5A24A

Crystal structure of dionain-1, the major endopeptidase in the venus flytrap digestive juice
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
222
structure length
222
Chain Sequence
VPAAVDWRTAGAVTPVKNQQQCGCCWAFSAVAAIEGATQIKTGTLTSLSEEQIVDCDTNGNDKGCNGGTPDGAFQYVVNNQGIDTESDYPYTAGGGSPGTCSASSYQPAASITGYQDVPANNEQALQQAAATQPISVAIDASDPSFQSYSSGIYSGPCNTNLDHAVTVVGYGTDPNSGNSYWIVKNSWGTSWGQEGYIWMQMGLNAPYGVCGIAMQASYPTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords DIONAIN-1
publication title Enzymatic and Structural Characterization of the Major Endopeptidase in the Venus Flytrap Digestion Fluid.
pubmed doi rcsb
source organism Dionaea muscipula
total genus 64
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2015-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 5a24A00
1MS6A 1CVZA 4Q8HA 3MORA 1AYUA 2YJCA 2DCCA 2AVWA 4W5CA 3ZUAA 4BS5A 3WXEA 4X6JA 2GFOA 4DMYA 4MZSA 1AIMA 1NPZA 1NQCA 1U9XA 1DF0A 4PADA 3B79A 4QH6A 1THEA 3USVA 1MEMA 3F75A 4BPVA 2XU3A 1PE6A 4PP2E 1QMYA 1AYWA 4YYRA 3I06A 4HWYA 4YYVA 3KKUA 4XUIA 3PW3A 3BWKA 3CBJA 3KWBX 3NHEA 1NLJA 3BOWA 1GCBA 2AYNA 3MTNA 1ICFA 1ME3A 2FRAA 2DJFB 2CIOA 1POPA 4AXMA 2O6XA 3WXGA 2JQFR 2FT2A 2AIMA 1GLOA 3M99A 1PCIA 1U5IA 4CZWA 1EWOA 3H6SA 1PBHA 4I07A 3IHPA 1U9WA 4XR7A 1PPNA 2ARYA 1M6DA 3MHSA 1AU3A 2IPPB 1S4VA 1CQDA 3D6SA 1Y4HA 3V6CA 1MHWA 4OELA 3KWZA 2HXZA 1F29A 3RVVA 3MHHA 1K3BB 4DMXA 4KLBA 5EF4A 2G8EA 5CHVA 5FPWA 2E03A 2G8JA 1VSNA 3H7DA 4X6HA 2P7UA 3QJ3A 3QSDA 2FYEA 4N79A 2FO5A 1AU0A 1BY8A 4W5BA 1YALA 2R9FA 5PADA 4I04A 4P6GA 2XU4A 5CHTA 3IV2A 3KW9A 3BPFA 3BCNA 9PAPA 3OF8A 7PCKA 3ERVA 5K16A 1PADA 2G7YA 4CDCB 2CB5A 5J94A 1CJLA 2VHFA 1EF7A 4YYWA 2DZYA 4P6EA 3GCBA 1YVBA 1KHPA 1TLOA 2F1GA 2PBHA 2GHUA 4FIPA 3LXSA 1SP4B 3O1GA 1PPOA 2R6NA 1CV8A 5A24A 3K8UA 1F2BA 3N4CA 1AU2A 4YYQA 3OVXA 5JH3A 4FK5A 3AI8A 2G6DA 3F5VA 1BGOA 5CVOB 3RVXA 1AECA 2JQGR 1BQIA 3IEJA 1MDWA 2DC7A 2PNSA 2NQDB 1YK8A 2XU5A 2IBIA 4YVAA 1U9QX 1NL6A 3K9MA 2ATOA 2BDLA 1YK7A 2H7JA 4Q8GA 2R9NA 4PI3A 2NQGA 3CH3X 3OISA 3PNRA 2DC9A 4G54A 4X6IA 3P5VA 1GECE 3P5UA 1CSBB 3BC3A 4BS6A 1MIRA 1KXRA 1PPPA 1VJVA 2C0YA 2OULA 2YJ9A 1HUCB 3DF0A 3U8EA 3CBKA 1ATKA 3HD3A 2AYOA 2HH5A 2YJBA 3K24A 3PDFA 1PIPA 3WXFA 4QRGA 1CPJA 1JQPA 1KFXL 1MEGA 8PCHA 2AS8A 2FQ9A 2DCBA 1AU4A 4QRVA 3S3RA 4FJCA 1U9VA 2BDZA 3V6EA 3OVZA 4MZOA 1QOLA 3H8CA 2ACTA 4W4UA 2P0RA 4PP1A 1BP4A 3KFQA 3N3KA 2PREA 3IMAA 1SNKA 3QT4A 1CS8A 1ITOA 4YYUA 2PADA 1YT7A 4YV8A 1FH0A 4AXLA 3S3QA 3LFYA 3PBHA 3P5XA 4QRXA 3TNXA 1GMYA 1F2CA 2AUZA 5CVNB 