1ZCMA

Human calpain protease core inhibited by zllych2f
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
321
structure length
321
Chain Sequence
NAIKYLGQDYEQLRVRCLQSGTLFRDEAFPPVPQSLGYKDLGPNSSKTYGIKWKRPTELLSNPQFIVDGATRTDICQGALGDCWLLAAIASLTLNDTLLHRVVPHGQSFQNGYAGIFHFQLWQFGEWVDVVVDDLLPIKDGKLVFVHSAEGNEFWSALLEKAYAKVNGSYEALSGGSTSEAFEDFTGGVTEWYELRKAPSDLYQIILKALERGSLLGCSIDISSVLDMEAITFKKLVKGHAYSVTGAKQVNYRGQVVSLIRMRNPWGEVEWTGAWSDSSSEWNNVDPYERDQLRVKMEDGEFWMSFRDFMREFTRLEICNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mode of action of a covalently inhibiting peptidomimetic on the human calpain protease core
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Calpain 1, large [catalytic] subunit
total genus 98
structure length 321
sequence length 321
ec nomenclature ec 3.4.22.52: Calpain-1.
pdb deposition date 2005-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00648 Peptidase_C2 Calpain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1zcmA02
2R9OA 2G8JA 2Y5BA 3KWZA 2DCBA 1CJLA 2R9FA 4Q8GA 4YYVA 4HWYA 3K24A 3CBKA 1AIMA 3P5XA 4X6JA 1YT7A 2HXZA 1KXRA 1POPA 5EF4A 4X6IA 4BSQA 3BCNA 3BPMA 2IPPB 3H89A 1VJVA 1ZIVA 4KLBA 1U9VA 1XKGA 1PPNA 4N8WA 1PPOA 1AU4A 3U8EA 3KFQA 3P5VA 4PADA 4QRVA 1NL6A 2XU1A 3B79A 4RY2A 3F5VA 4CZWA 3IOQA 4MZSA 2DC8A 3KWBX 1KFXL 2DJFB 4QBBA 3OVXA 3PNRA 3QSDA 2R6NA 3CH3X 1STFE 2AYNA 2VHSA 3BWKA 2E01A 2YJBA 3WXGA 1CV8A 3IEJA 2ACTA 4W4UA 3M99A 2O6XA 1NQCA 1QOLA 2XU5A 3K8UA 3LFYA 1PCIA 2E00A 4ZUXU 4FIPA 2DCCA 3WXEA 1PXVA 2PREA 4YVAA 1EWOA 4I05A 5CHTA 4BPVA 5EGWA 4PP1A 3MHSA 2IBIA 1AYVA 3MORA 2P7UA 1FH0A 4N4ZA 1PADA 5CVMA 1JQPA 3CBJA 4AXLA 1NB3A 1BY8A 4QH6A 4YYSA 3C9EA 3OISA 3D6SA 2GFOA 4PP2E 6PADA 1MIRA 1CS8A 1EWLA 1QDQA 1TLOA 3KX1A 3E1ZB 2DCDA 3OVZA 1BGOA 1CQDA 2G8EA 3CH2X 1F29A 2JQGR 1Y4HA 1VSNA 1SP4B 1TU6A 1THEA 4BQVA 2OULA 3F75A 3S3QA 2CB5A 3HHAA 3RVVA 1F2AA 2DJGB 3QT4A 2NQDB 5JA7A 2YJ9A 2AS8A 3MTNA 1AU3A 2R9MA 5K16A 2E02A 2FT2A 1CTEA 