1ZCMA

Human calpain protease core inhibited by zllych2f
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
321
structure length
321
Chain Sequence
NAIKYLGQDYEQLRVRCLQSGTLFRDEAFPPVPQSLGYKDLGPNSSKTYGIKWKRPTELLSNPQFIVDGATRTDICQGALGDCWLLAAIASLTLNDTLLHRVVPHGQSFQNGYAGIFHFQLWQFGEWVDVVVDDLLPIKDGKLVFVHSAEGNEFWSALLEKAYAKVNGSYEALSGGSTSEAFEDFTGGVTEWYELRKAPSDLYQIILKALERGSLLGCSIDISSVLDMEAITFKKLVKGHAYSVTGAKQVNYRGQVVSLIRMRNPWGEVEWTGAWSDSSSEWNNVDPYERDQLRVKMEDGEFWMSFRDFMREFTRLEICNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calpain 1, large [catalytic] subunit
publication title Molecular mode of action of a covalently inhibiting peptidomimetic on the human calpain protease core
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 98
structure length 321
sequence length 321
ec nomenclature ec 3.4.22.52: Calpain-1.
pdb deposition date 2005-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00648 Peptidase_C2 Calpain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1zcmA02
1CJLA 1O0EA 2H7JA 9PAPA 5FPWA 1F29A 4YYUA 1GMYA 2G8JA 1Y08A 2Y6EA 4HWYA 1EWLA 3QT4A 2AUXA 4BS6A 3DF0A 4OELA 4YYQA 1BY8A 1MEGA 1ZCMA 2BDZA 2AYOA 3LFYA 4I04A 4YV8A 1ATKA 3AI8A 4N4ZA 1CV8A 4K7CA 1YVBA 4QH6A 2FT2A 2R9NA 1STFE 4CDCB 1PADA 1KXRA 3BC3A 2E02A 2P7UA 3BCNA 4MZOA 2DZZA 1KFXL 2P86A 2OP3A 4PI3A 1GCBA 2DC8A 1QXPA 2GHUA 1XKGA 3WXGA 4N79A 3RVWA 4Q8HA 2PBHA 4QRXA 1U5IA 3KX1A 3D6SA 1PPDA 3HWNA 2HXZA 3KSEA 1PPNA 2PADA 2XU5A 1PIPA 2R9OA 4FIPA 2YJCA 1CVZA 1QOLA 2P0RA 3KW9A 5CVMA 4KLBA 4X6IA 5EF4A 1AIMA 3RVVA 2DCDA 3B79A 1X9YA 4BS5A 2BDLA 2IPPB 3OF8A 2ACTA 3CBJA 2FO5A 1EF7A 2B1NA 3QSDA 1AYVA 1S4VA 3QJ3A 3HHIA 5J94A 1AU3A 1SP4B 1BGOA 1KFUL 2CB5A 4FJCA 1YT7A 1M6DA 2DZYA 1AYWA 1ITOA 2FRQA 3RVXA 1QMYA 7PCKA 5K16A 2C0YA 2AS8A 3BPFA 5PADA 2XU3A 1GLOA 1SNKA 1A6RA 1PPOA 2NQIA 2AYNA 2YJ8A 2DCAA 3C9EA 3IOQA 3I06A 3V6EA 3MORA 4QRGA 1VJVA 3IUTA 3U8EA 2VHFA 2VHSA 3K9MA 4W4UA 2G7YA 3H7DA 3ZUAA 3HHAA 3MTNA 2Y5BA 4MSXA 2G6DA 1NB5A 3O0UA 4RY2A 3OISA 4P6EA 1CQDA 1VSNA 3KWBX 1PPPA 1ICFA 2OZ2A 1NQCA 3H8BA 5JA7A 2HD5A 4BSQA 1MS6A 1THEA 3OVZA 2IBIA 1U9XA 3PW3A 2R9CA 1U9QX 1YK8A 4DMXA 4OEMA 4MZSA 2DC9A 3ERVA 3S3RA 1NL6A 3N3KA 1MIRA 1EWPA 1AU4A 2FRAA 4CDFB 4YYWA 2ATOA 2PNSA 5F02A 4W5CA 1AYUA 1GECE 3IEJA 1F2CA 3USVA 2AUZA 1CTEA 4AXLA 2FUDA 2F7DA 4P6GA 2NQDB 1TL9A 5JH3A 1PCIA 2JQFR 1QDQA 2DCBA 2NQAA 1KHQA 4CDDB 2R9MA 3HD3A 1POPA 3P5UA 3M99A 4YVAA 2DC6A 2CIOA 5CHTA 2E01A 3P5XA 3S3QA 2DJGB 1AECA 1NPZA 3P5VA 4XUIA 1PE6A 3OF9A 3N4CA 2AU1A 2E03A 2F1GA 4QBBA 3LXSA 2YJ2A 6PADA 2DCCA 