5A24A

Crystal structure of dionain-1, the major endopeptidase in the venus flytrap digestive juice
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
222
structure length
222
Chain Sequence
b'VPAAVDWRTAGAVTPVKNQQQCGCCWAFSAVAAIEGATQIKTGTLTSLSEEQIVDCDTNGNDKGCNGGTPDGAFQYVVNNQGIDTESDYPYTAGGGSPGTCSASSYQPAASITGYQDVPANNEQALQQAAATQPISVAIDASDPSFQSYSSGIYSGPCNTNLDHAVTVVGYGTDPNSGNSYWIVKNSWGTSWGQEGYIWMQMGLNAPYGVCGIAMQASYPTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIONAIN-1
publication title Enzymatic and Structural Characterization of the Major Endopeptidase in the Venus Flytrap Digestion Fluid.
pubmed doi rcsb
source organism Dionaea muscipula
molecule tags Hydrolase
total genus 64
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2015-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 5a24A00
2DCBA 3PW3A 4N79A 4RY2A 1Y4HA 3F75A 3D6SA 1SP4B 2AVWA 3IV2A 3WXEA 3KWZA 9PAPA 1XKGA 3MORA 3I06A 3BC3A 4N8WA 4QH6A 4YVAA 3CBKA 1U9WA 1PBHA 1MS6A 4YYWA 1KXRA 1CJLA 4I04A 1CSBB 2GFOA 3PNRA 1CPJA 5CVNB 4K7CA 2NQDB 3B79A 1KHQA 3H89A 3QSDA 1EWLA 3MHHA 1NB5A 5CVOB 4AXLA 3P5VA 3IEJA 4CDCB 2NQIA 1X9YA 4X6HA 4W5BA 1EWOA 3N3KA 2F1GA 4KLBA 2R9NA 3TNXA 3WXGA 2AUZA 2PREA 1BGOA 4YYQA 2DZYA 3QJ3A 1ZIVA 3S3RA 2G6DA 5A24A 4FJCA 4YYSA 1MEMA 2DZZA 3K24A 3V6CA 2VHSA 4G54A 3BOWA 3N3GA 4MZSA 1GLOA 3KKUA 1CVZA 1CTEA 1S4VA 1AYVA 2FYEA 2FO5A 2CIOA 2P7UA 2FUDA 4W5CA 4WA6A 3P5UA 3HHAA 4BS6A 1KFXL 2E03A 2G8JA 3E1ZB 1PE6A 1PPDA 5JH3A 2DC8A 4YYVA 4DMYA 4PP1A 1PIPA 4XR7A 1AU2A 3OISA 2DCDA 1AYWA 1QXPA 1VSNA 2IPPB 3H6SA 3ZUAA 2AS8A 3S3QA 2PNSA 2DC9A 3LFYA 3USVA 2JQFR 4P6EA 2AUXA 1GCBA 2R6NA 4BSQA 3M99A 5CHTA 3BPFA 2ARYA 5CHVA 1FH0A 4QBBA 2R9FA 3HD3A 3RVXA 3OF8A 5CVMA 4MSXA 2B1NA 1GECE 3KWBX 2OZ2A 1Y08A 3H8CA 3C9EA 3KW9A 4CDFB 6PADA 2DC7A 1MHWA 3LXSA 3H7DA 4I05A 3OVXA 1YK8A 3N4CA 1SNKA 2YJ9A 1EWPA 5EGWA 3MTNA 3OVZA 2FQ9A 3KSEA 4FIPA 1A6RA 3GCBA 1MEGA 1AIMA 2O6XA 1M6DA 3PDFA 2Y5BA 1F2CA 1NQCA 3MHSA 4CZWA 1F2AA 4OELA 4PADA 2HH5A 4N4ZA 1CV8A 3NHEA 3P5XA 3OF9A 4PI3A 4Q8GA 1YALA 2YJCA 2E01A 4MZOA 5JA7A 1F2BA 1F29A 1K3BB 3AI8A 3I3TA 1MDWA 3V6EA 2IBIA 2YJ8A 2XU1A 3RVVA 1AU0A 1EWMA 2BDZA 4X6JA 4QRXA 2WBFX 3U8EA 2GHUA 2NQAA 3IUTA 4DMXA 1THEA 3RVWA 4HWYA 4P6GA 5J94A 5K16A 1U9VA 3KFQA 2E00A 1IWDA 3BPMA 1POPA 2CB5A 2F7DA 2AU1A 1TL9A 2PADA 5PADA 1GMYA 1PPNA 1TLOA 2R9CA 1EF7A 2ACTA 1CS8A 4W4UA 1CB5A 2Y6EA 3K9MA 4CDEB 2OP3A 1BY8A 1KHPA 2G8EA 2DJFB 3O0UA 1U9XA 2HHNA 4YV8A 4PP2E 1BQIA 2XU4A 5FPWA 8PCHA 3O1GA 5EF4A 1AU3A 1YK7A 4QRVA 1ME3A 1YT7A 