1ZCMA

Human calpain protease core inhibited by zllych2f
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
321
structure length
321
Chain Sequence
NAIKYLGQDYEQLRVRCLQSGTLFRDEAFPPVPQSLGYKDLGPNSSKTYGIKWKRPTELLSNPQFIVDGATRTDICQGALGDCWLLAAIASLTLNDTLLHRVVPHGQSFQNGYAGIFHFQLWQFGEWVDVVVDDLLPIKDGKLVFVHSAEGNEFWSALLEKAYAKVNGSYEALSGGSTSEAFEDFTGGVTEWYELRKAPSDLYQIILKALERGSLLGCSIDISSVLDMEAITFKKLVKGHAYSVTGAKQVNYRGQVVSLIRMRNPWGEVEWTGAWSDSSSEWNNVDPYERDQLRVKMEDGEFWMSFRDFMREFTRLEICNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Calpain 1, large [catalytic] subunit
publication title Molecular mode of action of a covalently inhibiting peptidomimetic on the human calpain protease core
pubmed doi rcsb
source organism Homo sapiens
total genus 98
structure length 321
sequence length 321
ec nomenclature ec 3.4.22.52: Calpain-1.
pdb deposition date 2005-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00648 Peptidase_C2 Calpain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1zcmA02
4QRGA 3WXEA 3KKUA 3BWKA 1PIPA 3QT4A 2AUZA 2DCBA 1Q6KA 1POPA 4FK5A 2NQGA 4MZSA 4XR7A 3B79A 4X6IA 1MDWA 4QRXA 3N4CA 1K3BB 1KFUL 4N8WA 5JA7A 4OELA 1ME4A 1F29A 3DF0A 5F02A 1NQCA 1EWOA 2BDLA 3PDFA 3HHAA 3BCNA 2YJ8A 1U9XA 3BPFA 4N79A 4YV8A 3N3GA 3WXGA 3TNXA 1MEGA 3IHPA 4BS6A 2AYOA 2JQFR 2R9MA 1U9WA 3LXSA 4AXLA 4I05A 3K8UA 1PE6A 1SP4B 1A6RA 3O1GA 2WBFX 2HD5A 2YJCA 3M99A 1CPJA 3WXFA 2NQIA 4BSQA 4N4ZA 1YT7A 1PBHA 4MZOA 1EWMA 3KWZA 5CVOB 1PADA 3IEJA 4PP1A 5EGWA 1QOLA 3I3TA 1NB5A 3N3KA 4DMYA 2PADA 4P6EA 1VSNA 3OF9A 4KLBA 1KHQA 2DZZA 2DC7A 2Y5BA 1CB5A 1NL6A 1QDQA 1F2AA 3NHEA 3E1ZB 4YYUA 1FH0A 4YYWA 5K16A 1U9VA 3AI8A 1BGOA 3CH3X 3OVXA 1CV8A 3P5WA 1KXRA 2XU5A 1TLOA 1PPDA 3K24A 7PCKA 3HHIA 1ZCMA 3V6EA 2FQ9A 2FT2A 2PNSA 1CVZA 1O0EA 1TL9A 3KW9A 2P7UA 2G6DA 4X6JA 2R9NA 4XUIA 2DCAA 2GFOA 3RVVA 1YALA 4Q8HA 1KFXL 5CVMA 4PADA 5CHVA 1DF0A 1ICFA 1NLJA 1XKGA 4YVAA 1AU3A 2E02A 2DC8A 2FTDA 5JH3A 5CVNB 3H8CA 2E03A 3H89A 2HXZA 2XU4A 1MHWA 4QRVA 3CBJA 2CIOA 3F75A 2FUDA 1AYUA 1MIRA 3BOWA 1EWPA 2DJFB 5A24A 2DC6A 1BY8A 3U8EA 2OP3A 1THEA 2XU3A 1JQPA 2FRAA 3I06A 4I04A 4CZWA 2O6XA 4YYSA 2AU1A 1PPNA 4QBBA 2G8JA 1ME3A 1EF7A 3MHSA 4OEMA 1X9YA 3KSEA 1AYWA 1KHPA 2G8EA 2C0YA 2F7DA 2NQAA 1F2CA 2IPPB 3MHHA 1PXVA 1BQIA 3KWBX 2HH5A 1EWLA 2OULA 4YYVA 5FPWA 8PCHA 3CH2X 1YK7A 2YJ9A 2AVWA 4FIPA 3KFQA 2PREA 3S3RA 4RY2A 2HHNA 2R9OA 2R9FA 4HWYA 1CQDA 2P86A 3ERVA 4CDCB 2AYNA 1NB3A 1MEMA 3IOQA 3CBKA 5CHTA 3RVXA 3USVA 2YJBA 1HUCB 4BQVA 3K9MA 3PW3A 3OISA 2B1NA 1SNKA 2AIMA 4CDFB 1AIMA 1F2BA 3RVWA 