1F2AA 3K24A 1TLOA 3PNRA 2YJBA 3WXFA 4QRVA 3F5VA 2R9FA 1PBHA 1CS8A 1BQIA 1AU2A 2GFOA 2HH5A 2WBFX 3K8UA 5A24A 1AU0A 3NHEA 4PP2E 1MHWA 3BWKA 2ARYA 4AXMA 1FH0A 2NQGA 1EWOA 4CZWA 4X6JA 3I3TA 3O1GA 2G8EA 1ME3A 2E00A 3CBKA 1NLJA 3KFQA 1NB3A 2FQ9A 2FYEA 3N3GA 1MEMA 4ZUXU 4X6HA 1DEUA 2JQGR 1K3BB 1CPJA 1MDWA 1ZIVA 1EWMA 1TU6A 3OVXA 3E1ZB 1IWDA 2O6XA 1U9WA 2OULA 3KWZA 4PADA 3TNXA 2XU4A 1JQPA 3MHSA 2R6NA 2B1MA 3H89A 3IV2A 1BP4A 4PP1A 3IMAA 4BPVA 1YK7A 4W5BA 3H6SA 4FK5A 1U9VA 3P5WA 4YYSA 1ME4A 8PCHA 3PDFA 4BQVA 3IHPA 3MHHA 5CVOB 3WXEA 4WA6A 2DC7A 4I07A 4G54A 2YJ9A 2FTDA 4DMYA 3H8CA 1PXVA 1Q6KA 4XR7A 2AVWA 1F2BA 2DJFB 3F75A 2HHNA 5CVNB 5CHVA 1KHPA 4I05A 4YYRA 2PREA 3GCBA 1HUCB 4N8WA 3KKUA 2AIMA 3V6CA 1CB5A 1Y4HA 3PBHA 3BOWA 1YALA 1CSBB 2XU1A 4Q8GA 1DF0A 3CH2X 3CH3X 4CDEB 5EGWA 4YYVA 3BPMA
chains in the Genus database with same CATH superfamily
1CJLA 1O0EA 2H7JA 9PAPA 5FPWA 1F29A 4YYUA 1GMYA 2G8JA 1Y08A 2Y6EA 4HWYA 1EWLA 3QT4A 4WURA 2AUXA 4GUAA 4IUMA 4RF1A 4BS6A 3DF0A 4OELA 4YYQA 1BY8A 1MEGA 1ZCMA 2BDZA 2AYOA 3LFYA 4I04A 4YV8A 1ATKA 4OVZB 3AI8A 4N4ZA 1CV8A 4K7CA 1YVBA 4QH6A 2FT2A 3W30A 2R9NA 1STFE 4CDCB 1PADA 1KXRA 3BC3A 2E02A 4BOZA 2P7UA 3BCNA 4MZOA 2DZZA 1KFXL 2P86A 2OP3A 4PI3A 1GCBA 2DC8A 1QXPA 2GHUA 1XKGA 3WXGA 4N79A 3RVWA 4Q8HA 2PBHA 4QRXA 1U5IA 4R3DA 3KX1A 3D6SA 1PPDA 3HWNA 2HXZA 3KSEA 1PPNA 2PADA 2XU5A 1PIPA 2R9OA 4FIPA 2YJCA 1CVZA 1QOLA 5JZEA 2P0RA 3KW9A 5CVMA 4IP3A 4KLBA 2J7QA 4X6IA 5EF4A 1AIMA 3BY4A 3RVVA 2DCDA 4D8IA 3B79A 1X9YA 4BS5A 2BDLA 2IPPB 3OF8A 3BBAA 2ACTA 3CBJA 4RF0A 2FO5A 1EF7A 1YZBA 2B1NA 3QSDA 3PHUA 1AYVA 2BU3A 5EZQA 1S4VA 3QJ3A 3HHIA 5J94A 1AU3A 1SP4B 1BGOA 1KFUL 2CB5A 4FJCA 1YT7A 3TRKA 1M6DA 2DZYA 3PSEA 1AYWA 1ITOA 2FRQA 3RVXA 1QMYA 7PCKA 5K16A 5EZSA 2C0YA 3RNVA 2AS8A 3BPFA 5PADA 2XU3A 1GLOA 1SNKA 1A6RA 1PPOA 2NQIA 2AYNA 3E9SA 2YJ8A 2DCAA 3C9EA 4D8EA 3IOQA 3I06A 3V6EA 3MORA 4QRGA 1VJVA 3IUTA 3U8EA 2VHFA 2VHSA 3K9MA 4W4UA 2G7YA 2BTWA 3H7DA 3HHAA 3ZUAA 3MTNA 2Y5BA 4MSXA 3C0RA 4XZXA 4REZA 2G6DA 1NB5A 3O0UA 4RY2A 3OISA 4P6EA 1CQDA 1VSNA 3KWBX 1PPPA 1ICFA 2OZ2A 1NQCA 3H8BA 5JA7A 2HD5A 4BSQA 1MS6A 1THEA 3OVZA 4ZTBA 2IBIA 4P16A 1U9XA 3PW3A 2R9CA 1U9QX 1YK8A 4DMXA 4OEMA 4MZSA 2DC9A 3ERVA 3S3RA 1NL6A 3N3KA 1MIRA 1EWPA 2J7QC 1AU4A 2FRAA 4CDFB 2HWKA 4YYWA 4RNAA 2ATOA 2PNSA 5F02A 3BB7A 4W5CA 1AYUA 1GECE 1UKFA 3IEJA 1F2CA 2DOSA 3USVA 4PT5A 4OVZA 4A5UA 2AUZA 1CTEA 4AXLA 2FUDA 2F7DA 4P6GA 2NQDB 1TL9A 5JH3A 2UZJA 1PCIA 2JQFR 1QDQA 2DCBA 3IFUA 2NQAA 1KHQA 4D8BA 4CDDB 2R9MA 4BOQA 3HD3A 1POPA 3PHWA 3P5UA 3M99A 4YVAA 