4BSQA 3KSEA 3HHIA 1ZCMA 2YJ8A 2R9OA 2XU1A 4MSXA 3IOQA 3KX1A 2DC6A 3CH2X 4BQVA 1EWLA 2VHSA 4ZUXU 1QDQA 2E02A 2Y5BA 2DCDA 2NQAA 1F2AA 2AU1A 2F7DA 1NB5A 2DJGB 5JA7A 4YYSA 4WA6A 2DZZA 4QBBA 4RY2A 3BPMA 2B1MA 3H8BA 4N8WA 3OF9A 4CDDB 4N4ZA 3HWNA 5EGWA 3P5WA 4CDEB 2E00A 2DC8A 2DCAA 1X9YA 3IUTA 3N3GA 1Y08A 1Q6KA 2P86A 2HHNA 1TL9A 1ME4A 2FTDA 1ZIVA 3C9EA 3RVWA 3HHAA 5CVMA 1CB5A 1STFE 2R9MA 2YJ2A 1O0EA 1CTEA 1XKGA 2NQIA 1EWPA 1TU6A 3E1ZB 2AUXA 5F02A 6PADA 4I05A 4K7CA 2FRQA 2B1NA 2OP3A 2WBFX 3O0UA 3H89A 4OEMA 2Y6EA 1NB3A 2E01A 1DEUA 2R9CA 1EWMA 3I3TA 1KFUL 2HD5A 1AYVA 1PXVA 1IWDA 1KHQA 2OZ2A 1A6RA 4CDFB 1QXPA 2FUDA 1PPDA
chains in the Genus database with same CATH superfamily
1MS6A 4OW0A 1CVZA 4Q8HA 3IFUA 3MORA 1AYUA 2YJCA 2DCCA 4OVZB 2AVWA 4W5CA 3ZUAA 3BY4A 4BS5A 2J7QA 3WXEA 4X6JA 4BOSA 2GFOA 4DMYA 4M0WA 4MZSA 1AIMA 1NPZA 4XZXA 1NQCA 1U9XA 2AGAA 1DF0A 4PADA 3B79A 4QH6A 1THEA 3USVA 1MEMA 2JTCA 3F75A 4BPVA 2XU3A 1PE6A 4PP2E 1QMYA 1AYWA 4YYRA 3I06A 4HWYA 4YYVA 3KKUA 4XUIA 3PW3A 3BWKA 3CBJA 3KWBX 3NHEA 1NLJA 3BOWA 1GCBA 2AYNA 3MTNA 1ICFA 1ME3A 2FRAA 2DJFB 2CIOA 4RNAA 1POPA 4AXMA 2O6XA 3MJ5A 3WXGA 2JQFR 2FT2A 2AIMA 1GLOA 3PRMA 3M99A 1PCIA 1U5IA 4P16A 4CZWA 1EWOA 3H6SA 1PBHA 4I07A 3IHPA 1U9WA 4XR7A 1PPNA 2ARYA 4WURA 1M6DA 3MHSA 5EZQA 1AU3A 2IPPB 1S4VA 1CQDA 3D6SA 1Y4HA 3V6CA 1MHWA 1YZBA 4OELA 3KWZA 2HXZA 1F29A 3RVVA 3MHHA 1K3BB 4DMXA 4KLBA 2BTWB 5EF4A 2G8EA 5CHVA 5FPWA 2E03A 2G8JA 1VSNA 3H7DA 4X6HA 2P7UA 3QJ3A 3QSDA 5E6JA 2FYEA 4N79A 4RF0A 2FO5A 4A5UA 1AU0A 1BY8A 4W5BA 1YALA 2R9FA 5PADA 4I04A 4P6GA 2JRIA 3W31A 2XU4A 5CHTA 3IV2A 4BOPA 3KW9A 3BPFA 3BCNA 9PAPA 3OF8A 1DKIA 7PCKA 3ERVA 5K16A 1PADA 2G7YA 4CDCB 2CB5A 5J94A 1CJLA 2VHFA 1EF7A 4YYWA 2DZYA 4P6EA 3GCBA 2HWKA 1YVBA 1KHPA 1TLOA 2F1GA 2PBHA 2GHUA 3W30A 4D8BA 4FIPA 3LXSA 1SP4B 3O1GA 1PPOA 2R6NA 1CV8A 5A24A 3K8UA 1F2BA 3N4CA 1AU2A 3PHWA 4ZTBA 4YYQA 3OVXA 5JH3A 4FK5A 3AI8A 2G6DA 3F5VA 1BGOA 5CVOB 3RVXA 2FE8A 1AECA 2JQGR 1BQIA 3IEJA 1MDWA 4HXDB 2DC7A 2PNSA 4REZA 3E9SA 2NQDB 1YK8A 2XU5A 2IBIA 4YVAA 1U9QX 1NL6A 3K9MA 2ATOA 2BDLA 1YK7A 3MTVA 2H7JA 4Q8GA 2R9NA 4PI3A 2NQGA 3CH3X 3OISA 3PNRA 2DC9A 4G54A 4X6IA 3P5VA 1GECE 3MP2A 3P5UA 1CSBB 3BC3A 4BS6A 1MIRA 1KXRA 1PPPA 3TMPA 4RF1A 1VJVA 2C0YA 2OULA 4BOQA 3RNVA 2YJ9A 1HUCB 3DF0A 3U8EA 3CBKA 2DOSA 1ATKA 3HD3A 2AYOA 2HH5A 2YJBA 3K24A 3PDFA 3O65A 1PIPA 3WXFA 4QRGA 1CPJA 1JQPA 1KFXL 4PT5A 1MEGA 8PCHA 2AS8A 2FQ9A 2DCBA 1AU4A 4QRVA 3S3RA 4FJCA 1U9VA 2BDZA 5JZEA 3B21A 3V6EA 3OVZA 4MZOA 1QOLA 3H8CA 4D8EA 2ACTA 4W4UA 