4CDDB 2ACTA 3OF8A 1DEUA 2R9CA 2IBIA 6PADA 1STFE 1GLOA 2ATOA 4W5BA 2Y6EA 1GMYA 2JQGR 3PNRA 5PADA 3ZUAA 2R6NA 1YVBA 4I07A 4DMXA 2E01A 2DCDA 1ATKA 1AU4A 2E00A 4G54A 3H7DA 3O0UA 3KX1A 3H6SA 3BC3A 1AU0A 1ZIVA 2B1MA 3IV2A 1Y4HA 3C9EA 1VJVA 5J94A 1M6DA 4PI3A 1GCBA 3HWNA 1AECA 1QXPA 4YYRA 3IMAA 3P5UA 2G7YA 5EF4A 3V6CA 2H7JA 1CTEA 2DZYA 3PBHA 2DJGB 1CJLA 4K7CA 1TU6A 3HD3A 4X6HA 1PCIA 4AXMA 1U5IA 4Q8GA 1MS6A 3D6SA 4W5CA 2ARYA 1S4VA 4QH6A 2PBHA 4W4UA 1BP4A 4BS5A 4CDEB 2P0RA 1PPOA 2FO5A 3GCBA 1AYVA 3QSDA 2AUXA 2OZ2A 2DCCA 4PP2E 3MORA 1CS8A 4FJCA 1GECE 4MSXA 3MTNA 1U9QX 1IWDA 1AU2A 2XU1A 3F5VA 2YJ2A 1ITOA 2VHFA 4WA6A 1YK8A 2CB5A 2FYEA 3IUTA 4ZUXU 9PAPA 1Y08A 2GHUA 4BPVA 2F1GA 3S3QA 2FRQA 2VHSA 2AS8A 4YYQA 3P5VA 1CSBB 1QMYA 1NPZA 3OVZA 2BDZA 1PPPA 3QJ3A 2DC9A 3P5XA 4P6GA 3BPMA 3H8BA 3LFYA 2NQDB
chains in the Genus database with same CATH superfamily
4QRGA 4IP3A 3WXEA 1YZBA 2DOSA 3KKUA 3BWKA 1PIPA 3QT4A 2AUZA 2DCBA 1Q6KA 1POPA 4FK5A 2NQGA 4MZSA 4XR7A 3W30A 3B79A 4X6IA 1MDWA 3BY4A 4GUAA 4QRXA 3N4CA 4OVZB 1K3BB 1KFUL 4N8WA 2Z84A 5JA7A 3C0RA 4OELA 1ME4A 1F29A 3DF0A 5F02A 1NQCA 1EWOA 2BDLA 3PDFA 3HHAA 3BCNA 2YJ8A 1U9XA 3BPFA 4N79A 4YV8A 3N3GA 4MM3B 3WXGA 4BOPA 3TNXA 1MEGA 3IHPA 4BS6A 2AYOA 2JQFR 2R9MA 3BBAA 1U9WA 3LXSA 4AXLA 4I05A 3K8UA 4RNAA 1PE6A 1SP4B 1A6RA 3O1GA 2WBFX 2HD5A 2YJCA 3M99A 1CPJA 3WXFA 1PVJA 2NQIA 4BSQA 4N4ZA 3TMPA 1YT7A 4D8BA 1PBHA 4MZOA 1EWMA 3KWZA 5CVOB 1PADA 3IEJA 4PP1A 5EGWA 1QOLA 3PSEA 3I3TA 1NB5A 3N3KA 4DMYA 2PADA 4P6EA 1VSNA 3OF9A 3PRMA 4KLBA 1KHQA 2DZZA 2DC7A 2Y5BA 1CB5A 1NL6A 1QDQA 1F2AA 3NHEA 3E1ZB 4REZA 1FH0A 4YYWA 5K16A 4YYUA 1U9VA 3AI8A 1BGOA 3CH3X 3OVXA 1CV8A 3P5WA 3OQCA 1KXRA 2XU5A 1TLOA 1PPDA 3K24A 4WURA 7PCKA 3HHIA 1UKFA 1ZCMA 3V6EA 2FQ9A 2FT2A 4BOZA 2PNSA 1CVZA 1O0EA 2JTCA 1TL9A 3KW9A 3PT2A 2P7UA 2G6DA 4X6JA 2R9NA 4XUIA 2DCAA 2GFOA 3RVVA 1YALA 4Q8HA 3MP2A 4BOQA 1KFXL 5CVMA 5EZSA 4PADA 5CHVA 1DF0A 1ICFA 1NLJA 1XKGA 4YVAA 2HWKA 1AU3A 2E02A 4P16A 2DC8A 2FTDA 5JH3A 5CVNB 3H8CA 3W31A 2E03A 3H89A 4OW0A 2HXZA 2XU4A 1MHWA 4QRVA 4RF0A 3CBJA 2CIOA 3F75A 3IFUA 2FUDA 1AYUA 1MIRA 3BOWA 1EWPA 2DJFB 5A24A 2DC6A 1BY8A 3U8EA 2UZJA 2OP3A 1THEA 2XU3A 1JQPA 2FRAA 5EZQA 3I06A 3PHUA 4I04A 4CZWA 2O6XA 4YYSA 2AU1A 1PPNA 4QBBA 3O65A 2G8JA 1ME3A 1EF7A 3MHSA 4OEMA 3MTVA 1X9YA 3KSEA 3PHWA 1AYWA 1KHPA 2G8EA 2C0YA 2F7DA 2NQAA 1F2CA 2IPPB 3MHHA 1PXVA 1BQIA 3KWBX 2HH5A 2J7QC 2BTWA 1EWLA 2OULA 4YYVA 2BU3A 5FPWA 8PCHA 3CH2X 1YK7A 4XZXA 2YJ9A 3BB7A 2AVWA 4FIPA 3KFQA 2PREA 3S3RA 5E6JA 4RY2A 4HXDB 2HHNA 2R9OA 2R9FA 4HWYA 1CQDA 4IUMA 