2DC6A 2CIOA 4OW0A 5CHTA 2E01A 3P5XA 4BOPA 3S3QA 3TMPA 2DJGB 1AECA 3O65A 1NPZA 3P5VA 4XUIA 1PE6A 3OF9A 3N4CA 2AU1A 2E03A 2F1GA 4QBBA 3LXSA 4M0WA 2YJ2A 3PT2A 6PADA 2DCCA 1F2AA 3K24A 1TLOA 2Z84A 3PNRA 2YJBA 3WXFA 4QRVA 2FE8A 3F5VA 2R9FA 1PBHA 1CS8A 1BQIA 1AU2A 2GFOA 2HH5A 2WBFX 4MI7A 3K8UA 5A24A 1AU0A 3NHEA 3MJ5A 4PP2E 1MHWA 3BWKA 2ARYA 4AXMA 1FH0A 2NQGA 4RKXA 1EWOA 4HXDB 4CZWA 1PVJA 4X6JA 3I3TA 3O1GA 2G8EA 1ME3A 1DKIA 2E00A 3CBKA 1NLJA 3KFQA 1NB3A 2FQ9A 3MP2A 2FYEA 3N3GA 1MEMA 4ZUXU 4X6HA 1DEUA 2JQGR 1K3BB 1CPJA 5KO3A 1MDWA 1ZIVA 1EWMA 1TU6A 3OVXA 3PHXA 3MTVA 3E1ZB 1IWDA 2O6XA 1U9WA 2OULA 3KWZA 4PADA 3TNXA 2XU4A 1JQPA 3PRPA 3MHSA 2R6NA 2B1MA 3H89A 3IV2A 1BP4A 4PP1A 3IMAA 4BPVA 1YK7A 4W5BA 2JTCA 3H6SA 2JRIA 4FK5A 4MM3B 1U9VA 3P5WA 4YYSA 1ME4A 8PCHA 3PDFA 4BQVA 3IHPA 3MHHA 5CVOB 3WXEA 4WA6A 3W31A 2DC7A 4I07A 4G54A 2YJ9A 2FTDA 4DMYA 3H8CA 1PXVA 3B21A 3OQCA 1Q6KA 4XR7A 2AVWA 2AGAA 1F2BA 2DJFB 3F75A 2HHNA 5CVNB 4BOSA 5CHVA 1KHPA 4I05A 4YYRA 2PREA 3GCBA 1HUCB 4N8WA 2BTWB 3KKUA 2AIMA 3V6CA 1CB5A 1Y4HA 3PBHA 3BOWA 1YALA 1CSBB 2XU1A 4Q8GA 4BOUA 3ZNHA 1DF0A 3CH2X 3PRMA 3CH3X 4CDEB 5EGWA 4YYVA 5E6JA 3BPMA
chains in the Genus database with same CATH topology
1CJLA 1O0EA 2H7JA 9PAPA 5FPWA 1F29A 4YYUA 1GMYA 2G8JA 1Y08A 2Y6EA 4HWYA 1EWLA 1W4TA 3QT4A 2AUXA 4BS6A 3DF0A 4OELA 4YYQA 1BY8A 1MEGA 1ZCMA 2BDZA 2AYOA 3LFYA 4NV8A 4I04A 4YV8A 1ATKA 3AI8A 4N4ZA 1CV8A 4K7CA 1YVBA 4QH6A 2FT2A 2R9NA 1STFE 4CDCB 1PADA 1KXRA 3BC3A 2E02A 2P7UA 3BCNA 4MZOA 2DZZA 1KFXL 2P86A 2OP3A 4PI3A 1GCBA 2DC8A 1QXPA 2GHUA 1XKGA 3WXGA 4N79A 3RVWA 4Q8HA 2PBHA 4QRXA 1U5IA 3KX1A 3D6SA 1PPDA 3HWNA 2HXZA 3KSEA 1PPNA 2PADA 2XU5A 1PIPA 2R9OA 4FIPA 2YJCA 1CVZA 1QOLA 2P0RA 3KW9A 5CVMA 4KLBA 4X6IA 5EF4A 1AIMA 3RVVA 2DCDA 3B79A 1X9YA 4BS5A 2BDLA 2IPPB 3OF8A 2ACTA 3CBJA 2FO5A 1EF7A 2B1NA 3QSDA 3LTWA 1AYVA 1S4VA 3QJ3A 3HHIA 5J94A 1AU3A 1SP4B 1BGOA 1KFUL 2CB5A 4FJCA 1YT7A 1M6DA 2DZYA 1AYWA 1ITOA 2FRQA 3RVXA 1QMYA 7PCKA 5K16A 2C0YA 2AS8A 3BPFA 5PADA 2XU3A 1GLOA 1SNKA 1A6RA 1PPOA 2NQIA 1W6FA 2AYNA 2YJ8A 2DCAA 3C9EA 3IOQA 3I06A 3V6EA 3MORA 4QRGA 1VJVA 3IUTA 3U8EA 2VHFA 2VHSA 3K9MA 4W4UA 2G7YA 3H7DA 3ZUAA 3HHAA 3MTNA 2Y5BA 1W5RA 4MSXA 2G6DA 1NB5A 3O0UA 4RY2A 3OISA 4P6EA 1CQDA 1VSNA 3KWBX 1PPPA 1ICFA 2OZ2A 1NQCA 3H8BA 5JA7A 2HD5A 4BSQA 1MS6A 1THEA 3OVZA 2IBIA 1U9XA 3PW3A 2R9CA 1U9QX 1YK8A 4DMXA 4OEMA 4MZSA 2DC9A 3ERVA 3S3RA 4NV7A 1NL6A 3N3KA 1MIRA 1EWPA 1AU4A 2FRAA 4CDFB 4YYWA 2ATOA 2PNSA 5F02A 4W5CA 1AYUA 1GECE 3IEJA 1F2CA 3USVA 2AUZA 1CTEA 4AXLA 2FUDA 2F7DA 4P6GA 2NQDB 1TL9A 5JH3A 1PCIA 2JQFR 1QDQA 2DCBA 2NQAA 1KHQA 4CDDB 2R9MA 3HD3A 1POPA 3P5UA 3M99A 4YVAA 2DC6A 2CIOA 5CHTA 2E01A 3P5XA 3S3QA 2DJGB 1AECA 1NPZA 3P5VA 4XUIA 1PE6A 3OF9A 3N4CA 2AU1A 2E03A 2F1GA 4QBBA 3LXSA 2YJ2A 6PADA 2DCCA 1F2AA 3K24A 1TLOA 3PNRA 2YJBA 3WXFA 4QRVA 3F5VA 1E2TA 2R9FA 1PBHA 1CS8A 1BQIA 1AU2A 2GFOA 2HH5A 2WBFX 3K8UA 5A24A 1AU0A 3NHEA 4PP2E 1MHWA 3BWKA 2ARYA 4AXMA 1FH0A 2NQGA 1EWOA 4CZWA 4X6JA 3D9WA 3I3TA 3O1GA 2G8EA 1ME3A 2E00A 3CBKA 1NLJA 3KFQA 1NB3A 2FQ9A 2FYEA 3N3GA 1MEMA 4ZUXU 4C5PA 4X6HA 2BSZA 1DEUA 2JQGR 1K3BB 1CPJA 1MDWA 1ZIVA 1EWMA 1TU6A 3OVXA 3E1ZB 1IWDA 2O6XA 1U9WA 4BGFA 2OULA 3KWZA 4PADA 3TNXA 2XU4A 1JQPA 3MHSA 2R6NA 2B1MA 3H89A 3IV2A 1BP4A 4PP1A 3IMAA 4BPVA 1YK7A 4W5BA 3H6SA 2VFBA 4FK5A 1U9VA 3P5WA 4YYSA 1ME4A 8PCHA 3PDFA 4BQVA 3IHPA 3MHHA 5CVOB 4B55A 3WXEA 4WA6A 2DC7A 4I07A 4G54A 2YJ9A 2FTDA 4DMYA 3H8CA 1PXVA 1Q6KA 1GX3A 4XR7A 2AVWA 1F2BA 2DJFB 2VFCA 2HHNA 3F75A 5CVNB 5CHVA 1KHPA 4I05A 4YYRA 2PREA 3GCBA 1HUCB 4N8WA 3KKUA 2AIMA 3V6CA 1CB5A 1Y4HA 3PBHA 3BOWA 4GUZA 1YALA 1CSBB 2XU1A 4Q8GA 1DF0A 3CH2X 3CH3X 4CDEB 5EGWA 4YYVA 3BPMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CJL A;  1O0E A;  2H7J A;  9PAP A;  5FPW A;  1F29 A;  4YYU A;  1GMY A;  2G8J A;  1Y08 A;  2Y6E A;  4HWY A;  1EWL A;  3QT4 A;  2AUX A;  4BS6 A;  3DF0 A;  4OEL A;  4YYQ A;  1BY8 A;  1MEG A;  1ZCM A;  2BDZ A;  2AYO A;  3LFY A;  4I04 A;  4YV8 A;  1ATK A;  3AI8 A;  4N4Z A;  1CV8 A;  4K7C A;  1YVB A;  4QH6 A;  2FT2 A;  2R9N A;  1STF E;  4CDC B;  1PAD A;  1KXR A;  3BC3 A;  2E02 A;  2P7U A;  3BCN A;  4MZO A;  2DZZ A;  1KFX L;  2P86 A;  2OP3 A;  4PI3 A;  1GCB A;  2DC8 A;  1QXP A;  2GHU A;  1XKG A;  3WXG A;  4N79 A;  3RVW A;  4Q8H A;  2PBH A;  4QRX A;  1U5I A;  3KX1 A;  3D6S A;  1PPD A;  3HWN A;  2HXZ A;  3KSE A;  1PPN A;  2PAD A;  2XU5 A;  1PIP A;  2R9O A;  4FIP A;  2YJC A;  1CVZ A;  1QOL A;  2P0R A;  3KW9 A;  5CVM A;  4KLB A;  4X6I A;  5EF4 A;  1AIM A;  3RVV A;  2DCD A;  3B79 A;  1X9Y A;  4BS5 A;  2BDL A;  2IPP B;  3OF8 A;  2ACT A;  3CBJ A;  2FO5 A;  1EF7 A;  2B1N A;  3QSD A;  1AYV A;  1S4V A;  3QJ3 A;  3HHI A;  5J94 A;  1AU3 A;  1SP4 B;  1BGO A;  1KFU L;  2CB5 A;  4FJC A;  1YT7 A;  1M6D A;  2DZY A;  1AYW A;  1ITO A;  2FRQ A;  3RVX A;  1QMY A;  7PCK A;  5K16 A;  2C0Y A;  2AS8 A;  3BPF A;  5PAD A;  2XU3 A;  1GLO A;  1SNK A;  1A6R A;  1PPO A;  2NQI A;  2AYN A;  2YJ8 A;  2DCA A;  3C9E A;  3IOQ A;  3I06 A;  3V6E A;  3MOR A;  4QRG A;  1VJV A;  3IUT A;  3U8E A;  2VHF A;  2VHS A;  3K9M A;  4W4U A;  2G7Y A;  3H7D A;  3ZUA A;  3HHA A;  