4G54A 1CB5A 2NQAA 1K3BB 1Y08A 4YYQA 1YK7A 3P5WA 3KSEA 4BS6A 1BP4A 3LXSA 3RVXA 4I04A 4YYWA 3RVWA 1DF0A 1PBHA 1KHPA 2DC7A 2AUZA 2E03A 4Q8HA 1MS6A 2XU4A 1EWPA 1NB5A 2C0YA 2BDZA 2R9NA 4XR7A 2G6DA 1MEMA 3P5UA 4DMYA 3OF9A 5PADA 1QMYA 2R9CA 4YV8A 3KKUA 3HHIA 1GLOA 2XU3A 1PE6A 3OF8A 1YVBA 1U9WA 2FUDA 1CPJA 2AUXA 3PBHA 1Q6KA 2F7DA 3IV2A 2PNSA 4W5CA 1GECE 4OELA 3BC3A 3ZUAA 3BOWA 2P0RA 3H7DA 3WXFA 2VHFA 3O0UA 1EF7A 2OP3A 2FYEA 1O0EA 1X9YA 3PW3A 3H8CA 2HHNA 3PDFA 2CIOA 4QRGA 4CDFB 3IMAA 1U5IA 1GCBA 3IHPA 3N3GA 1M6DA 1SNKA 7PCKA 1EWMA 4CDDB 1AU2A 1KFUL 2NQGA 2P86A 3HWNA 3IUTA 4MZOA 4YYUA 1PPPA 1AYUA 3USVA 5CVOB 1NLJA 3I06A 1ZCMA 2DC9A 1ME3A 4YYRA 1S4VA 3V6EA 4PI3A 1MHWA 1DEUA 2HH5A 3S3RA 2F1GA 5A24A 1AYWA 2DZYA 2DC6A 2WBFX 4FK5A 4CDEB 2YJ8A 2ATOA 2OZ2A 2DCAA 4QRXA 1U9QX 3NHEA 2PADA 2ARYA 4CDCB 1NPZA 5CVNB 2YJ2A 3DF0A 1ME4A 3K9MA 3HD3A 4BS5A 1KHQA 5F02A 3GCBA 1YK8A 4WA6A 2Y6EA 3V6CA 3MHHA 1HUCB 4FJCA 3N4CA 8PCHA 1YALA 5J94A 1MEGA 4P6EA 2G7YA 2B1NA 1CSBB 3AI8A 2PBHA 2B1MA 2FO5A 3KW9A 2AVWA 1ITOA 2H7JA 1F2BA 2FQ9A 2AIMA 3TNXA 1QXPA 3N3KA 2HD5A 1AU0A 1ICFA 2AU1A 1BQIA 9PAPA 5JH3A 2FRQA 1F2CA 4MSXA 4I07A 1GMYA 3ERVA 2JQFR 1PPDA 5FPWA 1MDWA 4P6GA 3BPFA 4X6HA 5CHVA 4DMXA 3O1GA 2AYOA 3QJ3A 4N79A 4K7CA 4AXMA 3H6SA 1TL9A 2GHUA 2DZZA 2FTDA 4XUIA 1A6RA 1AECA 4W5BA 4OEMA 1PIPA 2NQIA 2YJCA 1IWDA 3H8BA 3I3TA 1CVZA 2FRAA 1ATKA 1U9XA 2BDLA
chains in the Genus database with same CATH superfamily
1YZBA 2R9OA 2G8JA 2Y5BA 3KWZA 2DCBA 1CJLA 2R9FA 4Q8GA 4YYVA 4HWYA 3K24A 3CBKA 1AIMA 5EZQA 4A5UA 3P5XA 3TMPA 4X6JA 1YT7A 2HXZA 1KXRA 4D8BA 1POPA 4BOPA 3W30A 5EF4A 3OQCA 4X6IA 4BSQA 3BCNA 3BPMA 2IPPB 3H89A 3RNVA 1VJVA 3PHUA 1ZIVA 4KLBA 1U9VA 1XKGA 1PPNA 4N8WA 1PPOA 1AU4A 3U8EA 4MI7A 3KFQA 3P5VA 4PADA 4QRVA 1NL6A 2XU1A 3B79A 4RY2A 4RKXA 3F5VA 4CZWA 3IOQA 4MZSA 2DC8A 3KWBX 1KFXL 2DJFB 4GUAA 4QBBA 3OVXA 3PNRA 3QSDA 2R6NA 3CH3X 1STFE 2BU3A 2AYNA 3PRPA 2VHSA 3BWKA 2E01A 2YJBA 3WXGA 1CV8A 3PHWA 4BOUA 3C0RA 