2P0RA 5KO3A 4PP1A 1BP4A 3KFQA 3N3KA 3PHXA 4RKXA 2PREA 4OVZA 3IMAA 1SNKA 3QT4A 1CS8A 1ITOA 3C0RA 4R3DA 4YYUA 2PADA 1YT7A 4YV8A 1FH0A 4AXLA 3PRPA 3S3QA 3LFYA 3PBHA 3P5XA 4QRXA 3TNXA 1GMYA 1F2CA 2AUZA 5CVNB 4BSQA 3KSEA 3HHIA 1ZCMA 2YJ8A 2R9OA 4D8IA 2XU1A 4MSXA 3IOQA 3KX1A 2DC6A 3CH2X 3PT2A 4BQVA 1EWLA 2VHSA 4ZUXU 1QDQA 2E02A 2Y5BA 2DCDA 2NQAA 1F2AA 2AU1A 2F7DA 1NB5A 2DJGB 5JA7A 4YYSA 4WA6A 2DZZA 4QBBA 4RY2A 3BBAA 4GUAA 3BPMA 4BOUA 4MM3B 2B1MA 3H8BA 4N8WA 4BOZA 3OF9A 4CDDB 4N4ZA 3HWNA 5EGWA 3P5WA 4CDEB 2E00A 2DC8A 2UZJA 2DCAA 1X9YA 3IUTA 1UKFA 3N3GA 1Y08A 1Q6KA 2P86A 2HHNA 1TL9A 3BB7A 1ME4A 2FTDA 1ZIVA 3C9EA 3RVWA 3OQCA 3PHUA 2BTWA 3HHAA 4IUMA 5CVMA 1CB5A 1STFE 2R9MA 2YJ2A 1O0EA 1CTEA 1XKGA 5EZSA 2NQIA 3TRKA 4IP3A 1EWPA 1TU6A 3E1ZB 2AUXA 5F02A 6PADA 4I05A 4K7CA 2FRQA 2B1NA 2J7QC 1PVJA 2OP3A 3PSEA 4MI7A 2WBFX 2Z84A 3O0UA 3H89A 4OEMA 2Y6EA 1NB3A 3ZNHA 2E01A 1DEUA 2R9CA 1EWMA 3I3TA 1KFUL 2HD5A 1AYVA 1PXVA 1IWDA 2BU3A 1KHQA 2OZ2A 1A6RA 4CDFB 1QXPA 2FUDA 1PPDA
chains in the Genus database with same CATH topology
1GX3A 1MS6A 4C5PA 1CVZA 4Q8HA 3MORA 1AYUA 2YJCA 2DCCA 2AVWA 4W5CA 3ZUAA 4BS5A 3WXEA 4X6JA 2GFOA 4DMYA 4MZSA 1AIMA 1NPZA 1NQCA 1U9XA 1DF0A 4PADA 3B79A 4QH6A 1THEA 3USVA 1MEMA 3F75A 4BPVA 2XU3A 1PE6A 4PP2E 1QMYA 1AYWA 4YYRA 3I06A 4HWYA 4YYVA 3KKUA 4XUIA 3PW3A 3BWKA 3CBJA 3KWBX 3NHEA 1NLJA 3BOWA 1GCBA 2VFCA 2AYNA 3MTNA 1ICFA 1ME3A 2FRAA 2DJFB 2CIOA 1POPA 4AXMA 2O6XA 3WXGA 2JQFR 2FT2A 2AIMA 1GLOA 3M99A 1PCIA 1U5IA 4CZWA 1EWOA 3H6SA 1PBHA 4I07A 3IHPA 1U9WA 4XR7A 1PPNA 2ARYA 1M6DA 3MHSA 4GUZA 1AU3A 2IPPB 1S4VA 1CQDA 3D6SA 1Y4HA 3V6CA 1MHWA 4OELA 3KWZA 2HXZA 1F29A 3RVVA 3MHHA 1K3BB 4DMXA 4KLBA 5EF4A 2G8EA 1W5RA 5CHVA 5FPWA 2E03A 2G8JA 1VSNA 3H7DA 4X6HA 2P7UA 3QJ3A 3QSDA 2FYEA 4N79A 2FO5A 1AU0A 1BY8A 4W5BA 1YALA 2R9FA 5PADA 4I04A 4P6GA 2XU4A 5CHTA 3IV2A 3KW9A 4NV8A 3BPFA 3BCNA 9PAPA 3OF8A 2BSZA 7PCKA 3ERVA 5K16A 1PADA 2G7YA 4CDCB 2CB5A 1E2TA 5J94A 1CJLA 2VHFA 1EF7A 4YYWA 2DZYA 4P6EA 3GCBA 1YVBA 1KHPA 1TLOA 2F1GA 2PBHA 2GHUA 4FIPA 3LXSA 1SP4B 3O1GA 1PPOA 2R6NA 1CV8A 5A24A 3K8UA 1F2BA 3N4CA 1AU2A 4YYQA 3OVXA 5JH3A 4FK5A 3AI8A 2G6DA 3F5VA 1BGOA 5CVOB 3RVXA 1W4TA 1AECA 2JQGR 1BQIA 3IEJA 1MDWA 2DC7A 2PNSA 2NQDB 1YK8A 2XU5A 2IBIA 4YVAA 1U9QX 1NL6A 3K9MA 2ATOA 2BDLA 1YK7A 2H7JA 4Q8GA 2R9NA 4PI3A 2NQGA 3CH3X 3OISA 3PNRA 2DC9A 4G54A 4X6IA 3P5VA 1GECE 3P5UA 1CSBB 3BC3A 4BS6A 1MIRA 1KXRA 1PPPA 1VJVA 2C0YA 2OULA 2YJ9A 1HUCB 3DF0A 3U8EA 3CBKA 1ATKA 3HD3A 2AYOA 2HH5A 2YJBA 3K24A 3PDFA 1PIPA 3WXFA 4QRGA 1CPJA 