3MTN A;  2Y5B A;  4MSX A;  2G6D A;  1NB5 A;  3O0U A;  4RY2 A;  3OIS A;  4P6E A;  1CQD A;  1VSN A;  3KWB X;  1PPP A;  1ICF A;  2OZ2 A;  1NQC A;  3H8B A;  5JA7 A;  2HD5 A;  4BSQ A;  1MS6 A;  1THE A;  3OVZ A;  2IBI A;  1U9X A;  3PW3 A;  2R9C A;  1U9Q X;  1YK8 A;  4DMX A;  4OEM A;  4MZS A;  2DC9 A;  3ERV A;  3S3R A;  1NL6 A;  3N3K A;  1MIR A;  1EWP A;  1AU4 A;  2FRA A;  4CDF B;  4YYW A;  2ATO A;  2PNS A;  5F02 A;  4W5C A;  1AYU A;  1GEC E;  3IEJ A;  1F2C A;  3USV A;  2AUZ A;  1CTE A;  4AXL A;  2FUD A;  2F7D A;  4P6G A;  2NQD B;  1TL9 A;  5JH3 A;  1PCI A;  2JQF R;  1QDQ A;  2DCB A;  2NQA A;  1KHQ A;  4CDD B;  2R9M A;  3HD3 A;  1POP A;  3P5U A;  3M99 A;  4YVA A;  2DC6 A;  2CIO A;  5CHT A;  2E01 A;  3P5X A;  3S3Q A;  2DJG B;  1AEC A;  1NPZ A;  3P5V A;  4XUI A;  1PE6 A;  3OF9 A;  3N4C A;  2AU1 A;  2E03 A;  2F1G A;  4QBB A;  3LXS A;  2YJ2 A;  6PAD A;  2DCC A;  1F2A A;  3K24 A;  1TLO A;  3PNR A;  2YJB A;  3WXF A;  4QRV A;  3F5V A;  2R9F A;  1PBH A;  1CS8 A;  1BQI A;  1AU2 A;  2GFO A;  2HH5 A;  2WBF X;  3K8U A;  5A24 A;  1AU0 A;  3NHE A;  4PP2 E;  1MHW A;  3BWK A;  2ARY A;  4AXM A;  1FH0 A;  2NQG A;  1EWO A;  4CZW A;  4X6J A;  3I3T A;  3O1G A;  2G8E A;  1ME3 A;  2E00 A;  3CBK A;  1NLJ A;  3KFQ A;  1NB3 A;  2FQ9 A;  2FYE A;  3N3G A;  1MEM A;  4ZUX U;  4X6H A;  1DEU A;  2JQG R;  1K3B B;  1CPJ A;  1MDW A;  1ZIV A;  1EWM A;  1TU6 A;  3OVX A;  3E1Z B;  1IWD A;  2O6X A;  1U9W A;  2OUL A;  3KWZ A;  4PAD A;  3TNX A;  2XU4 A;  1JQP A;  3MHS A;  2R6N A;  2B1M A;  3H89 A;  3IV2 A;  1BP4 A;  4PP1 A;  3IMA A;  4BPV A;  1YK7 A;  4W5B A;  3H6S A;  4FK5 A;  1U9V A;  3P5W A;  4YYS A;  1ME4 A;  8PCH A;  3PDF A;  4BQV A;  3IHP A;  3MHH A;  5CVO B;  3WXE A;  4WA6 A;  2DC7 A;  4I07 A;  4G54 A;  2YJ9 A;  2FTD A;  4DMY A;  3H8C A;  1PXV A;  1Q6K A;  4XR7 A;  2AVW A;  1F2B A;  2DJF B;  3F75 A;  2HHN A;  5CVN B;  5CHV A;  1KHP A;  4I05 A;  4YYR A;  2PRE A;  3GCB A;  1HUC B;  4N8W A;  3KKU A;  2AIM A;  3V6C A;  1CB5 A;  1Y4H A;  3PBH A;  3BOW A;  1YAL A;  1CSB B;  2XU1 A;  4Q8G A;  1DF0 A;  3CH2 X;  3CH3 X;  4CDE B;  5EGW A;  4YYV A;  3BPM A; 
#chains in the Genus database with same CATH topology