4XUIA 3DF0A 4BS5A 1QOLA 3H8BA 1Q6KA 2P0RA 4FK5A 3WXFA 3QT4A 2XU3A 4CDDB 1KFUL 1PCIA 3F5VA 1ME4A 3HHIA 4AXMA 2HXZA 1JQPA 1DF0A 3CBJA 7PCKA 2DCCA 2HD5A 1O0EA 2H7JA 3BWKA 2FTDA 2BDLA 4YYRA 2DC6A 1YVBA 1HUCB 4QRGA 1VJVA 1U9QX 2P86A 1QDQA 1ATKA 1AU4A 2XU5A 3K8UA 1AECA 2AYOA 2ATOA 3PBHA 2B1MA 3P5WA 2R9OA 1PXVA 3CH2X 4X6IA 2FRQA 3BCNA 1ITOA 2FRAA 2AYNA 2OULA 1DEUA 4ZUXU 2VHFA 2G7YA 2PBHA 2C0YA 1AYUA 4I07A 1PPPA 4YYUA 1TU6A 3ERVA 1NL6A 3IHPA 1U5IA 2NQGA 1BP4A 2YJBA 1PPOA 1QMYA 1NB3A 3KX1A 4OEMA 1ZCMA 3HWNA 1STFE 4BPVA 2DJGB 2DCAA 2FT2A 1NPZA 2AIMA 2JQGR 2R9MA 4BQVA 2E02A 1ICFA 3IMAA 4Q8HA 3IOQA 1NLJA 2YJ2A 3CH3X 1CQDA 1PADA 1MIRA 5F02A
chains in the Genus database with same CATH superfamily
3MP2A 2DCBA 3PW3A 4N79A 4RY2A 1Y4HA 3F75A 3D6SA 1SP4B 2AVWA 3IV2A 3WXEA 4REZA 3KWZA 9PAPA 3BBAA 4OVZA 1XKGA 3MORA 3I06A 3BC3A 3IFUA 4N8WA 4QH6A 4YVAA 3CBKA 1U9WA 1PBHA 1MS6A 4YYWA 1YZBA 4P16A 1KXRA 2JTCA 1CJLA 4I04A 1CSBB 3TMPA 2GFOA 3PNRA 1CPJA 5CVNB 4K7CA 2NQDB 3B79A 1KHQA 3H89A 3QSDA 1EWLA 3MHHA 1NB5A 5CVOB 2BTWA 4AXLA 3P5VA 1PVJA 3W31A 3IEJA 4CDCB 2NQIA 1X9YA 4X6HA 2FE8A 4W5BA 1EWOA 3N3KA 2F1GA 4KLBA 2R9NA 3TNXA 3WXGA 2AUZA 2PREA 1BGOA 1UKFA 4D8EA 4YYQA 3ZNHA 2DZYA 3QJ3A 1ZIVA 3PT2A 3S3RA 2G6DA 5A24A 4FJCA 4YYSA 1MEMA 2DZZA 4RF1A 4HXDB 3K24A 4RKXA 3V6CA 3C0RA 2VHSA 4G54A 3BOWA 3N3GA 4MZSA 1GLOA 3KKUA 1CVZA 1CTEA 1S4VA 1AYVA 2FYEA 2FO5A 2CIOA 2P7UA 2FUDA 4W5CA 4WA6A 3P5UA 3HHAA 4BS6A 1KFXL 2E03A 2G8JA 3E1ZB 1PE6A 1PPDA 5JH3A 2DC8A 4YYVA 4DMYA 4PP1A 3PRPA 1PIPA 4XR7A 1AU2A 3OISA 2DCDA 1AYWA 1QXPA 1VSNA 2IPPB 3H6SA 3ZUAA 2AS8A 3S3QA 4BOZA 2PNSA 2DC9A 3LFYA 3USVA 2JQFR 4P6EA 2JRIA 2AUXA 1GCBA 2BU3A 2R6NA 4BSQA 4R3DA 3M99A 5CHTA 3MTVA 3BPFA 4IP3A 2ARYA 5CHVA 1FH0A 4QBBA 2R9FA 3HD3A 3RVXA 3OF8A 5CVMA 3B21A 4MSXA 2B1NA 1GECE 3KWBX 2OZ2A 1Y08A 3H8CA 3C9EA 3KW9A 4CDFB 6PADA 5JZEA 2DC7A 1MHWA 4BOQA 3LXSA 3H7DA 4I05A 4RNAA 3OVXA 1YK8A 3N4CA 1SNKA 2YJ9A 1EWPA 5EGWA 3PSEA 3MTNA 3OVZA 2FQ9A 3KSEA 4FIPA 1A6RA 3GCBA 1MEGA 5KO3A 1AIMA 3W30A 2O6XA 1M6DA 3PDFA 2Y5BA 1F2CA 1NQCA 2BTWB 4IUMA 1DKIA 3MHSA 3PHWA 5EZSA 4CZWA 2AGAA 4BOPA 1F2AA 4ZTBA 4OELA 4PADA 2J7QA 2HH5A 4N4ZA 1CV8A 3NHEA 3P5XA 3OF9A 4PI3A 4WURA 5EZQA 4Q8GA 1YALA 2YJCA 2E01A 4MZOA 5JA7A 1F2BA 1F29A 1K3BB 3AI8A 3I3TA 1MDWA 3V6EA 2IBIA 2YJ8A 2XU1A 3RVVA 1AU0A 1EWMA 2BDZA 4X6JA 4QRXA 2UZJA 2WBFX 3U8EA 2GHUA 2NQAA 3IUTA 4DMXA 1THEA 3RVWA 4HWYA 4P6GA 5J94A 5K16A 1U9VA 3KFQA 2E00A 1IWDA 3O65A 3BPMA 1POPA 2CB5A 2F7DA 4A5UA 2AU1A 1TL9A 2PADA 5PADA 1GMYA 1PPNA 1TLOA 2R9CA 