1JQPA 4B55A 1KFXL 1MEGA 8PCHA 2AS8A 2FQ9A 2DCBA 1AU4A 4QRVA 3S3RA 4FJCA 1U9VA 2BDZA 3V6EA 3OVZA 4MZOA 1QOLA 3H8CA 2ACTA 4W4UA 2P0RA 4PP1A 1BP4A 3KFQA 3N3KA 2PREA 3IMAA 1SNKA 3QT4A 1CS8A 1ITOA 4YYUA 2PADA 1YT7A 4YV8A 1FH0A 4AXLA 3S3QA 3LFYA 3PBHA 3P5XA 4QRXA 3TNXA 1GMYA 1F2CA 2AUZA 5CVNB 4BSQA 3D9WA 3KSEA 3HHIA 1ZCMA 2YJ8A 2R9OA 2XU1A 4MSXA 3IOQA 3KX1A 2DC6A 3CH2X 4BQVA 1EWLA 2VHSA 4ZUXU 1QDQA 2E02A 2Y5BA 2DCDA 2NQAA 1F2AA 2AU1A 2F7DA 1NB5A 2DJGB 5JA7A 4YYSA 4WA6A 2DZZA 4QBBA 4RY2A 3BPMA 2B1MA 3H8BA 4N8WA 3OF9A 4CDDB 4N4ZA 3HWNA 5EGWA 3P5WA 4CDEB 2E00A 2DC8A 2DCAA 1X9YA 2VFBA 3IUTA 3N3GA 1Y08A 1Q6KA 2P86A 2HHNA 1TL9A 1ME4A 2FTDA 1ZIVA 3C9EA 3RVWA 3HHAA 5CVMA 1CB5A 1STFE 2R9MA 1W6FA 2YJ2A 1O0EA 4NV7A 1CTEA 1XKGA 4BGFA 2NQIA 1EWPA 1TU6A 3E1ZB 2AUXA 5F02A 6PADA 4I05A 4K7CA 2FRQA 2B1NA 2OP3A 2WBFX 3O0UA 3H89A 4OEMA 2Y6EA 1NB3A 2E01A 1DEUA 2R9CA 1EWMA 3I3TA 3LTWA 1KFUL 2HD5A 1AYVA 1PXVA 1IWDA 1KHQA 2OZ2A 1A6RA 4CDFB 1QXPA 2FUDA 1PPDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MS6 A;  1CVZ A;  4Q8H A;  3MOR A;  1AYU A;  2YJC A;  2DCC A;  2AVW A;  4W5C A;  3ZUA A;  4BS5 A;  3WXE A;  4X6J A;  2GFO A;  4DMY A;  4MZS A;  1AIM A;  1NPZ A;  1NQC A;  1U9X A;  1DF0 A;  4PAD A;  3B79 A;  4QH6 A;  1THE A;  3USV A;  1MEM A;  3F75 A;  4BPV A;  2XU3 A;  1PE6 A;  4PP2 E;  1QMY A;  1AYW A;  4YYR A;  3I06 A;  4HWY A;  4YYV A;  3KKU A;  4XUI A;  3PW3 A;  3BWK A;  3CBJ A;  3KWB X;  3NHE A;  1NLJ A;  3BOW A;  1GCB A;  2AYN A;  3MTN A;  1ICF A;  1ME3 A;  2FRA A;  2DJF B;  2CIO A;  1POP A;  4AXM A;  2O6X A;  3WXG A;  2JQF R;  2FT2 A;  2AIM A;  1GLO A;  3M99 A;  1PCI A;  1U5I A;  4CZW A;  1EWO A;  3H6S A;  1PBH A;  4I07 A;  3IHP A;  1U9W A;  4XR7 A;  1PPN A;  2ARY A;  1M6D A;  3MHS A;  1AU3 A;  2IPP B;  1S4V A;  1CQD A;  3D6S A;  1Y4H A;  3V6C A;  1MHW A;  4OEL A;  3KWZ A;  2HXZ A;  1F29 A;  3RVV A;  3MHH A;  1K3B B;  4DMX A;  4KLB A;  5EF4 A;  2G8E A;  5CHV A;  5FPW A;  2E03 A;  2G8J A;  1VSN A;  3H7D A;  4X6H A;  2P7U A;  3QJ3 A;  3QSD A;  2FYE A;  4N79 A;  2FO5 A;  1AU0 A;  1BY8 A;  4W5B A;  1YAL A;  2R9F A;  5PAD A;  4I04 A;  4P6G A;  2XU4 A;  5CHT A;  3IV2 A;  3KW9 A;  3BPF A;  3BCN A;  9PAP A;  3OF8 A;  7PCK A;  3ERV A;  5K16 A;  1PAD A;  2G7Y A;  4CDC B;  2CB5 A;  5J94 A;  1CJL A;  2VHF A;  1EF7 A;  4YYW A;  2DZY A;  4P6E A;  3GCB A;  1YVB A;  1KHP A;  1TLO A;  2F1G A;  2PBH A;  2GHU A;  4FIP A;  3LXS A;  1SP4 B;  3O1G A;  1PPO A;  2R6N A;  1CV8 A;  5A24 A;  3K8U A;  1F2B A;  3N4C A;  1AU2 A;  4YYQ A;  3OVX A;  5JH3 A;  4FK5 A;  3AI8 A;  2G6D A;  3F5V A;  1BGO A;  5CVO B;  3RVX A;  1AEC A;  2JQG R;  1BQI A;  3IEJ A;  1MDW A;  2DC7 A;  2PNS A;  2NQD B;  1YK8 A;  2XU5 A;  2IBI A;  4YVA A;  1U9Q X;  1NL6 A;  3K9M A;  2ATO A;  2BDL A;  1YK7 A;  2H7J A;  4Q8G A;  2R9N A;  4PI3 A;  2NQG A;  3CH3 X;  3OIS A;  3PNR A;  2DC9 A;  4G54 A;  4X6I A;  3P5V A;  1GEC E;  3P5U A;  1CSB B;  3BC3 A;  4BS6 A;  1MIR A;  1KXR A;  1PPP A;  1VJV A;  2C0Y A;  2OUL A;  2YJ9 A;  1HUC B;  3DF0 A;  3U8E A;  3CBK A;  1ATK A;  3HD3 A;  2AYO A;  2HH5 A;  2YJB A;  3K24 A;  3PDF A;  1PIP A;  3WXF A;  4QRG A;  1CPJ A;  1JQP A;  1KFX L;  1MEG A;  8PCH A;  2AS8 A;  2FQ9 A;  2DCB A;  1AU4 A;  4QRV A;  3S3R A;  4FJC A;  1U9V A;  2BDZ A;  3V6E A;  3OVZ A;  4MZO A;  1QOL A;  3H8C A;  2ACT A;  4W4U A;  2P0R A;  4PP1 A;  1BP4 A;  3KFQ A;  3N3K A;  2PRE A;  3IMA A;  1SNK A;  3QT4 A;  1CS8 A;  1ITO A;  4YYU A;  2PAD A;  1YT7 A;  4YV8 A;  1FH0 A;  4AXL A;  3S3Q A;  3LFY A;  3PBH A;  3P5X A;  4QRX A;  3TNX A;  1GMY A;  1F2C A;  2AUZ A;  5CVN B;  4BSQ A;  3KSE A;  3HHI A;  1ZCM A;  2YJ8 A;  2R9O A;  2XU1 A;  4MSX A;  3IOQ A;  3KX1 A;  2DC6 A;  3CH2 X;  4BQV A;  1EWL A;  2VHS A;  4ZUX U;  1QDQ A;  2E02 A;  2Y5B A;  2DCD A;  2NQA A;  1F2A A;  2AU1 A;  2F7D A;  1NB5 A;  2DJG B;  5JA7 A;  4YYS A;  4WA6 A;  2DZZ A;  4QBB A;  4RY2 A;  3BPM A;  2B1M A;  3H8B A;  4N8W A;  3OF9 A;  4CDD B;  4N4Z A;  3HWN A;  5EGW A;  3P5W A;  4CDE B;  2E00 A;  2DC8 A;  2DCA A;  1X9Y A;  3IUT A;  3N3G A;  1Y08 A;  1Q6K A;  2P86 A;  2HHN A;  1TL9 A;  1ME4 A;  2FTD A;  1ZIV A;  3C9E A;  3RVW A;  3HHA A;  5CVM A;  1CB5 A;  1STF E;  2R9M A;  2YJ2 A;  1O0E A;  1CTE A;  1XKG A;  2NQI A;  1EWP A;  1TU6 A;  3E1Z B;  2AUX A;  5F02 A;  6PAD A;  4I05 A;  4K7C A;  2FRQ A;  2B1N A;  2OP3 A;  2WBF X;  3O0U A;  3H89 A;  4OEM A;  2Y6E A;  1NB3 A;  2E01 A;  1DEU A;  2R9C A;  1EWM A;  3I3T A;  1KFU L;  2HD5 A;  1AYV A;  1PXV A;  1IWD A;  1KHQ A;  2OZ2 A;  1A6R A;  4CDF B;  1QXP A;  2FUD A;  1PPD A; 
#chains in the Genus database with same CATH topology
 1MS6 A;  4OW0 A;  1CVZ A;  4Q8H A;  3IFU A;  3MOR A;  1AYU A;  2YJC A;  2DCC A;  4OVZ B;  2AVW A;  4W5C A;  3ZUA A;  3BY4 A;  4BS5 A;  2J7Q A;  3WXE A;  4X6J A;  4BOS A;  2GFO A;  4DMY A;  4M0W A;  4MZS A;  1AIM A;  1NPZ A;  4XZX A;  1NQC A;  1U9X A;  2AGA A;  1DF0 A;  4PAD A;  3B79 A;  4QH6 A;  1THE A;  3USV A;  1MEM A;  2JTC A;  3F75 A;  4BPV A;  2XU3 A;  1PE6 A;  4PP2 E;  1QMY A;  1AYW A;  4YYR A;  3I06 A;  4HWY A;  