2P86A 3ERVA 4CDCB 2FE8A 2AYNA 1NB3A 1MEMA 3IOQA 3CBKA 5CHTA 3RVXA 3USVA 2YJBA 1HUCB 4BQVA 4RF1A 3K9MA 3PW3A 3OISA 2B1NA 1SNKA 2AIMA 4CDFB 3TRKA 2JRIA 1AIMA 1F2BA 3RVWA 4CDDB 2ACTA 4A5UA 3OF8A 1DEUA 2R9CA 2IBIA 4RKXA 6PADA 1STFE 1GLOA 2ATOA 4W5BA 2Y6EA 1GMYA 2JQGR 3PNRA 4D8EA 5PADA 3ZUAA 2R6NA 4D8IA 1YVBA 4I07A 4DMXA 2E01A 2DCDA 1ATKA 3B21A 1AU4A 2E00A 4G54A 3E9SA 3H7DA 3O0UA 3KX1A 4PT5A 3H6SA 3BC3A 1AU0A 1ZIVA 2B1MA 3IV2A 1Y4HA 3C9EA 4BOSA 5KO3A 1VJVA 5J94A 1M6DA 4PI3A 1GCBA 3HWNA 1AECA 1QXPA 4YYRA 3IMAA 3P5UA 2G7YA 5EF4A 3V6CA 2BTWB 1CTEA 2H7JA 4MI7A 2DZYA 3PBHA 2DJGB 1CJLA 4K7CA 1TU6A 4OVZA 2J7QA 3HD3A 4X6HA 1PCIA 4AXMA 1U5IA 3MJ5A 4Q8GA 4R3DA 1MS6A 3D6SA 4W5CA 2ARYA 1S4VA 4QH6A 2PBHA 4W4UA 1BP4A 1DKIA 3PHXA 4BS5A 4CDEB 2P0RA 1PPOA 2FO5A 3GCBA 1AYVA 3QSDA 2AUXA 2OZ2A 2DCCA 4PP2E 3MORA 1CS8A 4FJCA 1GECE 4MSXA 3MTNA 1U9QX 1IWDA 1AU2A 2XU1A 3F5VA 2YJ2A 1ITOA 2VHFA 4WA6A 1YK8A 2AGAA 2CB5A 2FYEA 3IUTA 4ZUXU 9PAPA 1Y08A 2GHUA 4ZTBA 4BPVA 2F1GA 3S3QA 2FRQA 2VHSA 3PRPA 2AS8A 3ZNHA 4YYQA 3P5VA 4M0WA 1CSBB 1QMYA 1NPZA 5JZEA 3OVZA 2BDZA 3RNVA 1PPPA 4BOUA 3QJ3A 2DC9A 3P5XA 4P6GA 3BPMA 3H8BA 3LFYA 2NQDB
chains in the Genus database with same CATH topology
4QRGA 3WXEA 3KKUA 3BWKA 1PIPA 3QT4A 2AUZA 2DCBA 1Q6KA 1POPA 4FK5A 2NQGA 4MZSA 4XR7A 3B79A 4X6IA 1MDWA 4QRXA 3N4CA 4B55A 1K3BB 1KFUL 4N8WA 5JA7A 4OELA 1ME4A 1F29A 3DF0A 5F02A 1NQCA 1EWOA 2BDLA 3PDFA 3HHAA 3BCNA 2YJ8A 1U9XA 3BPFA 4N79A 4YV8A 3N3GA 3WXGA 3TNXA 1MEGA 3IHPA 4BS6A 4C5PA 2AYOA 2JQFR 2R9MA 1E2TA 1U9WA 3LXSA 4AXLA 4I05A 3K8UA 1PE6A 1SP4B 1A6RA 3O1GA 2WBFX 2HD5A 2YJCA 3M99A 1CPJA 3WXFA 2NQIA 4BSQA 4N4ZA 1YT7A 1PBHA 4MZOA 1EWMA 3KWZA 5CVOB 1PADA 3IEJA 4PP1A 5EGWA 1QOLA 3I3TA 3D9WA 1NB5A 3N3KA 4DMYA 2PADA 4P6EA 4NV8A 1VSNA 3OF9A 4KLBA 1KHQA 2DZZA 2DC7A 2Y5BA 1CB5A 1NL6A 1QDQA 1F2AA 3NHEA 3E1ZB 4YYUA 1FH0A 4YYWA 5K16A 1U9VA 3AI8A 1BGOA 3CH3X 3OVXA 1CV8A 3P5WA 1KXRA 2XU5A 1TLOA 1PPDA 3K24A 7PCKA 3HHIA 1ZCMA 3V6EA 2FQ9A 2FT2A 2PNSA 1CVZA 1O0EA 4GUZA 1TL9A 3KW9A 2P7UA 2G6DA 4X6JA 2R9NA 4XUIA 2DCAA 1W5RA 2GFOA 1YALA 3RVVA 4Q8HA 1KFXL 5CVMA 4PADA 5CHVA 1DF0A 2VFBA 1ICFA 1NLJA 1XKGA 4YVAA 1AU3A 2E02A 2DC8A 2FTDA 5JH3A 5CVNB 3H8CA 2E03A 3H89A 2HXZA 2XU4A 1MHWA 4QRVA 3CBJA 4NV7A 2CIOA 3F75A 3LTWA 2FUDA 1AYUA 1MIRA 3BOWA 1EWPA 2DJFB 5A24A 2DC6A 1BY8A 3U8EA 2OP3A 1THEA 2XU3A 1JQPA 2FRAA 3I06A 4I04A 4CZWA 2O6XA 4YYSA 2AU1A 1PPNA 4QBBA 2G8JA 1ME3A 1EF7A 3MHSA 4OEMA 1X9YA 3KSEA 1AYWA 1KHPA 2G8EA 2C0YA 2F7DA 2NQAA 1F2CA 2IPPB 3MHHA 1PXVA 1BQIA 3KWBX 2HH5A 1EWLA 2OULA 4YYVA 5FPWA 