1EF7A 2HWKA 2ACTA 1CS8A 4W4UA 1CB5A 2Y6EA 3K9MA 4CDEB 2OP3A 1BY8A 1KHPA 2G8EA 2DJFB 3O0UA 1U9XA 2HHNA 5E6JA 4YV8A 4PP2E 1BQIA 2XU4A 5FPWA 8PCHA 3O1GA 5EF4A 1AU3A 1YK7A 4QRVA 1ME3A 1YT7A 4XUIA 3DF0A 4BS5A 1QOLA 3H8BA 1Q6KA 2P0RA 4FK5A 3WXFA 3QT4A 2XU3A 4CDDB 4OVZB 1KFUL 1PCIA 3F5VA 1ME4A 3HHIA 4AXMA 4MM3B 2HXZA 1JQPA 1DF0A 3CBJA 7PCKA 2Z84A 4D8BA 2DCCA 2HD5A 3MJ5A 1O0EA 3PHUA 3BY4A 2H7JA 2J7QC 3PRMA 3BWKA 2FTDA 2BDLA 3PHXA 3BB7A 4YYRA 3OQCA 2DC6A 1YVBA 1HUCB 4QRGA 1VJVA 1U9QX 2P86A 1QDQA 2DOSA 1ATKA 1AU4A 2XU5A 3K8UA 1AECA 2AYOA 2ATOA 3PBHA 4D8IA 2B1MA 3P5WA 2R9OA 1PXVA 4GUAA 3CH2X 4X6IA 2FRQA 3BCNA 4OW0A 3RNVA 1ITOA 4PT5A 2FRAA 2AYNA 2OULA 1DEUA 4ZUXU 2VHFA 2G7YA 2PBHA 2C0YA 1AYUA 4I07A 1PPPA 4YYUA 1TU6A 3ERVA 1NL6A 3IHPA 1U5IA 2NQGA 4RF0A 1BP4A 2YJBA 1PPOA 4BOUA 1QMYA 1NB3A 4XZXA 3KX1A 4MI7A 4OEMA 1ZCMA 3HWNA 4M0WA 1STFE 4BPVA 3E9SA 2DJGB 2DCAA 2FT2A 1NPZA 4BOSA 2AIMA 2JQGR 2R9MA 4BQVA 2E02A 1ICFA 3IMAA 4Q8HA 3IOQA 1NLJA 2YJ2A 3CH3X 1CQDA 1PADA 1MIRA 3TRKA 5F02A
chains in the Genus database with same CATH topology
2DCBA 3PW3A 4N79A 4RY2A 1Y4HA 3F75A 3D6SA 1SP4B 2AVWA 3IV2A 3WXEA 3KWZA 9PAPA 1XKGA 3MORA 3I06A 3BC3A 4N8WA 4QH6A 4YVAA 3CBKA 1U9WA 1PBHA 1W6FA 1MS6A 4YYWA 1KXRA 1CJLA 4I04A 1CSBB 2GFOA 3PNRA 1E2TA 1CPJA 5CVNB 4K7CA 2NQDB 3B79A 1KHQA 3H89A 3QSDA 1EWLA 3MHHA 1NB5A 4B55A 5CVOB 4AXLA 3P5VA 3IEJA 4CDCB 2NQIA 1X9YA 4X6HA 4W5BA 1EWOA 3N3KA 2F1GA 4KLBA 2R9NA 3TNXA 3WXGA 1W5RA 2AUZA 2PREA 1BGOA 4YYQA 2DZYA 3QJ3A 1ZIVA 3S3RA 2G6DA 5A24A 4FJCA 4YYSA 1MEMA 2DZZA 3K24A 3V6CA 2VHSA 4G54A 3BOWA 3N3GA 4MZSA 1GLOA 3KKUA 1CVZA 1CTEA 1S4VA 1AYVA 2FYEA 2FO5A 2CIOA 2P7UA 2FUDA 4W5CA 4WA6A 3P5UA 3HHAA 4BS6A 1KFXL 2E03A 2G8JA 3E1ZB 1PE6A 1PPDA 5JH3A 2DC8A 4YYVA 4DMYA 4PP1A 1PIPA 4XR7A 1AU2A 3OISA 2DCDA 1AYWA 1QXPA 1VSNA 4BGFA 2IPPB 3H6SA 3ZUAA 2AS8A 3S3QA 2PNSA 2DC9A 3LFYA 3USVA 2JQFR 4P6EA 2AUXA 1GCBA 2R6NA 4BSQA 3M99A 1W4TA 5CHTA 3BPFA 2ARYA 5CHVA 1FH0A 4QBBA 2R9FA 2VFBA 3HD3A 3RVXA 3OF8A 5CVMA 4MSXA 2B1NA 1GECE 3KWBX 2OZ2A 1Y08A 3H8CA 3C9EA 3KW9A 4CDFB 6PADA 2DC7A 1MHWA 3LXSA 3H7DA 4I05A 3OVXA 1YK8A 3N4CA 2VFCA 1SNKA 2YJ9A 1EWPA 5EGWA 3MTNA 3OVZA 2FQ9A 3KSEA 4FIPA 1A6RA 3GCBA 1MEGA 1AIMA 2O6XA 1M6DA 3PDFA 2Y5BA 1F2CA 1NQCA 3MHSA 4CZWA 1F2AA 4OELA 4PADA 2HH5A 4N4ZA 1CV8A 3NHEA 3P5XA 3OF9A 4PI3A 4Q8GA 1YALA 2YJCA 2E01A 4MZOA 5JA7A 1F2BA 1F29A 1K3BB 3AI8A 3I3TA 1MDWA 3V6EA 2IBIA 2YJ8A 2XU1A 3RVVA 1AU0A 1EWMA 2BDZA 4X6JA 4QRXA 2WBFX 3U8EA 3LTWA 2GHUA 2NQAA 3IUTA 4DMXA 1THEA 3RVWA 4HWYA 4P6GA 5J94A 