 1CJL A;  1O0E A;  2H7J A;  9PAP A;  5FPW A;  1F29 A;  4YYU A;  1GMY A;  2G8J A;  1Y08 A;  2Y6E A;  4HWY A;  1EWL A;  3QT4 A;  4WUR A;  2AUX A;  4GUA A;  4IUM A;  4RF1 A;  4BS6 A;  3DF0 A;  4OEL A;  4YYQ A;  1BY8 A;  1MEG A;  1ZCM A;  2BDZ A;  2AYO A;  3LFY A;  4I04 A;  4YV8 A;  1ATK A;  4OVZ B;  3AI8 A;  4N4Z A;  1CV8 A;  4K7C A;  1YVB A;  4QH6 A;  2FT2 A;  3W30 A;  2R9N A;  1STF E;  4CDC B;  1PAD A;  1KXR A;  3BC3 A;  2E02 A;  4BOZ A;  2P7U A;  3BCN A;  4MZO A;  2DZZ A;  1KFX L;  2P86 A;  2OP3 A;  4PI3 A;  1GCB A;  2DC8 A;  1QXP A;  2GHU A;  1XKG A;  3WXG A;  4N79 A;  3RVW A;  4Q8H A;  2PBH A;  4QRX A;  1U5I A;  4R3D A;  3KX1 A;  3D6S A;  1PPD A;  3HWN A;  2HXZ A;  3KSE A;  1PPN A;  2PAD A;  2XU5 A;  1PIP A;  2R9O A;  4FIP A;  2YJC A;  1CVZ A;  1QOL A;  5JZE A;  2P0R A;  3KW9 A;  5CVM A;  4IP3 A;  4KLB A;  2J7Q A;  4X6I A;  5EF4 A;  1AIM A;  3BY4 A;  3RVV A;  2DCD A;  4D8I A;  3B79 A;  1X9Y A;  4BS5 A;  2BDL A;  2IPP B;  3OF8 A;  3BBA A;  2ACT A;  3CBJ A;  4RF0 A;  2FO5 A;  1EF7 A;  1YZB A;  2B1N A;  3QSD A;  3PHU A;  1AYV A;  2BU3 A;  5EZQ A;  1S4V A;  3QJ3 A;  3HHI A;  5J94 A;  1AU3 A;  1SP4 B;  1BGO A;  1KFU L;  2CB5 A;  4FJC A;  1YT7 A;  3TRK A;  1M6D A;  2DZY A;  3PSE A;  1AYW A;  1ITO A;  2FRQ A;  3RVX A;  1QMY A;  7PCK A;  5K16 A;  5EZS A;  2C0Y A;  3RNV A;  2AS8 A;  3BPF A;  5PAD A;  2XU3 A;  1GLO A;  1SNK A;  1A6R A;  1PPO A;  2NQI A;  2AYN A;  3E9S A;  2YJ8 A;  2DCA A;  3C9E A;  4D8E A;  3IOQ A;  3I06 A;  3V6E A;  3MOR A;  4QRG A;  1VJV A;  3IUT A;  3U8E A;  2VHF A;  2VHS A;  3K9M A;  4W4U A;  2G7Y A;  2BTW A;  3H7D A;  3HHA A;  3ZUA A;  3MTN A;  2Y5B A;  4MSX A;  3C0R A;  4XZX A;  4REZ A;  2G6D A;  1NB5 A;  3O0U A;  4RY2 A;  3OIS A;  4P6E A;  1CQD A;  1VSN A;  3KWB X;  1PPP A;  1ICF A;  2OZ2 A;  1NQC A;  3H8B A;  5JA7 A;  2HD5 A;  4BSQ A;  1MS6 A;  1THE A;  3OVZ A;  4ZTB A;  2IBI A;  4P16 A;  1U9X A;  3PW3 A;  2R9C A;  1U9Q X;  1YK8 A;  4DMX A;  4OEM A;  4MZS A;  2DC9 A;  3ERV A;  3S3R A;  1NL6 A;  3N3K A;  1MIR A;  1EWP A;  2J7Q C;  1AU4 A;  2FRA A;  4CDF B;  2HWK A;  4YYW A;  4RNA A;  2ATO A;  2PNS A;  5F02 A;  3BB7 A;  4W5C A;  1AYU A;  1GEC E;  1UKF A;  3IEJ A;  1F2C A;  2DOS A;  3USV A;  4PT5 A;  4OVZ A;  4A5U A;  2AUZ A;  1CTE A;  4AXL A;  2FUD A;  2F7D A;  4P6G A;  2NQD B;  1TL9 A;  5JH3 A;  2UZJ A;  1PCI A;  2JQF R;  1QDQ A;  2DCB A;  3IFU A;  2NQA A;  1KHQ A;  4D8B A;  4CDD B;  2R9M A;  4BOQ A;  3HD3 A;  1POP A;  3PHW A;  3P5U A;  3M99 A;  4YVA A;  2DC6 A;  2CIO A;  4OW0 A;  5CHT A;  2E01 A;  3P5X A;  4BOP A;  3S3Q A;  3TMP A;  2DJG B;  1AEC A;  3O65 A;  1NPZ A;  3P5V A;  4XUI A;  1PE6 A;  3OF9 A;  3N4C A;  2AU1 A;  2E03 A;  2F1G A;  4QBB A;  3LXS A;  4M0W A;  2YJ2 A;  3PT2 A;  6PAD A;  2DCC A;  1F2A A;  3K24 A;  1TLO A;  2Z84 A;  3PNR A;  2YJB A;  3WXF A;  4QRV A;  2FE8 A;  3F5V A;  2R9F A;  1PBH A;  1CS8 A;  1BQI A;  1AU2 A;  2GFO