8PCHA 3CH2X 1YK7A 2YJ9A 2AVWA 4FIPA 3KFQA 2PREA 3S3RA 4RY2A 2HHNA 2R9OA 2R9FA 4HWYA 1CQDA 2P86A 3ERVA 4CDCB 2AYNA 1NB3A 1MEMA 3IOQA 3CBKA 5CHTA 3RVXA 3USVA 2YJBA 1HUCB 2VFCA 4BQVA 3K9MA 3PW3A 3OISA 1GX3A 2B1NA 1SNKA 2AIMA 4CDFB 1AIMA 1F2BA 3RVWA 4CDDB 2ACTA 3OF8A 1DEUA 2R9CA 2IBIA 6PADA 1STFE 1GLOA 2ATOA 4W5BA 2Y6EA 1GMYA 2JQGR 3PNRA 5PADA 3ZUAA 2R6NA 1YVBA 4I07A 4DMXA 2E01A 2DCDA 2BSZA 1ATKA 1AU4A 2E00A 4G54A 3H7DA 3O0UA 3KX1A 3H6SA 3BC3A 1AU0A 1ZIVA 2B1MA 3IV2A 1Y4HA 3C9EA 1VJVA 5J94A 1M6DA 4PI3A 1GCBA 3HWNA 1AECA 1QXPA 4YYRA 3IMAA 3P5UA 2G7YA 5EF4A 3V6CA 2H7JA 1CTEA 2DZYA 3PBHA 2DJGB 1CJLA 4K7CA 1TU6A 3HD3A 4X6HA 1PCIA 4AXMA 1U5IA 4Q8GA 1MS6A 3D6SA 1W6FA 4W5CA 2ARYA 1S4VA 4QH6A 2PBHA 4W4UA 1BP4A 4BS5A 4CDEB 2P0RA 1PPOA 2FO5A 3GCBA 1AYVA 3QSDA 1W4TA 2AUXA 2OZ2A 2DCCA 4PP2E 3MORA 1CS8A 4FJCA 1GECE 4MSXA 3MTNA 1U9QX 1IWDA 1AU2A 2XU1A 3F5VA 2YJ2A 1ITOA 2VHFA 4WA6A 1YK8A 2CB5A 2FYEA 3IUTA 4ZUXU 9PAPA 1Y08A 2GHUA 4BPVA 2F1GA 3S3QA 2FRQA 2VHSA 2AS8A 4YYQA 3P5VA 1CSBB 1QMYA 1NPZA 3OVZA 2BDZA 4BGFA 1PPPA 3QJ3A 2DC9A 3P5XA 4P6GA 3BPMA 3H8BA 3LFYA 2NQDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QRG A;  3WXE A;  3KKU A;  3BWK A;  1PIP A;  3QT4 A;  2AUZ A;  2DCB A;  1Q6K A;  1POP A;  4FK5 A;  2NQG A;  4MZS A;  4XR7 A;  3B79 A;  4X6I A;  1MDW A;  4QRX A;  3N4C A;  1K3B B;  1KFU L;  4N8W A;  5JA7 A;  4OEL A;  1ME4 A;  1F29 A;  3DF0 A;  5F02 A;  1NQC A;  1EWO A;  2BDL A;  3PDF A;  3HHA A;  3BCN A;  2YJ8 A;  1U9X A;  3BPF A;  4N79 A;  4YV8 A;  3N3G A;  3WXG A;  3TNX A;  1MEG A;  3IHP A;  4BS6 A;  2AYO A;  2JQF R;  2R9M A;  1U9W A;  3LXS A;  4AXL A;  4I05 A;  3K8U A;  1PE6 A;  1SP4 B;  1A6R A;  3O1G A;  2WBF X;  2HD5 A;  2YJC A;  3M99 A;  1CPJ A;  3WXF A;  2NQI A;  4BSQ A;  4N4Z A;  1YT7 A;  1PBH A;  4MZO A;  1EWM A;  3KWZ A;  5CVO B;  1PAD A;  3IEJ A;  4PP1 A;  5EGW A;  1QOL A;  3I3T A;  1NB5 A;  3N3K A;  4DMY A;  2PAD A;  4P6E A;  1VSN A;  3OF9 A;  4KLB A;  1KHQ A;  2DZZ A;  2DC7 A;  2Y5B A;  1CB5 A;  1NL6 A;  1QDQ A;  1F2A A;  3NHE A;  3E1Z B;  4YYU A;  1FH0 A;  4YYW A;  5K16 A;  1U9V A;  3AI8 A;  1BGO A;  3CH3 X;  3OVX A;  1CV8 A;  3P5W A;  1KXR A;  2XU5 A;  1TLO A;  1PPD A;  3K24 A;  7PCK A;  3HHI A;  1ZCM A;  3V6E A;  2FQ9 A;  2FT2 A;  2PNS A;  1CVZ A;  1O0E A;  1TL9 A;  3KW9 A;  2P7U A;  2G6D A;  4X6J A;  2R9N A;  4XUI A;  2DCA A;  2GFO A;  3RVV A;  1YAL A;  4Q8H A;  1KFX L;  5CVM A;  4PAD A;  5CHV A;  1DF0 A;  1ICF A;  1NLJ A;  1XKG A;  4YVA A;  1AU3 A;  2E02 A;  2DC8 A;  2FTD A;  5JH3 A;  5CVN B;  3H8C