5K16A 1U9VA 3KFQA 2E00A 1IWDA 3BPMA 1POPA 2CB5A 2F7DA 2AU1A 1TL9A 4NV7A 2PADA 5PADA 1GMYA 1PPNA 1TLOA 2R9CA 1EF7A 3D9WA 2ACTA 1CS8A 4W4UA 1CB5A 2Y6EA 3K9MA 4CDEB 2OP3A 1BY8A 1KHPA 2G8EA 2DJFB 3O0UA 1U9XA 2HHNA 4YV8A 4PP2E 4NV8A 1BQIA 2XU4A 2BSZA 5FPWA 8PCHA 3O1GA 5EF4A 1AU3A 1YK7A 4QRVA 1ME3A 1YT7A 4XUIA 3DF0A 4BS5A 1QOLA 3H8BA 1Q6KA 2P0RA 4FK5A 3WXFA 3QT4A 2XU3A 4CDDB 1KFUL 1PCIA 3F5VA 1ME4A 3HHIA 4AXMA 2HXZA 1JQPA 1DF0A 3CBJA 7PCKA 2DCCA 2HD5A 1O0EA 2H7JA 3BWKA 2FTDA 2BDLA 4YYRA 2DC6A 4GUZA 1YVBA 1HUCB 4QRGA 1VJVA 1U9QX 2P86A 1QDQA 1ATKA 1AU4A 2XU5A 3K8UA 1AECA 2AYOA 2ATOA 3PBHA 2B1MA 3P5WA 2R9OA 1PXVA 3CH2X 4X6IA 2FRQA 3BCNA 1ITOA 2FRAA 2AYNA 2OULA 1DEUA 4ZUXU 2VHFA 2G7YA 2PBHA 2C0YA 1AYUA 4I07A 1PPPA 4YYUA 1TU6A 3ERVA 1NL6A 3IHPA 1U5IA 2NQGA 1BP4A 2YJBA 1PPOA 1QMYA 1NB3A 4C5PA 3KX1A 4OEMA 1ZCMA 3HWNA 1STFE 4BPVA 2DJGB 2DCAA 1GX3A 2FT2A 1NPZA 2AIMA 2JQGR 2R9MA 4BQVA 2E02A 1ICFA 3IMAA 4Q8HA 3IOQA 1NLJA 2YJ2A 3CH3X 1CQDA 1PADA 1MIRA 5F02A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DCB A;  3PW3 A;  4N79 A;  4RY2 A;  1Y4H A;  3F75 A;  3D6S A;  1SP4 B;  2AVW A;  3IV2 A;  3WXE A;  3KWZ A;  9PAP A;  1XKG A;  3MOR A;  3I06 A;  3BC3 A;  4N8W A;  4QH6 A;  4YVA A;  3CBK A;  1U9W A;  1PBH A;  1MS6 A;  4YYW A;  1KXR A;  1CJL A;  4I04 A;  1CSB B;  2GFO A;  3PNR A;  1CPJ A;  5CVN B;  4K7C A;  2NQD B;  3B79 A;  1KHQ A;  3H89 A;  3QSD A;  1EWL A;  3MHH A;  1NB5 A;  5CVO B;  4AXL A;  3P5V A;  3IEJ A;  4CDC B;  2NQI A;  1X9Y A;  4X6H A;  4W5B A;  1EWO A;  3N3K A;  2F1G A;  4KLB A;  2R9N A;  3TNX A;  3WXG A;  2AUZ A;  2PRE A;  1BGO A;  4YYQ A;  2DZY A;  3QJ3 A;  1ZIV A;  3S3R A;  2G6D A;  5A24 A;  4FJC A;  4YYS A;  1MEM A;  2DZZ A;  3K24 A;  3V6C A;  2VHS A;  4G54 A;  3BOW A;  3N3G A;  4MZS A;  1GLO A;  3KKU A;  1CVZ A;  1CTE A;  1S4V A;  1AYV A;  2FYE A;  2FO5 A;  2CIO A;  2P7U A;  2FUD A;  4W5C A;  4WA6 A;  3P5U A;  3HHA A;  4BS6 A;  1KFX L;  2E03 A;  2G8J A;  3E1Z B;  1PE6 A;  1PPD A;  5JH3 A;  2DC8 A;  4YYV A;  4DMY A;  4PP1 A;  1PIP A;  4XR7 A;  1AU2 A;  3OIS A;  2DCD A;  1AYW A;  1QXP A;  1VSN A;  2IPP B;  3H6S A;  3ZUA A;  2AS8 A;  3S3Q A;  2PNS A;  2DC9 A;  3LFY A;  3USV A;  2JQF R;  4P6E A;  2AUX A;  1GCB A;  2R6N A;  4BSQ A;  3M99 A;  5CHT A;  3BPF A;  2ARY A;  5CHV A;  1FH0 A;  4QBB A;  2R9F A;  3HD3 A;  3RVX A;  3OF8 A;  5CVM A;  4MSX A;  2B1N A;  1GEC E;  3KWB X;  2OZ2 A;  1Y08 A;  3H8C A;  3C9E A;  3KW9 A;  4CDF B;  6PAD A;  2DC7 A;  1MHW A;  3LXS A;  3H7D A;  4I05 A;  3OVX A;  1YK8 