A;  2HH5 A;  2WBF X;  4MI7 A;  3K8U A;  5A24 A;  1AU0 A;  3NHE A;  3MJ5 A;  4PP2 E;  1MHW A;  3BWK A;  2ARY A;  4AXM A;  1FH0 A;  2NQG A;  4RKX A;  1EWO A;  4HXD B;  4CZW A;  1PVJ A;  4X6J A;  3I3T A;  3O1G A;  2G8E A;  1ME3 A;  1DKI A;  2E00 A;  3CBK A;  1NLJ A;  3KFQ A;  1NB3 A;  2FQ9 A;  3MP2 A;  2FYE A;  3N3G A;  1MEM A;  4ZUX U;  4X6H A;  1DEU A;  2JQG R;  1K3B B;  1CPJ A;  5KO3 A;  1MDW A;  1ZIV A;  1EWM A;  1TU6 A;  3OVX A;  3PHX A;  3MTV A;  3E1Z B;  1IWD A;  2O6X A;  1U9W A;  2OUL A;  3KWZ A;  4PAD A;  3TNX A;  2XU4 A;  1JQP A;  3PRP A;  3MHS A;  2R6N A;  2B1M A;  3H89 A;  3IV2 A;  1BP4 A;  4PP1 A;  3IMA A;  4BPV A;  1YK7 A;  4W5B A;  2JTC A;  3H6S A;  2JRI A;  4FK5 A;  4MM3 B;  1U9V A;  3P5W A;  4YYS A;  1ME4 A;  8PCH A;  3PDF A;  4BQV A;  3IHP A;  3MHH A;  5CVO B;  3WXE A;  4WA6 A;  3W31 A;  2DC7 A;  4I07 A;  4G54 A;  2YJ9 A;  2FTD A;  4DMY A;  3H8C A;  1PXV A;  3B21 A;  3OQC A;  1Q6K A;  4XR7 A;  2AVW A;  2AGA A;  1F2B A;  2DJF B;  3F75 A;  2HHN A;  5CVN B;  4BOS A;  5CHV A;  1KHP A;  4I05 A;  4YYR A;  2PRE A;  3GCB A;  1HUC B;  4N8W A;  2BTW B;  3KKU A;  2AIM A;  3V6C A;  1CB5 A;  1Y4H A;  3PBH A;  3BOW A;  1YAL A;  1CSB B;  2XU1 A;  4Q8G A;  4BOU A;  3ZNH A;  1DF0 A;  3CH2 X;  3PRM A;  3CH3 X;  4CDE B;  5EGW A;  4YYV A;  5E6J A;  3BPM A; 
#chains in the Genus database with same CATH homology
 1CJL A;  1O0E A;  2H7J A;  9PAP A;  5FPW A;  1F29 A;  4YYU A;  1GMY A;  2G8J A;  1Y08 A;  2Y6E A;  4HWY A;  1EWL A;  1W4T A;  3QT4 A;  2AUX A;  4BS6 A;  3DF0 A;  4OEL A;  4YYQ A;  1BY8 A;  1MEG A;  1ZCM A;  2BDZ A;  2AYO A;  3LFY A;  4NV8 A;  4I04 A;  4YV8 A;  1ATK A;  3AI8 A;  4N4Z A;  1CV8 A;  4K7C A;  1YVB A;  4QH6 A;  2FT2 A;  2R9N A;  1STF E;  4CDC B;  1PAD A;  1KXR A;  3BC3 A;  2E02 A;  2P7U A;  3BCN A;  4MZO A;  2DZZ A;  1KFX L;  2P86 A;  2OP3 A;  4PI3 A;  1GCB A;  2DC8 A;  1QXP A;  2GHU A;  1XKG A;  3WXG A;  4N79 A;  3RVW A;  4Q8H A;  2PBH A;  4QRX A;  1U5I A;  3KX1 A;  3D6S A;  1PPD A;  3HWN A;  2HXZ A;  3KSE A;  1PPN A;  2PAD A;  2XU5 A;  1PIP A;  2R9O A;  4FIP A;  2YJC A;  1CVZ A;  1QOL A;  2P0R A;  3KW9 A;  5CVM A;  4KLB A;  4X6I A;  5EF4 A;  1AIM A;  3RVV A;  2DCD A;  3B79 A;  1X9Y A;  4BS5 A;  2BDL A;  2IPP B;  3OF8 A;  2ACT A;  3CBJ A;  2FO5 A;  1EF7 A;  2B1N A;  3QSD A;  3LTW A;  1AYV A;  1S4V A;  3QJ3 A;  3HHI A;  5J94 A;  1AU3 A;  1SP4 B;  1BGO A;  1KFU L;  2CB5 A;  4FJC A;  1YT7 A;  1M6D A;  2DZY A;  1AYW A;  1ITO A;  2FRQ A;  3RVX A;  1QMY A;  7PCK A;  5K16 A;  2C0Y A;  2AS8 A;  3BPF A;  