A;  2E03 A;  3H89 A;  2HXZ A;  2XU4 A;  1MHW A;  4QRV A;  3CBJ A;  2CIO A;  3F75 A;  2FUD A;  1AYU A;  1MIR A;  3BOW A;  1EWP A;  2DJF B;  5A24 A;  2DC6 A;  1BY8 A;  3U8E A;  2OP3 A;  1THE A;  2XU3 A;  1JQP A;  2FRA A;  3I06 A;  4I04 A;  4CZW A;  2O6X A;  4YYS A;  2AU1 A;  1PPN A;  4QBB A;  2G8J A;  1ME3 A;  1EF7 A;  3MHS A;  4OEM A;  1X9Y A;  3KSE A;  1AYW A;  1KHP A;  2G8E A;  2C0Y A;  2F7D A;  2NQA A;  1F2C A;  2IPP B;  3MHH A;  1PXV A;  1BQI A;  3KWB X;  2HH5 A;  1EWL A;  2OUL A;  4YYV A;  5FPW A;  8PCH A;  3CH2 X;  1YK7 A;  2YJ9 A;  2AVW A;  4FIP A;  3KFQ A;  2PRE A;  3S3R A;  4RY2 A;  2HHN A;  2R9O A;  2R9F A;  4HWY A;  1CQD A;  2P86 A;  3ERV A;  4CDC B;  2AYN A;  1NB3 A;  1MEM A;  3IOQ A;  3CBK A;  5CHT A;  3RVX A;  3USV A;  2YJB A;  1HUC B;  4BQV A;  3K9M A;  3PW3 A;  3OIS A;  2B1N A;  1SNK A;  2AIM A;  4CDF B;  1AIM A;  1F2B A;  3RVW A;  4CDD B;  2ACT A;  3OF8 A;  1DEU A;  2R9C A;  2IBI A;  6PAD A;  1STF E;  1GLO A;  2ATO A;  4W5B A;  2Y6E A;  1GMY A;  2JQG R;  3PNR A;  5PAD A;  3ZUA A;  2R6N A;  1YVB A;  4I07 A;  4DMX A;  2E01 A;  2DCD A;  1ATK A;  1AU4 A;  2E00 A;  4G54 A;  3H7D A;  3O0U A;  3KX1 A;  3H6S A;  3BC3 A;  1AU0 A;  1ZIV A;  2B1M A;  3IV2 A;  1Y4H A;  3C9E A;  1VJV A;  5J94 A;  1M6D A;  4PI3 A;  1GCB A;  3HWN A;  1AEC A;  1QXP A;  4YYR A;  3IMA A;  3P5U A;  2G7Y A;  5EF4 A;  3V6C A;  2H7J A;  1CTE A;  2DZY A;  3PBH A;  2DJG B;  1CJL A;  4K7C A;  1TU6 A;  3HD3 A;  4X6H A;  1PCI A;  4AXM A;  1U5I A;  4Q8G A;  1MS6 A;  3D6S A;  4W5C A;  2ARY A;  1S4V A;  4QH6 A;  2PBH A;  4W4U A;  1BP4 A;  4BS5 A;  4CDE B;  2P0R A;  1PPO A;  2FO5 A;  3GCB A;  1AYV A;  3QSD A;  2AUX A;  2OZ2 A;  2DCC A;  4PP2 E;  3MOR A;  1CS8 A;  4FJC A;  1GEC E;  4MSX A;  3MTN A;  1U9Q X;  1IWD A;  1AU2 A;  2XU1 A;  3F5V A;  2YJ2 A;  1ITO A;  2VHF A;  4WA6 A;  1YK8 A;  2CB5 A;  2FYE A;  3IUT A;  4ZUX U;  9PAP A;  1Y08 A;  2GHU A;  4BPV A;  2F1G A;  3S3Q A;  2FRQ A;  2VHS A;  2AS8 A;  4YYQ A;  3P5V A;  1CSB B;  1QMY A;  1NPZ A;  3OVZ A;  2BDZ A;  1PPP A;  3QJ3 A;  2DC9 A;  3P5X A;  4P6G A;  3BPM A;  3H8B A;  3LFY A;  2NQD B; 
#chains in the Genus database with same CATH topology