A;  3N4C A;  1SNK A;  2YJ9 A;  1EWP A;  5EGW A;  3MTN A;  3OVZ A;  2FQ9 A;  3KSE A;  4FIP A;  1A6R A;  3GCB A;  1MEG A;  1AIM A;  2O6X A;  1M6D A;  3PDF A;  2Y5B A;  1F2C A;  1NQC A;  3MHS A;  4CZW A;  1F2A A;  4OEL A;  4PAD A;  2HH5 A;  4N4Z A;  1CV8 A;  3NHE A;  3P5X A;  3OF9 A;  4PI3 A;  4Q8G A;  1YAL A;  2YJC A;  2E01 A;  4MZO A;  5JA7 A;  1F2B A;  1F29 A;  1K3B B;  3AI8 A;  3I3T A;  1MDW A;  3V6E A;  2IBI A;  2YJ8 A;  2XU1 A;  3RVV A;  1AU0 A;  1EWM A;  2BDZ A;  4X6J A;  4QRX A;  2WBF X;  3U8E A;  2GHU A;  2NQA A;  3IUT A;  4DMX A;  1THE A;  3RVW A;  4HWY A;  4P6G A;  5J94 A;  5K16 A;  1U9V A;  3KFQ A;  2E00 A;  1IWD A;  3BPM A;  1POP A;  2CB5 A;  2F7D A;  2AU1 A;  1TL9 A;  2PAD A;  5PAD A;  1GMY A;  1PPN A;  1TLO A;  2R9C A;  1EF7 A;  2ACT A;  1CS8 A;  4W4U A;  1CB5 A;  2Y6E A;  3K9M A;  4CDE B;  2OP3 A;  1BY8 A;  1KHP A;  2G8E A;  2DJF B;  3O0U A;  1U9X A;  2HHN A;  4YV8 A;  4PP2 E;  1BQI A;  2XU4 A;  5FPW A;  8PCH A;  3O1G A;  5EF4 A;  1AU3 A;  1YK7 A;  4QRV A;  1ME3 A;  1YT7 A;  4XUI A;  3DF0 A;  4BS5 A;  1QOL A;  3H8B A;  1Q6K A;  2P0R A;  4FK5 A;  3WXF A;  3QT4 A;  2XU3 A;  4CDD B;  1KFU L;  1PCI A;  3F5V A;  1ME4 A;  3HHI A;  4AXM A;  2HXZ A;  1JQP A;  1DF0 A;  3CBJ A;  7PCK A;  2DCC A;  2HD5 A;  1O0E A;  2H7J A;  3BWK A;  2FTD A;  2BDL A;  4YYR A;  2DC6 A;  1YVB A;  1HUC B;  4QRG A;  1VJV A;  1U9Q X;  2P86 A;  1QDQ A;  1ATK A;  1AU4 A;  2XU5 A;  3K8U A;  1AEC A;  2AYO A;  2ATO A;  3PBH A;  2B1M A;  3P5W A;  2R9O A;  1PXV A;  3CH2 X;  4X6I A;  2FRQ A;  3BCN A;  1ITO A;  2FRA A;  2AYN A;  2OUL A;  1DEU A;  4ZUX U;  2VHF A;  2G7Y A;  2PBH A;  2C0Y A;  1AYU A;  4I07 A;  1PPP A;  4YYU A;  1TU6 A;  3ERV A;  1NL6 A;  3IHP A;  1U5I A;  2NQG A;  1BP4 A;  2YJB A;  1PPO A;  1QMY A;  1NB3 A;  3KX1 A;  4OEM A;  1ZCM A;  3HWN A;  1STF E;  4BPV A;  2DJG B;  2DCA A;  2FT2 A;  1NPZ A;  2AIM A;  2JQG R;  2R9M A;  4BQV A;  2E02 A;  1ICF A;  3IMA A;  4Q8H A;  3IOQ A;  1NLJ A;  2YJ2 A;  3CH3 X;  1CQD A;  1PAD A;  1MIR A;  5F02 A; 
#chains in the Genus database with same CATH topology
 3MP2 A;  2DCB A;  3PW3 A;  4N79 A;  4RY2 A;  1Y4H A;  3F75 A;  3D6S A;  1SP4 B;  2AVW A;  3IV2 A;  3WXE A;  4REZ A;  3KWZ A;  9PAP A;  3BBA A;  4OVZ A;  1XKG A;  3MOR A;  3I06 A;  3BC3 A;  3IFU A;  4N8W A;  4QH6 A;  4YVA A;  3CBK A;  1U9W A;  1PBH A;  1MS6 A;  4YYW A;  1YZB A;  4P16 A;  1KXR A;  2JTC A;  1CJL A;  4I04 A;  1CSB B;  3TMP A;  2GFO A;  3PNR A;  1CPJ A;  5CVN B;  4K7C A;  2NQD B;  3B79 A;  1KHQ A;  3H89 