5PAD A;  2XU3 A;  1GLO A;  1SNK A;  1A6R A;  1PPO A;  2NQI A;  1W6F A;  2AYN A;  2YJ8 A;  2DCA A;  3C9E A;  3IOQ A;  3I06 A;  3V6E A;  3MOR A;  4QRG A;  1VJV A;  3IUT A;  3U8E A;  2VHF A;  2VHS A;  3K9M A;  4W4U A;  2G7Y A;  3H7D A;  3ZUA A;  3HHA A;  3MTN A;  2Y5B A;  1W5R A;  4MSX A;  2G6D A;  1NB5 A;  3O0U A;  4RY2 A;  3OIS A;  4P6E A;  1CQD A;  1VSN A;  3KWB X;  1PPP A;  1ICF A;  2OZ2 A;  1NQC A;  3H8B A;  5JA7 A;  2HD5 A;  4BSQ A;  1MS6 A;  1THE A;  3OVZ A;  2IBI A;  1U9X A;  3PW3 A;  2R9C A;  1U9Q X;  1YK8 A;  4DMX A;  4OEM A;  4MZS A;  2DC9 A;  3ERV A;  3S3R A;  4NV7 A;  1NL6 A;  3N3K A;  1MIR A;  1EWP A;  1AU4 A;  2FRA A;  4CDF B;  4YYW A;  2ATO A;  2PNS A;  5F02 A;  4W5C A;  1AYU A;  1GEC E;  3IEJ A;  1F2C A;  3USV A;  2AUZ A;  1CTE A;  4AXL A;  2FUD A;  2F7D A;  4P6G A;  2NQD B;  1TL9 A;  5JH3 A;  1PCI A;  2JQF R;  1QDQ A;  2DCB A;  2NQA A;  1KHQ A;  4CDD B;  2R9M A;  3HD3 A;  1POP A;  3P5U A;  3M99 A;  4YVA A;  2DC6 A;  2CIO A;  5CHT A;  2E01 A;  3P5X A;  3S3Q A;  2DJG B;  1AEC A;  1NPZ A;  3P5V A;  4XUI A;  1PE6 A;  3OF9 A;  3N4C A;  2AU1 A;  2E03 A;  2F1G A;  4QBB A;  3LXS A;  2YJ2 A;  6PAD A;  2DCC A;  1F2A A;  3K24 A;  1TLO A;  3PNR A;  2YJB A;  3WXF A;  4QRV A;  3F5V A;  1E2T A;  2R9F A;  1PBH A;  1CS8 A;  1BQI A;  1AU2 A;  2GFO A;  2HH5 A;  2WBF X;  3K8U A;  5A24 A;  1AU0 A;  3NHE A;  4PP2 E;  1MHW A;  3BWK A;  2ARY A;  4AXM A;  1FH0 A;  2NQG A;  1EWO A;  4CZW A;  4X6J A;  3D9W A;  3I3T A;  3O1G A;  2G8E A;  1ME3 A;  2E00 A;  3CBK A;  1NLJ A;  3KFQ A;  1NB3 A;  2FQ9 A;  2FYE A;  3N3G A;  1MEM A;  4ZUX U;  4C5P A;  4X6H A;  2BSZ A;  1DEU A;  2JQG R;  1K3B B;  1CPJ A;  1MDW A;  1ZIV A;  1EWM A;  1TU6 A;  3OVX A;  3E1Z B;  1IWD A;  2O6X A;  1U9W A;  4BGF A;  2OUL A;  3KWZ A;  4PAD A;  3TNX A;  2XU4 A;  1JQP A;  3MHS A;  2R6N A;  2B1M A;  3H89 A;  3IV2 A;  1BP4 A;  4PP1 A;  3IMA A;  4BPV A;  1YK7 A;  4W5B A;  3H6S A;  2VFB A;  4FK5 A;  1U9V A;  3P5W A;  4YYS A;  1ME4 A;  8PCH A;  3PDF A;  4BQV A;  3IHP A;  3MHH A;  5CVO B;  4B55 A;  3WXE A;  4WA6 A;  2DC7 A;  4I07 A;  4G54 A;  2YJ9 A;  2FTD A;  4DMY A;  3H8C A;  1PXV A;  1Q6K A;  1GX3 A;  4XR7 A;  2AVW A;  1F2B A;  2DJF B;  2VFC A;  2HHN A;  3F75 A;  5CVN B;  5CHV A;  1KHP A;  4I05 A;  4YYR A;  2PRE A;  3GCB A;  1HUC B;  4N8W A;  3KKU A;  2AIM A;  3V6C A;  1CB5 A;  1Y4H A;  3PBH A;  3BOW A;  4GUZ A;  1YAL A;  1CSB B;  2XU1 A;  4Q8G A;  1DF0 A;  3CH2 X;  3CH3 X;  4CDE B;  5EGW A;  4YYV A;  3BPM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...