4YYV A;  3KKU A;  4XUI A;  3PW3 A;  3BWK A;  3CBJ A;  3KWB X;  3NHE A;  1NLJ A;  3BOW A;  1GCB A;  2AYN A;  3MTN A;  1ICF A;  1ME3 A;  2FRA A;  2DJF B;  2CIO A;  4RNA A;  1POP A;  4AXM A;  2O6X A;  3MJ5 A;  3WXG A;  2JQF R;  2FT2 A;  2AIM A;  1GLO A;  3PRM A;  3M99 A;  1PCI A;  1U5I A;  4P16 A;  4CZW A;  1EWO A;  3H6S A;  1PBH A;  4I07 A;  3IHP A;  1U9W A;  4XR7 A;  1PPN A;  2ARY A;  4WUR A;  1M6D A;  3MHS A;  5EZQ A;  1AU3 A;  2IPP B;  1S4V A;  1CQD A;  3D6S A;  1Y4H A;  3V6C A;  1MHW A;  1YZB A;  4OEL A;  3KWZ A;  2HXZ A;  1F29 A;  3RVV A;  3MHH A;  1K3B B;  4DMX A;  4KLB A;  2BTW B;  5EF4 A;  2G8E A;  5CHV A;  5FPW A;  2E03 A;  2G8J A;  1VSN A;  3H7D A;  4X6H A;  2P7U A;  3QJ3 A;  3QSD A;  5E6J A;  2FYE A;  4N79 A;  4RF0 A;  2FO5 A;  4A5U A;  1AU0 A;  1BY8 A;  4W5B A;  1YAL A;  2R9F A;  5PAD A;  4I04 A;  4P6G A;  2JRI A;  3W31 A;  2XU4 A;  5CHT A;  3IV2 A;  4BOP A;  3KW9 A;  3BPF A;  3BCN A;  9PAP A;  3OF8 A;  1DKI A;  7PCK A;  3ERV A;  5K16 A;  1PAD A;  2G7Y A;  4CDC B;  2CB5 A;  5J94 A;  1CJL A;  2VHF A;  1EF7 A;  4YYW A;  2DZY A;  4P6E A;  3GCB A;  2HWK A;  1YVB A;  1KHP A;  1TLO A;  2F1G A;  2PBH A;  2GHU A;  3W30 A;  4D8B A;  4FIP A;  3LXS A;  1SP4 B;  3O1G A;  1PPO A;  2R6N A;  1CV8 A;  5A24 A;  3K8U A;  1F2B A;  3N4C A;  1AU2 A;  3PHW A;  4ZTB A;  4YYQ A;  3OVX A;  5JH3 A;  4FK5 A;  3AI8 A;  2G6D A;  3F5V A;  1BGO A;  5CVO B;  3RVX A;  2FE8 A;  1AEC A;  2JQG R;  1BQI A;  3IEJ A;  1MDW A;  4HXD B;  2DC7 A;  2PNS A;  4REZ A;  3E9S A;  2NQD B;  1YK8 A;  2XU5 A;  2IBI A;  4YVA A;  1U9Q X;  1NL6 A;  3K9M A;  2ATO A;  2BDL A;  1YK7 A;  3MTV A;  2H7J A;  4Q8G A;  2R9N A;  4PI3 A;  2NQG A;  3CH3 X;  3OIS A;  3PNR A;  2DC9 A;  4G54 A;  4X6I A;  3P5V A;  1GEC E;  3MP2 A;  3P5U A;  1CSB B;  3BC3 A;  4BS6 A;  1MIR A;  1KXR A;  1PPP A;  3TMP A;  4RF1 A;  1VJV A;  2C0Y A;  2OUL A;  4BOQ A;  3RNV A;  2YJ9 A;  1HUC B;  3DF0 A;  3U8E A;  3CBK A;  2DOS A;  1ATK A;  3HD3 A;  2AYO A;  2HH5 A;  2YJB A;  3K24 A;  3PDF A;  3O65 A;  1PIP A;  3WXF A;  4QRG A;  1CPJ A;  1JQP A;  1KFX L;  4PT5 A;  1MEG A;  8PCH A;  2AS8 A;  2FQ9 A;  2DCB A;  1AU4 A;  4QRV A;  3S3R A;  4FJC A;  1U9V A;  2BDZ A;  5JZE A;  3B21 A;  3V6E A;  3OVZ A;  4MZO A;  1QOL A;  3H8C A;  4D8E A;  2ACT A;  4W4U A;  2P0R A;  5KO3 A;  4PP1 A;  1BP4 A;  3KFQ A;  3N3K A;  3PHX A;  4RKX A;  2PRE A;  4OVZ A;  3IMA A;  1SNK A;  3QT4 A;  1CS8 A;  1ITO A;  3C0R A;  4R3D A;  4YYU A;  2PAD A;  1YT7 A;  4YV8 A;  1FH0 A;  4AXL A;  3PRP A;  3S3Q A;  