A;  3QSD A;  1EWL A;  3MHH A;  1NB5 A;  5CVO B;  2BTW A;  4AXL A;  3P5V A;  1PVJ A;  3W31 A;  3IEJ A;  4CDC B;  2NQI A;  1X9Y A;  4X6H A;  2FE8 A;  4W5B A;  1EWO A;  3N3K A;  2F1G A;  4KLB A;  2R9N A;  3TNX A;  3WXG A;  2AUZ A;  2PRE A;  1BGO A;  1UKF A;  4D8E A;  4YYQ A;  3ZNH A;  2DZY A;  3QJ3 A;  1ZIV A;  3PT2 A;  3S3R A;  2G6D A;  5A24 A;  4FJC A;  4YYS A;  1MEM A;  2DZZ A;  4RF1 A;  4HXD B;  3K24 A;  4RKX A;  3V6C A;  3C0R A;  2VHS A;  4G54 A;  3BOW A;  3N3G A;  4MZS A;  1GLO A;  3KKU A;  1CVZ A;  1CTE A;  1S4V A;  1AYV A;  2FYE A;  2FO5 A;  2CIO A;  2P7U A;  2FUD A;  4W5C A;  4WA6 A;  3P5U A;  3HHA A;  4BS6 A;  1KFX L;  2E03 A;  2G8J A;  3E1Z B;  1PE6 A;  1PPD A;  5JH3 A;  2DC8 A;  4YYV A;  4DMY A;  4PP1 A;  3PRP A;  1PIP A;  4XR7 A;  1AU2 A;  3OIS A;  2DCD A;  1AYW A;  1QXP A;  1VSN A;  2IPP B;  3H6S A;  3ZUA A;  2AS8 A;  3S3Q A;  4BOZ A;  2PNS A;  2DC9 A;  3LFY A;  3USV A;  2JQF R;  4P6E A;  2JRI A;  2AUX A;  1GCB A;  2BU3 A;  2R6N A;  4BSQ A;  4R3D A;  3M99 A;  5CHT A;  3MTV A;  3BPF A;  4IP3 A;  2ARY A;  5CHV A;  1FH0 A;  4QBB A;  2R9F A;  3HD3 A;  3RVX A;  3OF8 A;  5CVM A;  3B21 A;  4MSX A;  2B1N A;  1GEC E;  3KWB X;  2OZ2 A;  1Y08 A;  3H8C A;  3C9E A;  3KW9 A;  4CDF B;  6PAD A;  5JZE A;  2DC7 A;  1MHW A;  4BOQ A;  3LXS A;  3H7D A;  4I05 A;  4RNA A;  3OVX A;  1YK8 A;  3N4C A;  1SNK A;  2YJ9 A;  1EWP A;  5EGW A;  3PSE A;  3MTN A;  3OVZ A;  2FQ9 A;  3KSE A;  4FIP A;  1A6R A;  3GCB A;  1MEG A;  5KO3 A;  1AIM A;  3W30 A;  2O6X A;  1M6D A;  3PDF A;  2Y5B A;  1F2C A;  1NQC A;  2BTW B;  4IUM A;  1DKI A;  3MHS A;  3PHW A;  5EZS A;  4CZW A;  2AGA A;  4BOP A;  1F2A A;  4ZTB A;  4OEL A;  4PAD A;  2J7Q A;  2HH5 A;  4N4Z A;  1CV8 A;  3NHE A;  3P5X A;  3OF9 A;  4PI3 A;  4WUR A;  5EZQ A;  4Q8G A;  1YAL A;  2YJC A;  2E01 A;  4MZO A;  5JA7 A;  1F2B A;  1F29 A;  1K3B B;  3AI8 A;  3I3T A;  1MDW A;  3V6E A;  2IBI A;  2YJ8 A;  2XU1 A;  3RVV A;  1AU0 A;  1EWM A;  2BDZ A;  4X6J A;  4QRX A;  2UZJ A;  2WBF X;  3U8E A;  2GHU A;  2NQA A;  3IUT A;  4DMX A;  1THE A;  3RVW A;  4HWY A;  4P6G A;  5J94 A;  5K16 A;  1U9V A;  3KFQ A;  2E00 A;  1IWD A;  3O65 A;  3BPM A;  1POP A;  2CB5 A;  2F7D A;  4A5U A;  2AU1 A;  1TL9 A;  2PAD A;  5PAD A;  1GMY A;  1PPN A;  1TLO A;  2R9C A;  1EF7 A;  2HWK A;  2ACT A;  1CS8 A;  4W4U A;  1CB5 A;  2Y6E A;  3K9M A;  4CDE B;  2OP3 A;  1BY8 A;  1KHP A;  2G8E A;  2DJF B;  3O0U A;  1U9X A;  2HHN A;  5E6J A;  4YV8 A;  4PP2 E;  1BQI A;  2XU4 A;  5FPW A;  8PCH A;  3O1G A;  5EF4 A;  1AU3 