 4QRG A;  4IP3 A;  3WXE A;  1YZB A;  2DOS A;  3KKU A;  3BWK A;  1PIP A;  3QT4 A;  2AUZ A;  2DCB A;  1Q6K A;  1POP A;  4FK5 A;  2NQG A;  4MZS A;  4XR7 A;  3W30 A;  3B79 A;  4X6I A;  1MDW A;  3BY4 A;  4GUA A;  4QRX A;  3N4C A;  4OVZ B;  1K3B B;  1KFU L;  4N8W A;  2Z84 A;  5JA7 A;  3C0R A;  4OEL A;  1ME4 A;  1F29 A;  3DF0 A;  5F02 A;  1NQC A;  1EWO A;  2BDL A;  3PDF A;  3HHA A;  3BCN A;  2YJ8 A;  1U9X A;  3BPF A;  4N79 A;  4YV8 A;  3N3G A;  4MM3 B;  3WXG A;  4BOP A;  3TNX A;  1MEG A;  3IHP A;  4BS6 A;  2AYO A;  2JQF R;  2R9M A;  3BBA A;  1U9W A;  3LXS A;  4AXL A;  4I05 A;  3K8U A;  4RNA A;  1PE6 A;  1SP4 B;  1A6R A;  3O1G A;  2WBF X;  2HD5 A;  2YJC A;  3M99 A;  1CPJ A;  3WXF A;  1PVJ A;  2NQI A;  4BSQ A;  4N4Z A;  3TMP A;  1YT7 A;  4D8B A;  1PBH A;  4MZO A;  1EWM A;  3KWZ A;  5CVO B;  1PAD A;  3IEJ A;  4PP1 A;  5EGW A;  1QOL A;  3PSE A;  3I3T A;  1NB5 A;  3N3K A;  4DMY A;  2PAD A;  4P6E A;  1VSN A;  3OF9 A;  3PRM A;  4KLB A;  1KHQ A;  2DZZ A;  2DC7 A;  2Y5B A;  1CB5 A;  1NL6 A;  1QDQ A;  1F2A A;  3NHE A;  3E1Z B;  4REZ A;  1FH0 A;  4YYW A;  5K16 A;  4YYU A;  1U9V A;  3AI8 A;  1BGO A;  3CH3 X;  3OVX A;  1CV8 A;  3P5W A;  3OQC A;  1KXR A;  2XU5 A;  1TLO A;  1PPD A;  3K24 A;  4WUR A;  7PCK A;  3HHI A;  1UKF A;  1ZCM A;  3V6E A;  2FQ9 A;  2FT2 A;  4BOZ A;  2PNS A;  1CVZ A;  1O0E A;  2JTC A;  1TL9 A;  3KW9 A;  3PT2 A;  2P7U A;  2G6D A;  4X6J A;  2R9N A;  4XUI A;  2DCA A;  2GFO A;  3RVV A;  1YAL A;  4Q8H A;  3MP2 A;  4BOQ A;  1KFX L;  5CVM A;  5EZS A;  4PAD A;  5CHV A;  1DF0 A;  1ICF A;  1NLJ A;  1XKG A;  4YVA A;  2HWK A;  1AU3 A;  2E02 A;  4P16 A;  2DC8 A;  2FTD A;  5JH3 A;  5CVN B;  3H8C A;  3W31 A;  2E03 A;  3H89 A;  4OW0 A;  2HXZ A;  2XU4 A;  1MHW A;  4QRV A;  4RF0 A;  3CBJ A;  2CIO A;  3F75 A;  3IFU A;  2FUD A;  1AYU A;  1MIR A;  3BOW A;  1EWP A;  2DJF B;  5A24 A;  2DC6 A;  1BY8 A;  3U8E A;  2UZJ A;  2OP3 A;  1THE A;  2XU3 A;  1JQP A;  2FRA A;  5EZQ A;  3I06 A;  3PHU A;  4I04 A;  4CZW A;  2O6X A;  4YYS A;  2AU1 A;  1PPN A;  4QBB A;  3O65 A;  2G8J A;  1ME3 A;  1EF7 A;  3MHS A;  4OEM A;  3MTV A;  1X9Y A;  3KSE A;  3PHW A;  1AYW A;  1KHP A;  2G8E A;  2C0Y A;  2F7D A;  2NQA A;  1F2C A;  2IPP B;  3MHH A;  1PXV A;  1BQI A;  3KWB X;  2HH5 A;  2J7Q C;  2BTW A;  1EWL A;  2OUL A;  4YYV A;  2BU3 A;  5FPW A;  8PCH A;  3CH2 X;  1YK7 A;  4XZX A;  2YJ9 A;  3BB7 A;  2AVW A;  4FIP A;  3KFQ A;  2PRE A;  3S3R A;  5E6J A;  4RY2 A;  4HXD B;  2HHN A;  2R9O A;  2R9F A;  4HWY A;  1CQD A;  4IUM A;  2P86 A;  3ERV A;  4CDC B;  2FE8 A;  2AYN A;  1NB3 A;  1MEM A;  3IOQ A;  3CBK A;  5CHT A;  3RVX A;  3USV A;  2YJB A;  1HUC B;  4BQV A;  4RF1 A;  3K9M A;  3PW3 A;  3OIS A;  2B1N A;  1SNK A;  2AIM A;  4CDF B;  3TRK A;  2JRI A;  1AIM A;  1F2B A;  3RVW A;  4CDD B;  2ACT A;  4A5U A;  3OF8 A;  1DEU A;  2R9C A;  2IBI A;  4RKX A;  6PAD A;  1STF E;  1GLO A;  2ATO A;  4W5B A;  2Y6E A;  1GMY A;  2JQG