3IEJA 2ACTA 4BOZA 4W4UA 3M99A 2O6XA 1NQCA 1QOLA 2XU5A 3K8UA 2DOSA 3LFYA 1PCIA 1UKFA 2E00A 4ZUXU 4BOQA 4FIPA 2DCCA 3WXEA 1PXVA 2PREA 4YVAA 2HWKA 4PT5A 1EWOA 2JRIA 4I05A 4XZXA 5CHTA 4BPVA 5EGWA 4PP1A 3MHSA 2IBIA 4MM3B 1AYVA 3MORA 2P7UA 1FH0A 4N4ZA 1PADA 5CVMA 1JQPA 3CBJA 4AXLA 1NB3A 1BY8A 4QH6A 4YYSA 3C9EA 3OISA 3D6SA 2GFOA 4PP2E 6PADA 1MIRA 1CS8A 1EWLA 1QDQA 3W31A 1TLOA 3KX1A 3E1ZB 2DCDA 3OVZA 1BGOA 1CQDA 2G8EA 3CH2X 4IUMA 1F29A 2JQGR 1Y4HA 1VSNA 1SP4B 1TU6A 1THEA 5EZSA 4BQVA 2OULA 3F75A 2Z84A 3S3QA 2CB5A 3HHAA 3RVVA 1F2AA 2JTCA 2DJGB 3QT4A 2NQDB 3BBAA 5JA7A 2YJ9A 2AS8A 3MTNA 1AU3A 2R9MA 5K16A 2E02A 2FT2A 1CTEA 4G54A 5JZEA 4RF1A 1CB5A 2NQAA 1K3BB 1Y08A 4YYQA 1YK7A 3P5WA 3KSEA 4BS6A 1BP4A 3LXSA 3RVXA 2BTWB 4I04A 4YYWA 3RVWA 2FE8A 1DF0A 3BY4A 1PBHA 1KHPA 2DC7A 2AUZA 2E03A 1DKIA 4Q8HA 1MS6A 2XU4A 1EWPA 3MTVA 1NB5A 2C0YA 2BDZA 2R9NA 4XR7A 3E9SA 3BB7A 2G6DA 1MEMA 3P5UA 4DMYA 3OF9A 2AGAA 5PADA 3PT2A 1QMYA 2R9CA 4YV8A 3KKUA 1PVJA 3HHIA 4OVZA 1GLOA 2XU3A 4RF0A 1PE6A 3OF8A 1YVBA 1U9WA 2FUDA 1CPJA 2AUXA 3PBHA 3O65A 3MJ5A 1Q6KA 2F7DA 3IV2A 2PNSA 4W5CA 1GECE 4OELA 3BC3A 3ZUAA 3BOWA 2P0RA 3H7DA 2J7QA 3WXFA 2VHFA 3O0UA 1EF7A 2OP3A 2FYEA 4P16A 1O0EA 1X9YA 3PW3A 3H8CA 2HHNA 3PDFA 2CIOA 4QRGA 4CDFB 3IMAA 1U5IA 1GCBA 3IHPA 3N3GA 1M6DA 1SNKA 7PCKA 1EWMA 4CDDB 1AU2A 1KFUL 2NQGA 2P86A 5KO3A 3HWNA 3IUTA 4MZOA 4YYUA 1PPPA 1AYUA 3USVA 5CVOB 1NLJA 3I06A 4REZA 1ZCMA 2DC9A 4WURA 1ME3A 4YYRA 1S4VA 3V6EA 4PI3A 1MHWA 1DEUA 2HH5A 3S3RA 2F1GA 5A24A 3PSEA 1AYWA 3TRKA 2DZYA 2DC6A 2WBFX 4FK5A 5E6JA 4CDEB 2YJ8A 4BOSA 2ATOA 2OZ2A 2DCAA 4M0WA 4QRXA 1U9QX 3NHEA 3IFUA 2PADA 2ARYA 4CDCB 1NPZA 2J7QC 4OVZB 5CVNB 2YJ2A 3DF0A 1ME4A 3K9MA 3HD3A 4BS5A 1KHQA 5F02A 3GCBA 1YK8A 4WA6A 2Y6EA 3V6CA 3MHHA 1HUCB 4FJCA 4RNAA 3N4CA 8PCHA 1YALA 5J94A 1MEGA 4P6EA 2G7YA 2B1NA 1CSBB 3AI8A 2PBHA 2B1MA 2FO5A 3KW9A 2AVWA 2BTWA 1ITOA 3PHXA 2H7JA 3ZNHA 1F2BA 2FQ9A 2AIMA 3TNXA 1QXPA 3N3KA 2HD5A 1AU0A 1ICFA 4IP3A 2AU1A 1BQIA 9PAPA 