV8 A;  3QJ3 A;  3BCN A;  1PCI A;  8PCH A;  1YK7 A;  1K3B B;  5CVO B;  3PSE A;  2C0Y A;  1U9X A;  2GHU A;  4REZ A;  1QOL A;  4WUR A;  4RKX A;  4WA6 A;  2R6N A;  2DC9 A;  2Z84 A;  3TRK A;  4BOZ A;  1KHP A;  2JTC A; 
#chains in the Genus database with same CATH homology
 2B1M A;  2DC6 A;  3K24 A;  4YYQ A;  2VHF A;  2F1G A;  4X6J A;  4YYV A;  1IWD A;  2BDZ A;  1F2C A;  4ZUX U;  1Y08 A;  2H7J A;  2DJF B;  2DCB A;  2DCC A;  4RY2 A;  2XU1 A;  2NQG A;  3D9W A;  2XU3 A;  1PBH A;  5A24 A;  2DZY A;  2E02 A;  4YYR A;  3MOR A;  2YJ8 A;  2CIO A;  5JA7 A;  4PAD A;  2P86 A;  2PNS A;  2G8E A;  5PAD A;  3WXE A;  4N79 A;  3IEJ A;  3USV A;  1SP4 B;  3QT4 A;  2R9M A;  3PDF A;  3BPF A;  2AUX A;  1PPO A;  1HUC B;  1KFX L;  1MIR A;  1X9Y A;  1ZCM A;  3KX1 A;  1NB3 A;  4NV8 A;  3HWN A;  3P5W A;  3V6E A;  1YK8 A;  3NHE A;  1DEU A;  2R9O A;  4W5B A;  3OVZ A;  2PBH A;  1U9W A;  1EF7 A;  4W5C A;  4X6H A;  1AU0 A;  1CS8 A;  1VSN A;  2F7D A;  3BWK A;  2IPP B;  3WXG A;  4Q8H A;  2YJ9 A;  3M99 A;  3IV2 A;  3H8C A;  1STF E;  3BPM A;  1PPD A;  1XKG A;  3N3K A;  1CTE A;  4CDF B;  4DMX A;  2WBF X;  1AYV A;  4DMY A;  1Q6K A;  1W6F A;  2OZ2 A;  3CH2 X;  1M6D A;  1NL6 A;  3OVX A;  3IHP A;  1NB5 A;  2CB5 A;  3N4C A;  3S3R A;  1NLJ A;  1KXR A;  1A6R A;  2NQI A;  4W4U A;  3I06 A;  3BC3 A;  4I04 A;  1GCB A;  4XR7 A;  1QMY A;  2AVW A;  2GFO A;  1Y4H A;  3B79 A;  4G54 A;  2NQA A;  1CQD A;  5CVM A;  1CPJ A;  5K16 A;  1TLO A;  2FUD A;  3MTN A;  1NPZ A;  2OUL A;  1AYU A;  4P6G A;  2HHN A;  4BS5 A;  2YJC A;  4BSQ A;  1BP4 A;  1PXV A;  3D6S A;  1MS6 A;  2R9N A;  6PAD A;  1GX3 A;  4KLB A;  3WXF A;  3P5X A;  5J94 A;  1CSB B;  2OP3 A;  2HH5 A;  3QSD A;  1EWM A;  1VJV A;  2JQF R;  3MHH A;  2DC7 A;  3I3T A;  2FRA A;  5EGW A;  1SNK A;  2FT2 A;  3PW3 A;  2O6X A;  1AU4 A;  4C5P A;  4N8W A;  4YVA A;  1PPP A;  2FYE A;  1AU2 A;  2DZZ A;  4XUI A;  3ZUA A;  2Y5B A;  1F2B A;  3P5V A;  4MZO A;  3RVX A;  3OIS A;  1U9V A;  4AXM A;  1CVZ A;  1GLO A;  3CH3 X;  1AIM A;  1BQI A;  1AEC A;  2AYO A;  1EWL A;  3KSE A;  1O0E A;  2E00 A;  1YVB A;  1BY8 A;  4BGF A;  1E2T A;  4QH6 A;  3HHA A;  3RVV A;  4YYW A;  3H7D A;  4NV7 A;  4CDC B;  3U8E A;  5FPW A;  3OF8 A;  1AYW A;  1GMY A;  1QDQ A;  3LTW A;  5F02 A;  2YJ2 A;  4OEM A;  3PNR A;  5CHV A;  5JH3 A;  4QRX A;  1ATK A;  2AUZ A;  4CDE B;  3HD3 A;  2VFB A;  3BOW A;  3CBK A;  2E03 A;  4BS6 A;  4PI3 A;  1F2A A;  2NQD B;  2PRE A;  1EWO A;  3F75 A;  1U5I A;  2VFC A;  3H89 A;  3HHI A;  3O1G A;  1POP A;  1ZIV A;  3ERV A;  3H6S A;  2G8J A;  3O0U A;  1ME3 A;  1S4V A;  3IOQ A;  2G7Y A;  1GEC E;  2JQG R;  1CV8 A;  2ARY A;  1THE A;  1MDW A;  2G6D A;  1PAD A;  4GUZ A;  1QXP A;  3P5U A;  1YT7 A;  2DCA A;  4HWY A;  2FQ9 A;  4YYS A;  1PE6 A;  1BGO A;  2BSZ A;  1EWP A;  1CJL A;  3GCB A;  2PAD A;  4B55 A;  4MZS A;  1F29 A;  1TL9 A;  2R9C A;  2BDL A;  5EF4 A;  4CDD B;  1NQC A;  1MEM A;  2B1N A;  2AU1 A;  2XU4 A;  1ICF A;  3E1Z B;  7PCK A;  2HXZ A;  2E01 A;  2DCD A;  3C9E A;  2FTD A;  3KW9 A;  1DF0 A;  1PIP A;  4BQV A;  2ATO A;  4QRV A;  2FO5 A;  4CZW A;  3OF9 A;  3S3Q A;  1YAL A;  1FH0 A;  2Y6E A;  2FRQ A;  2AIM A;  1KFU L;  2AYN A;  3V6C A;  3LXS A;  4BPV A;  4PP2 E;  2HD5 A;  4N4Z A;  1JQP A;  1MHW A;  4MSX A;  4AXL A;  3LFY A;  4YYU A;  4Q8G A;  2XU5 A;  3MHS A;  2R9F A;  5CVN B;  1MEG A;  2P7U A;  1AU3 A;  4X6I A;  1ITO A;  2DC8 A;  3F5V A;  4I07 A;  1KHQ A;  4FJC A;  3CBJ A;  3IMA A;  2P0R A;  3PBH A;  1W5R A;  4OEL A;  3KKU A;  2VHS A;  4PP1 A;  4FK5 A;  1W4T A;  2DJG B;  3KWB X;  1TU6 A;  2AS8 A;  3AI8 A;  1U9Q X;  2IBI A;  5CHT A;  3KWZ A;  2ACT A;  3H8B A;  9PAP A;  2YJB A;  4FIP A;  3IUT A;  1CB5 A;  4P6E A;  3TNX A;  3KFQ A;  3K9M A;  3N3G A;  4K7C A;  4QRG A;  1PPN A;  3DF0 A;  4QBB A;  4I05 A;  3RVW A;  3K8U A;  1ME4 A;  4YV8 A;  3QJ3 A;  3BCN A;  1PCI A;  8PCH A;  1YK7 A;  1K3B B;  5CVO B;  2C0Y A;  1U9X A;  2GHU A;  1QOL A;  4WA6 A;  2R6N A;  2DC9 A;  1KHP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...