R;  3PNR A;  4D8E A;  5PAD A;  3ZUA A;  2R6N A;  4D8I A;  1YVB A;  4I07 A;  4DMX A;  2E01 A;  2DCD A;  1ATK A;  3B21 A;  1AU4 A;  2E00 A;  4G54 A;  3E9S A;  3H7D A;  3O0U A;  3KX1 A;  4PT5 A;  3H6S A;  3BC3 A;  1AU0 A;  1ZIV A;  2B1M A;  3IV2 A;  1Y4H A;  3C9E A;  4BOS A;  5KO3 A;  1VJV A;  5J94 A;  1M6D A;  4PI3 A;  1GCB A;  3HWN A;  1AEC A;  1QXP A;  4YYR A;  3IMA A;  3P5U A;  2G7Y A;  5EF4 A;  3V6C A;  2BTW B;  1CTE A;  2H7J A;  4MI7 A;  2DZY A;  3PBH A;  2DJG B;  1CJL A;  4K7C A;  1TU6 A;  4OVZ A;  2J7Q A;  3HD3 A;  4X6H A;  1PCI A;  4AXM A;  1U5I A;  3MJ5 A;  4Q8G A;  4R3D A;  1MS6 A;  3D6S A;  4W5C A;  2ARY A;  1S4V A;  4QH6 A;  2PBH A;  4W4U A;  1BP4 A;  1DKI A;  3PHX A;  4BS5 A;  4CDE B;  2P0R A;  1PPO A;  2FO5 A;  3GCB A;  1AYV A;  3QSD A;  2AUX A;  2OZ2 A;  2DCC A;  4PP2 E;  3MOR A;  1CS8 A;  4FJC A;  1GEC E;  4MSX A;  3MTN A;  1U9Q X;  1IWD A;  1AU2 A;  2XU1 A;  3F5V A;  2YJ2 A;  1ITO A;  2VHF A;  4WA6 A;  1YK8 A;  2AGA A;  2CB5 A;  2FYE A;  3IUT A;  4ZUX U;  9PAP A;  1Y08 A;  2GHU A;  4ZTB A;  4BPV A;  2F1G A;  3S3Q A;  2FRQ A;  2VHS A;  3PRP A;  2AS8 A;  3ZNH A;  4YYQ A;  3P5V A;  4M0W A;  1CSB B;  1QMY A;  1NPZ A;  5JZE A;  3OVZ A;  2BDZ A;  3RNV A;  1PPP A;  4BOU A;  3QJ3 A;  2DC9 A;  3P5X A;  4P6G A;  3BPM A;  3H8B A;  3LFY A;  2NQD B; 
#chains in the Genus database with same CATH homology
 4QRG A;  3WXE A;  3KKU A;  3BWK A;  1PIP A;  3QT4 A;  2AUZ A;  2DCB A;  1Q6K A;  1POP A;  4FK5 A;  2NQG A;  4MZS A;  4XR7 A;  3B79 A;  4X6I A;  1MDW A;  4QRX A;  3N4C A;  4B55 A;  1K3B B;  1KFU L;  4N8W A;  5JA7 A;  4OEL A;  1ME4 A;  1F29 A;  3DF0 A;  5F02 A;  1NQC A;  1EWO A;  2BDL A;  3PDF A;  3HHA A;  3BCN A;  2YJ8 A;  1U9X A;  3BPF A;  4N79 A;  4YV8 A;  3N3G A;  3WXG A;  3TNX A;  1MEG A;  3IHP A;  4BS6 A;  4C5P A;  2AYO A;  2JQF R;  2R9M A;  1E2T A;  1U9W A;  3LXS A;  4AXL A;  4I05 A;  3K8U A;  1PE6 A;  1SP4 B;  1A6R A;  3O1G A;  2WBF X;  2HD5 A;  2YJC A;  3M99 A;  1CPJ A;  3WXF A;  2NQI A;  4BSQ A;  4N4Z A;  1YT7 A;  1PBH A;  4MZO A;  1EWM A;  3KWZ A;  5CVO B;  1PAD A;  3IEJ A;  4PP1 A;  5EGW A;  1QOL A;  3I3T A;  3D9W A;  1NB5 A;  3N3K A;  4DMY A;  2PAD A;  4P6E A;  4NV8 A;  1VSN A;  3OF9 A;  4KLB A;  1KHQ A;  2DZZ A;  2DC7 A;  2Y5B A;  1CB5 A;  1NL6 A;  1QDQ A;  1F2A A;  3NHE A;  3E1Z B;  4YYU A;  1FH0 A;  4YYW A;  5K16 A;  1U9V A;  3AI8 A;  1BGO A;  3CH3 X;  3OVX A;  1CV8 A;  3P5W A;  1KXR A;  2XU5 A;  1TLO A;  1PPD A;  3K24 A;  7PCK A;  3HHI A;  1ZCM A;  3V6E A;  2FQ9 A;  2FT2 A;  2PNS A;  1CVZ A;  