5JH3A 4D8EA 2FRQA 4R3DA 1F2CA 4MSXA 4I07A 1GMYA 3ERVA 2JQFR 1PPDA 5FPWA 1MDWA 4P6GA 3BPFA 4X6HA 5CHVA 4DMXA 3O1GA 2AYOA 4OW0A 3QJ3A 4ZTBA 4N79A 4K7CA 4D8IA 2UZJA 4AXMA 3H6SA 1TL9A 2GHUA 2DZZA 4HXDB 3MP2A 2FTDA 4XUIA 1A6RA 1AECA 3PRMA 4W5BA 4OEMA 1PIPA 2NQIA 2YJCA 1IWDA 3H8BA 3I3TA 1CVZA 2FRAA 3B21A 1ATKA 1U9XA 2BDLA
chains in the Genus database with same CATH topology
4BGFA 2R9OA 2G8JA 2Y5BA 3KWZA 2DCBA 1CJLA 2R9FA 4Q8GA 4YYVA 4HWYA 3K24A 3CBKA 1AIMA 3P5XA 4X6JA 1YT7A 2HXZA 1KXRA 1POPA 5EF4A 4NV8A 4X6IA 4BSQA 3BCNA 3BPMA 2IPPB 3H89A 1VJVA 1ZIVA 4KLBA 1U9VA 1XKGA 1PPNA 4N8WA 1PPOA 1AU4A 3U8EA 3KFQA 3P5VA 4PADA 4GUZA 4QRVA 1NL6A 2XU1A 3B79A 4RY2A 3F5VA 4CZWA 3IOQA 4MZSA 2DC8A 3KWBX 1KFXL 2DJFB 4QBBA 3OVXA 3PNRA 3QSDA 2R6NA 3CH3X 4NV7A 1STFE 2AYNA 4C5PA 2VHSA 3BWKA 2E01A 2YJBA 3WXGA 1CV8A 3IEJA 2ACTA 2VFBA 4W4UA 3M99A 2O6XA 1NQCA 1QOLA 2XU5A 3K8UA 3LFYA 1PCIA 2E00A 4ZUXU 4FIPA 2DCCA 3WXEA 1PXVA 2PREA 4YVAA 1EWOA 4I05A 5CHTA 4BPVA 5EGWA 4PP1A 3MHSA 2IBIA 4B55A 1AYVA 3MORA 2P7UA 1FH0A 4N4ZA 1PADA 5CVMA 1JQPA 3CBJA 4AXLA 1NB3A 1BY8A 2BSZA 4QH6A 4YYSA 3C9EA 3OISA 3D6SA 2GFOA 4PP2E 6PADA 1MIRA 1CS8A 1EWLA 1QDQA 1TLOA 3KX1A 3E1ZB 2DCDA 3OVZA 1BGOA 1CQDA 2G8EA 3CH2X 1F29A 2JQGR 1Y4HA 1VSNA 1SP4B 1TU6A 1THEA 4BQVA 2OULA 3F75A 3S3QA 3LTWA 2CB5A 3HHAA 3RVVA 1F2AA 2DJGB 3QT4A 2NQDB 5JA7A 2YJ9A 2AS8A 3MTNA 1AU3A 2R9MA 5K16A 2E02A 2FT2A 1CTEA 4G54A 1CB5A 2NQAA 1K3BB 1Y08A 4YYQA 1YK7A 3P5WA 3KSEA 4BS6A 1BP4A 3LXSA 3RVXA 4I04A 4YYWA 3RVWA 1DF0A 1PBHA 1KHPA 2DC7A 2AUZA 2E03A 4Q8HA 1MS6A 2XU4A 1EWPA 1NB5A 2C0YA 2BDZA 2R9NA 4XR7A 2G6DA 1MEMA 3P5UA 4DMYA 3OF9A 5PADA 1QMYA 2R9CA 4YV8A 3KKUA 3HHIA 1GLOA 2XU3A 1PE6A 3OF8A 1YVBA 1U9WA 2FUDA 1W5RA 1CPJA 2AUXA 3PBHA 1Q6KA 2F7DA 3IV2A 2PNSA 4W5CA 1GECE 4OELA 3BC3A 3ZUAA 3BOWA 2P0RA 3H7DA 3WXFA 2VHFA 3O0UA 1EF7A 2OP3A 2FYEA 1O0EA 1X9YA 3PW3A 3H8CA 2HHNA 3PDFA 2CIOA 4QRGA 4CDFB 3IMAA 1U5IA 1GCBA 3IHPA 3N3GA 1M6DA 1SNKA 1W4TA 7PCKA 1EWMA 