A;  1YK7 A;  4QRV A;  1ME3 A;  1YT7 A;  4XUI A;  3DF0 A;  4BS5 A;  1QOL A;  3H8B A;  1Q6K A;  2P0R A;  4FK5 A;  3WXF A;  3QT4 A;  2XU3 A;  4CDD B;  4OVZ B;  1KFU L;  1PCI A;  3F5V A;  1ME4 A;  3HHI A;  4AXM A;  4MM3 B;  2HXZ A;  1JQP A;  1DF0 A;  3CBJ A;  7PCK A;  2Z84 A;  4D8B A;  2DCC A;  2HD5 A;  3MJ5 A;  1O0E A;  3PHU A;  3BY4 A;  2H7J A;  2J7Q C;  3PRM A;  3BWK A;  2FTD A;  2BDL A;  3PHX A;  3BB7 A;  4YYR A;  3OQC A;  2DC6 A;  1YVB A;  1HUC B;  4QRG A;  1VJV A;  1U9Q X;  2P86 A;  1QDQ A;  2DOS A;  1ATK A;  1AU4 A;  2XU5 A;  3K8U A;  1AEC A;  2AYO A;  2ATO A;  3PBH A;  4D8I A;  2B1M A;  3P5W A;  2R9O A;  1PXV A;  4GUA A;  3CH2 X;  4X6I A;  2FRQ A;  3BCN A;  4OW0 A;  3RNV A;  1ITO A;  4PT5 A;  2FRA A;  2AYN A;  2OUL A;  1DEU A;  4ZUX U;  2VHF A;  2G7Y A;  2PBH A;  2C0Y A;  1AYU A;  4I07 A;  1PPP A;  4YYU A;  1TU6 A;  3ERV A;  1NL6 A;  3IHP A;  1U5I A;  2NQG A;  4RF0 A;  1BP4 A;  2YJB A;  1PPO A;  4BOU A;  1QMY A;  1NB3 A;  4XZX A;  3KX1 A;  4MI7 A;  4OEM A;  1ZCM A;  3HWN A;  4M0W A;  1STF E;  4BPV A;  3E9S A;  2DJG B;  2DCA A;  2FT2 A;  1NPZ A;  4BOS A;  2AIM A;  2JQG R;  2R9M A;  4BQV A;  2E02 A;  1ICF A;  3IMA A;  4Q8H A;  3IOQ A;  1NLJ A;  2YJ2 A;  3CH3 X;  1CQD A;  1PAD A;  1MIR A;  3TRK A;  5F02 A; 
#chains in the Genus database with same CATH homology
 2DCB A;  3PW3 A;  4N79 A;  4RY2 A;  1Y4H A;  3F75 A;  3D6S A;  1SP4 B;  2AVW A;  3IV2 A;  3WXE A;  3KWZ A;  9PAP A;  1XKG A;  3MOR A;  3I06 A;  3BC3 A;  4N8W A;  4QH6 A;  4YVA A;  3CBK A;  1U9W A;  1PBH A;  1W6F A;  1MS6 A;  4YYW A;  1KXR A;  1CJL A;  4I04 A;  1CSB B;  2GFO A;  3PNR A;  1E2T A;  1CPJ A;  5CVN B;  4K7C A;  2NQD B;  3B79 A;  1KHQ A;  3H89 A;  3QSD A;  1EWL A;  3MHH A;  1NB5 A;  4B55 A;  5CVO B;  4AXL A;  3P5V A;  3IEJ A;  4CDC B;  2NQI A;  1X9Y A;  4X6H A;  4W5B A;  1EWO A;  3N3K A;  2F1G A;  4KLB A;  2R9N A;  3TNX A;  3WXG A;  1W5R A;  2AUZ A;  2PRE A;  1BGO A;  4YYQ A;  2DZY A;  3QJ3 A;  1ZIV A;  3S3R A;  2G6D A;  5A24 A;  4FJC A;  4YYS A;  1MEM A;  2DZZ A;  3K24 A;  3V6C A;  2VHS A;  4G54 A;  3BOW A;  3N3G A;  4MZS A;  1GLO A;  3KKU A;  1CVZ A;  1CTE A;  1S4V A;  1AYV A;  2FYE A;  2FO5 A;  2CIO A;  2P7U A;  2FUD A;  4W5C A;  4WA6 A;  3P5U A;  3HHA A;  4BS6 A;  1KFX L;  2E03 A;  2G8J A;  3E1Z B;  1PE6 A;  1PPD A;  5JH3 A;  2DC8 A;  4YYV A;  4DMY A;  4PP1 A;  1PIP A;  4XR7 A;  1AU2 A;  3OIS A;  2DCD A;  1AYW A;  1QXP A;  1VSN A;  4BGF A;  2IPP B;  3H6S A;  3ZUA A;  2AS8 A;  3S3Q A;  2PNS A;  2DC9 A;  3LFY A;  3USV