3LFY A;  3PBH A;  3P5X A;  4QRX A;  3TNX A;  1GMY A;  1F2C A;  2AUZ A;  5CVN B;  4BSQ A;  3KSE A;  3HHI A;  1ZCM A;  2YJ8 A;  2R9O A;  4D8I A;  2XU1 A;  4MSX A;  3IOQ A;  3KX1 A;  2DC6 A;  3CH2 X;  3PT2 A;  4BQV A;  1EWL A;  2VHS A;  4ZUX U;  1QDQ A;  2E02 A;  2Y5B A;  2DCD A;  2NQA A;  1F2A A;  2AU1 A;  2F7D A;  1NB5 A;  2DJG B;  5JA7 A;  4YYS A;  4WA6 A;  2DZZ A;  4QBB A;  4RY2 A;  3BBA A;  4GUA A;  3BPM A;  4BOU A;  4MM3 B;  2B1M A;  3H8B A;  4N8W A;  4BOZ A;  3OF9 A;  4CDD B;  4N4Z A;  3HWN A;  5EGW A;  3P5W A;  4CDE B;  2E00 A;  2DC8 A;  2UZJ A;  2DCA A;  1X9Y A;  3IUT A;  1UKF A;  3N3G A;  1Y08 A;  1Q6K A;  2P86 A;  2HHN A;  1TL9 A;  3BB7 A;  1ME4 A;  2FTD A;  1ZIV A;  3C9E A;  3RVW A;  3OQC A;  3PHU A;  2BTW A;  3HHA A;  4IUM A;  5CVM A;  1CB5 A;  1STF E;  2R9M A;  2YJ2 A;  1O0E A;  1CTE A;  1XKG A;  5EZS A;  2NQI A;  3TRK A;  4IP3 A;  1EWP A;  1TU6 A;  3E1Z B;  2AUX A;  5F02 A;  6PAD A;  4I05 A;  4K7C A;  2FRQ A;  2B1N A;  2J7Q C;  1PVJ A;  2OP3 A;  3PSE A;  4MI7 A;  2WBF X;  2Z84 A;  3O0U A;  3H89 A;  4OEM A;  2Y6E A;  1NB3 A;  3ZNH A;  2E01 A;  1DEU A;  2R9C A;  1EWM A;  3I3T A;  1KFU L;  2HD5 A;  1AYV A;  1PXV A;  1IWD A;  2BU3 A;  1KHQ A;  2OZ2 A;  1A6R A;  4CDF B;  1QXP A;  2FUD A;  1PPD A; 
#chains in the Genus database with same CATH homology
 1GX3 A;  1MS6 A;  4C5P A;  1CVZ A;  4Q8H A;  3MOR A;  1AYU A;  2YJC A;  2DCC A;  2AVW A;  4W5C A;  3ZUA A;  4BS5 A;  3WXE A;  4X6J A;  2GFO A;  4DMY A;  4MZS A;  1AIM A;  1NPZ A;  1NQC A;  1U9X A;  1DF0 A;  4PAD A;  3B79 A;  4QH6 A;  1THE A;  3USV A;  1MEM A;  3F75 A;  4BPV A;  2XU3 A;  1PE6 A;  4PP2 E;  1QMY A;  1AYW A;  4YYR A;  3I06 A;  4HWY A;  4YYV A;  3KKU A;  4XUI A;  3PW3 A;  3BWK A;  3CBJ A;  3KWB X;  3NHE A;  1NLJ A;  3BOW A;  1GCB A;  2VFC A;  2AYN A;  3MTN A;  1ICF A;  1ME3 A;  2FRA A;  2DJF B;  2CIO A;  1POP A;  4AXM A;  2O6X A;  3WXG A;  2JQF R;  2FT2 A;  2AIM A;  1GLO A;  3M99 A;  1PCI A;  1U5I A;  4CZW A;  1EWO A;  3H6S A;  1PBH A;  4I07 A;  3IHP A;  1U9W A;  4XR7 A;  1PPN A;  2ARY A;  1M6D A;  3MHS A;  4GUZ A;  1AU3 A;  2IPP B;  1S4V A;  1CQD A;  3D6S A;  1Y4H A;  3V6C A;  1MHW A;  4OEL A;  3KWZ A;  2HXZ A;  1F29 A;  3RVV A;  3MHH A;  1K3B B;  4DMX A;  4KLB A;  5EF4 A;  2G8E A;  1W5R A;  5CHV A;  5FPW A;  2E03 A;  2G8J A;  1VSN A;  3H7D A;  4X6H A;  2P7U A;  3QJ3 A;  3QSD A;  2FYE A;  4N79 A;  2FO5 A;  1AU0 A;  1BY8 A;  4W5B A;  1YAL A;  2R9F A;  5PAD A;  4I04 A;  4P6G A;  2XU4 A;  5CHT A;  3IV2 A;  3KW9 A;  4NV8 A;  