4CDDB 1AU2A 1KFUL 2NQGA 2P86A 3HWNA 2VFCA 3IUTA 4MZOA 4YYUA 1PPPA 1AYUA 3USVA 5CVOB 1NLJA 3I06A 1ZCMA 2DC9A 1ME3A 4YYRA 1S4VA 3V6EA 4PI3A 1MHWA 1DEUA 2HH5A 3S3RA 2F1GA 5A24A 1AYWA 2DZYA 2DC6A 2WBFX 4FK5A 4CDEB 2YJ8A 2ATOA 2OZ2A 2DCAA 4QRXA 1U9QX 3NHEA 2PADA 2ARYA 4CDCB 1NPZA 5CVNB 2YJ2A 3D9WA 3DF0A 1ME4A 3K9MA 3HD3A 4BS5A 1KHQA 5F02A 3GCBA 1YK8A 4WA6A 2Y6EA 3V6CA 3MHHA 1HUCB 4FJCA 3N4CA 8PCHA 1YALA 5J94A 1MEGA 4P6EA 2G7YA 2B1NA 1CSBB 3AI8A 2PBHA 2B1MA 2FO5A 1E2TA 3KW9A 2AVWA 1ITOA 2H7JA 1F2BA 2FQ9A 2AIMA 3TNXA 1QXPA 3N3KA 2HD5A 1AU0A 1ICFA 2AU1A 1BQIA 9PAPA 5JH3A 2FRQA 1F2CA 4MSXA 4I07A 1GMYA 3ERVA 2JQFR 1PPDA 5FPWA 1MDWA 4P6GA 3BPFA 4X6HA 5CHVA 4DMXA 3O1GA 2AYOA 1W6FA 3QJ3A 4N79A 4K7CA 4AXMA 3H6SA 1TL9A 2GHUA 2DZZA 2FTDA 4XUIA 1A6RA 1AECA 4W5BA 4OEMA 1PIPA 2NQIA 2YJCA 1IWDA 3H8BA 3I3TA 1CVZA 1GX3A 2FRAA 1ATKA 1U9XA 2BDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R9O A;  2G8J A;  2Y5B A;  3KWZ A;  2DCB A;  1CJL A;  2R9F A;  4Q8G A;  4YYV A;  4HWY A;  3K24 A;  3CBK A;  1AIM A;  3P5X A;  4X6J A;  1YT7 A;  2HXZ A;  1KXR A;  1POP A;  5EF4 A;  4X6I A;  4BSQ A;  3BCN A;  3BPM A;  2IPP B;  3H89 A;  1VJV A;  1ZIV A;  4KLB A;  1U9V A;  1XKG A;  1PPN A;  4N8W A;  1PPO A;  1AU4 A;  3U8E A;  3KFQ A;  3P5V A;  4PAD A;  4QRV A;  1NL6 A;  2XU1 A;  3B79 A;  4RY2 A;  3F5V A;  4CZW A;  3IOQ A;  4MZS A;  2DC8 A;  3KWB X;  1KFX L;  2DJF B;  4QBB A;  3OVX A;  3PNR A;  3QSD A;  2R6N A;  3CH3 X;  1STF E;  2AYN A;  2VHS A;  3BWK A;  2E01 A;  2YJB A;  3WXG A;  1CV8 A;  3IEJ A;  2ACT A;  4W4U A;  3M99 A;  2O6X A;  1NQC A;  1QOL A;  2XU5 A;  3K8U A;  3LFY A;  1PCI A;  2E00 A;  4ZUX U;  4FIP A;  2DCC A;  3WXE A;  1PXV A;  2PRE A;  4YVA A;  1EWO A;  4I05 A;  5CHT A;  4BPV A;  5EGW A;  4PP1 A;  3MHS A;  2IBI A;  1AYV A;  3MOR A;  2P7U A;  1FH0 A;  4N4Z A;  1PAD A;  5CVM A;  1JQP A;  3CBJ A;  4AXL A;  1NB3 A;  1BY8 A;  4QH6 A;  4YYS A;  3C9E A;  3OIS A;  3D6S A;  2GFO A;  4PP2 E;  6PAD