A;  2JQF R;  4P6E A;  2AUX A;  1GCB A;  2R6N A;  4BSQ A;  3M99 A;  1W4T A;  5CHT A;  3BPF A;  2ARY A;  5CHV A;  1FH0 A;  4QBB A;  2R9F A;  2VFB A;  3HD3 A;  3RVX A;  3OF8 A;  5CVM A;  4MSX A;  2B1N A;  1GEC E;  3KWB X;  2OZ2 A;  1Y08 A;  3H8C A;  3C9E A;  3KW9 A;  4CDF B;  6PAD A;  2DC7 A;  1MHW A;  3LXS A;  3H7D A;  4I05 A;  3OVX A;  1YK8 A;  3N4C A;  2VFC A;  1SNK A;  2YJ9 A;  1EWP A;  5EGW A;  3MTN A;  3OVZ A;  2FQ9 A;  3KSE A;  4FIP A;  1A6R A;  3GCB A;  1MEG A;  1AIM A;  2O6X A;  1M6D A;  3PDF A;  2Y5B A;  1F2C A;  1NQC A;  3MHS A;  4CZW A;  1F2A A;  4OEL A;  4PAD A;  2HH5 A;  4N4Z A;  1CV8 A;  3NHE A;  3P5X A;  3OF9 A;  4PI3 A;  4Q8G A;  1YAL A;  2YJC A;  2E01 A;  4MZO A;  5JA7 A;  1F2B A;  1F29 A;  1K3B B;  3AI8 A;  3I3T A;  1MDW A;  3V6E A;  2IBI A;  2YJ8 A;  2XU1 A;  3RVV A;  1AU0 A;  1EWM A;  2BDZ A;  4X6J A;  4QRX A;  2WBF X;  3U8E A;  3LTW A;  2GHU A;  2NQA A;  3IUT A;  4DMX A;  1THE A;  3RVW A;  4HWY A;  4P6G A;  5J94 A;  5K16 A;  1U9V A;  3KFQ A;  2E00 A;  1IWD A;  3BPM A;  1POP A;  2CB5 A;  2F7D A;  2AU1 A;  1TL9 A;  4NV7 A;  2PAD A;  5PAD A;  1GMY A;  1PPN A;  1TLO A;  2R9C A;  1EF7 A;  3D9W A;  2ACT A;  1CS8 A;  4W4U A;  1CB5 A;  2Y6E A;  3K9M A;  4CDE B;  2OP3 A;  1BY8 A;  1KHP A;  2G8E A;  2DJF B;  3O0U A;  1U9X A;  2HHN A;  4YV8 A;  4PP2 E;  4NV8 A;  1BQI A;  2XU4 A;  2BSZ A;  5FPW A;  8PCH A;  3O1G A;  5EF4 A;  1AU3 A;  1YK7 A;  4QRV A;  1ME3 A;  1YT7 A;  4XUI A;  3DF0 A;  4BS5 A;  1QOL A;  3H8B A;  1Q6K A;  2P0R A;  4FK5 A;  3WXF A;  3QT4 A;  2XU3 A;  4CDD B;  1KFU L;  1PCI A;  3F5V A;  1ME4 A;  3HHI A;  4AXM A;  2HXZ A;  1JQP A;  1DF0 A;  3CBJ A;  7PCK A;  2DCC A;  2HD5 A;  1O0E A;  2H7J A;  3BWK A;  2FTD A;  2BDL A;  4YYR A;  2DC6 A;  4GUZ A;  1YVB A;  1HUC B;  4QRG A;  1VJV A;  1U9Q X;  2P86 A;  1QDQ A;  1ATK A;  1AU4 A;  2XU5 A;  3K8U A;  1AEC A;  2AYO A;  2ATO A;  3PBH A;  2B1M A;  3P5W A;  2R9O A;  1PXV A;  3CH2 X;  4X6I A;  2FRQ A;  3BCN A;  1ITO A;  2FRA A;  2AYN A;  2OUL A;  1DEU A;  4ZUX U;  2VHF A;  2G7Y A;  2PBH A;  2C0Y A;  1AYU A;  4I07 A;  1PPP A;  4YYU A;  1TU6 A;  3ERV A;  1NL6 A;  3IHP A;  1U5I A;  2NQG A;  1BP4 A;  2YJB A;  1PPO A;  1QMY A;  1NB3 A;  4C5P A;  3KX1 A;  4OEM A;  1ZCM A;  3HWN A;  1STF E;  4BPV A;  2DJG B;  2DCA A;  1GX3 A;  2FT2 A;  1NPZ A;  2AIM A;  2JQG R;  2R9M A;  4BQV A;  2E02 A;  1ICF A;  3IMA A;  4Q8H A;  3IOQ A;  1NLJ A;  2YJ2 A;  3CH3 X;  1CQD A;  1PAD A;  1MIR A;  5F02 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...