3BPF A;  3BCN A;  9PAP A;  3OF8 A;  2BSZ A;  7PCK A;  3ERV A;  5K16 A;  1PAD A;  2G7Y A;  4CDC B;  2CB5 A;  1E2T A;  5J94 A;  1CJL A;  2VHF A;  1EF7 A;  4YYW A;  2DZY A;  4P6E A;  3GCB A;  1YVB A;  1KHP A;  1TLO A;  2F1G A;  2PBH A;  2GHU A;  4FIP A;  3LXS A;  1SP4 B;  3O1G A;  1PPO A;  2R6N A;  1CV8 A;  5A24 A;  3K8U A;  1F2B A;  3N4C A;  1AU2 A;  4YYQ A;  3OVX A;  5JH3 A;  4FK5 A;  3AI8 A;  2G6D A;  3F5V A;  1BGO A;  5CVO B;  3RVX A;  1W4T A;  1AEC A;  2JQG R;  1BQI A;  3IEJ A;  1MDW A;  2DC7 A;  2PNS A;  2NQD B;  1YK8 A;  2XU5 A;  2IBI A;  4YVA A;  1U9Q X;  1NL6 A;  3K9M A;  2ATO A;  2BDL A;  1YK7 A;  2H7J A;  4Q8G A;  2R9N A;  4PI3 A;  2NQG A;  3CH3 X;  3OIS A;  3PNR A;  2DC9 A;  4G54 A;  4X6I A;  3P5V A;  1GEC E;  3P5U A;  1CSB B;  3BC3 A;  4BS6 A;  1MIR A;  1KXR A;  1PPP A;  1VJV A;  2C0Y A;  2OUL A;  2YJ9 A;  1HUC B;  3DF0 A;  3U8E A;  3CBK A;  1ATK A;  3HD3 A;  2AYO A;  2HH5 A;  2YJB A;  3K24 A;  3PDF A;  1PIP A;  3WXF A;  4QRG A;  1CPJ A;  1JQP A;  4B55 A;  1KFX L;  1MEG A;  8PCH A;  2AS8 A;  2FQ9 A;  2DCB A;  1AU4 A;  4QRV A;  3S3R A;  4FJC A;  1U9V A;  2BDZ A;  3V6E A;  3OVZ A;  4MZO A;  1QOL A;  3H8C A;  2ACT A;  4W4U A;  2P0R A;  4PP1 A;  1BP4 A;  3KFQ A;  3N3K A;  2PRE A;  3IMA A;  1SNK A;  3QT4 A;  1CS8 A;  1ITO A;  4YYU A;  2PAD A;  1YT7 A;  4YV8 A;  1FH0 A;  4AXL A;  3S3Q A;  3LFY A;  3PBH A;  3P5X A;  4QRX A;  3TNX A;  1GMY A;  1F2C A;  2AUZ A;  5CVN B;  4BSQ A;  3D9W A;  3KSE A;  3HHI A;  1ZCM A;  2YJ8 A;  2R9O A;  2XU1 A;  4MSX A;  3IOQ A;  3KX1 A;  2DC6 A;  3CH2 X;  4BQV A;  1EWL A;  2VHS A;  4ZUX U;  1QDQ A;  2E02 A;  2Y5B A;  2DCD A;  2NQA A;  1F2A A;  2AU1 A;  2F7D A;  1NB5 A;  2DJG B;  5JA7 A;  4YYS A;  4WA6 A;  2DZZ A;  4QBB A;  4RY2 A;  3BPM A;  2B1M A;  3H8B A;  4N8W A;  3OF9 A;  4CDD B;  4N4Z A;  3HWN A;  5EGW A;  3P5W A;  4CDE B;  2E00 A;  2DC8 A;  2DCA A;  1X9Y A;  2VFB A;  3IUT A;  3N3G A;  1Y08 A;  1Q6K A;  2P86 A;  2HHN A;  1TL9 A;  1ME4 A;  2FTD A;  1ZIV A;  3C9E A;  3RVW A;  3HHA A;  5CVM A;  1CB5 A;  1STF E;  2R9M A;  1W6F A;  2YJ2 A;  1O0E A;  4NV7 A;  1CTE A;  1XKG A;  4BGF A;  2NQI A;  1EWP A;  1TU6 A;  3E1Z B;  2AUX A;  5F02 A;  6PAD A;  4I05 A;  4K7C A;  2FRQ A;  2B1N A;  2OP3 A;  2WBF X;  3O0U A;  3H89 A;  4OEM A;  2Y6E A;  1NB3 A;  2E01 A;  1DEU A;  2R9C A;  1EWM A;  3I3T A;  3LTW A;  1KFU L;  2HD5 A;  1AYV A;  1PXV A;  1IWD A;  1KHQ A;  2OZ2 A;  1A6R A;  4CDF B;  1QXP A;  2FUD A;  1PPD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...