1O0E A;  4GUZ A;  1TL9 A;  3KW9 A;  2P7U A;  2G6D A;  4X6J A;  2R9N A;  4XUI A;  2DCA A;  1W5R A;  2GFO A;  1YAL A;  3RVV A;  4Q8H A;  1KFX L;  5CVM A;  4PAD A;  5CHV A;  1DF0 A;  2VFB A;  1ICF A;  1NLJ A;  1XKG A;  4YVA A;  1AU3 A;  2E02 A;  2DC8 A;  2FTD A;  5JH3 A;  5CVN B;  3H8C A;  2E03 A;  3H89 A;  2HXZ A;  2XU4 A;  1MHW A;  4QRV A;  3CBJ A;  4NV7 A;  2CIO A;  3F75 A;  3LTW A;  2FUD A;  1AYU A;  1MIR A;  3BOW A;  1EWP A;  2DJF B;  5A24 A;  2DC6 A;  1BY8 A;  3U8E A;  2OP3 A;  1THE A;  2XU3 A;  1JQP A;  2FRA A;  3I06 A;  4I04 A;  4CZW A;  2O6X A;  4YYS A;  2AU1 A;  1PPN A;  4QBB A;  2G8J A;  1ME3 A;  1EF7 A;  3MHS A;  4OEM A;  1X9Y A;  3KSE A;  1AYW A;  1KHP A;  2G8E A;  2C0Y A;  2F7D A;  2NQA A;  1F2C A;  2IPP B;  3MHH A;  1PXV A;  1BQI A;  3KWB X;  2HH5 A;  1EWL A;  2OUL A;  4YYV A;  5FPW A;  8PCH A;  3CH2 X;  1YK7 A;  2YJ9 A;  2AVW A;  4FIP A;  3KFQ A;  2PRE A;  3S3R A;  4RY2 A;  2HHN A;  2R9O A;  2R9F A;  4HWY A;  1CQD A;  2P86 A;  3ERV A;  4CDC B;  2AYN A;  1NB3 A;  1MEM A;  3IOQ A;  3CBK A;  5CHT A;  3RVX A;  3USV A;  2YJB A;  1HUC B;  2VFC A;  4BQV A;  3K9M A;  3PW3 A;  3OIS A;  1GX3 A;  2B1N A;  1SNK A;  2AIM A;  4CDF B;  1AIM A;  1F2B A;  3RVW A;  4CDD B;  2ACT A;  3OF8 A;  1DEU A;  2R9C A;  2IBI A;  6PAD A;  1STF E;  1GLO A;  2ATO A;  4W5B A;  2Y6E A;  1GMY A;  2JQG R;  3PNR A;  5PAD A;  3ZUA A;  2R6N A;  1YVB A;  4I07 A;  4DMX A;  2E01 A;  2DCD A;  2BSZ A;  1ATK A;  1AU4 A;  2E00 A;  4G54 A;  3H7D A;  3O0U A;  3KX1 A;  3H6S A;  3BC3 A;  1AU0 A;  1ZIV A;  2B1M A;  3IV2 A;  1Y4H A;  3C9E A;  1VJV A;  5J94 A;  1M6D A;  4PI3 A;  1GCB A;  3HWN A;  1AEC A;  1QXP A;  4YYR A;  3IMA A;  3P5U A;  2G7Y A;  5EF4 A;  3V6C A;  2H7J A;  1CTE A;  2DZY A;  3PBH A;  2DJG B;  1CJL A;  4K7C A;  1TU6 A;  3HD3 A;  4X6H A;  1PCI A;  4AXM A;  1U5I A;  4Q8G A;  1MS6 A;  3D6S A;  1W6F A;  4W5C A;  2ARY A;  1S4V A;  4QH6 A;  2PBH A;  4W4U A;  1BP4 A;  4BS5 A;  4CDE B;  2P0R A;  1PPO A;  2FO5 A;  3GCB A;  1AYV A;  3QSD A;  1W4T A;  2AUX A;  2OZ2 A;  2DCC A;  4PP2 E;  3MOR A;  1CS8 A;  4FJC A;  1GEC E;  4MSX A;  3MTN A;  1U9Q X;  1IWD A;  1AU2 A;  2XU1 A;  3F5V A;  2YJ2 A;  1ITO A;  2VHF A;  4WA6 A;  1YK8 A;  2CB5 A;  2FYE A;  3IUT A;  4ZUX U;  9PAP A;  1Y08 A;  2GHU A;  4BPV A;  2F1G A;  3S3Q A;  2FRQ A;  2VHS A;  2AS8 A;  4YYQ A;  3P5V A;  1CSB B;  1QMY A;  1NPZ A;  3OVZ A;  2BDZ A;  4BGF A;  1PPP A;  3QJ3 A;  2DC9 A;  3P5X A;  4P6G A;  3BPM A;  3H8B A;  3LFY A;  2NQD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...