A;  1MIR A;  1CS8 A;  1EWL A;  1QDQ A;  1TLO A;  3KX1 A;  3E1Z B;  2DCD A;  3OVZ A;  1BGO A;  1CQD A;  2G8E A;  3CH2 X;  1F29 A;  2JQG R;  1Y4H A;  1VSN A;  1SP4 B;  1TU6 A;  1THE A;  4BQV A;  2OUL A;  3F75 A;  3S3Q A;  2CB5 A;  3HHA A;  3RVV A;  1F2A A;  2DJG B;  3QT4 A;  2NQD B;  5JA7 A;  2YJ9 A;  2AS8 A;  3MTN A;  1AU3 A;  2R9M A;  5K16 A;  2E02 A;  2FT2 A;  1CTE A;  4G54 A;  1CB5 A;  2NQA A;  1K3B B;  1Y08 A;  4YYQ A;  1YK7 A;  3P5W A;  3KSE A;  4BS6 A;  1BP4 A;  3LXS A;  3RVX A;  4I04 A;  4YYW A;  3RVW A;  1DF0 A;  1PBH A;  1KHP A;  2DC7 A;  2AUZ A;  2E03 A;  4Q8H A;  1MS6 A;  2XU4 A;  1EWP A;  1NB5 A;  2C0Y A;  2BDZ A;  2R9N A;  4XR7 A;  2G6D A;  1MEM A;  3P5U A;  4DMY A;  3OF9 A;  5PAD A;  1QMY A;  2R9C A;  4YV8 A;  3KKU A;  3HHI A;  1GLO A;  2XU3 A;  1PE6 A;  3OF8 A;  1YVB A;  1U9W A;  2FUD A;  1CPJ A;  2AUX A;  3PBH A;  1Q6K A;  2F7D A;  3IV2 A;  2PNS A;  4W5C A;  1GEC E;  4OEL A;  3BC3 A;  3ZUA A;  3BOW A;  2P0R A;  3H7D A;  3WXF A;  2VHF A;  3O0U A;  1EF7 A;  2OP3 A;  2FYE A;  1O0E A;  1X9Y A;  3PW3 A;  3H8C A;  2HHN A;  3PDF A;  2CIO A;  4QRG A;  4CDF B;  3IMA A;  1U5I A;  1GCB A;  3IHP A;  3N3G A;  1M6D A;  1SNK A;  7PCK A;  1EWM A;  4CDD B;  1AU2 A;  1KFU L;  2NQG A;  2P86 A;  3HWN A;  3IUT A;  4MZO A;  4YYU A;  1PPP A;  1AYU A;  3USV A;  5CVO B;  1NLJ A;  3I06 A;  1ZCM A;  2DC9 A;  1ME3 A;  4YYR A;  1S4V A;  3V6E A;  4PI3 A;  1MHW A;  1DEU A;  2HH5 A;  3S3R A;  2F1G A;  5A24 A;  1AYW A;  2DZY A;  2DC6 A;  2WBF X;  4FK5 A;  4CDE B;  2YJ8 A;  2ATO A;  2OZ2 A;  2DCA A;  4QRX A;  1U9Q X;  3NHE A;  2PAD A;  2ARY A;  4CDC B;  1NPZ A;  5CVN B;  2YJ2 A;  3DF0 A;  1ME4 A;  3K9M A;  3HD3 A;  4BS5 A;  1KHQ A;  5F02 A;  3GCB A;  1YK8 A;  4WA6 A;  2Y6E A;  3V6C A;  3MHH A;  1HUC B;  4FJC A;  3N4C A;  8PCH A;  1YAL A;  5J94 A;  1MEG A;  4P6E A;  2G7Y A;  2B1N A;  1CSB B;  3AI8 A;  2PBH A;  2B1M A;  2FO5 A;  3KW9 A;  2AVW A;  1ITO A;  2H7J A;  1F2B A;  2FQ9 A;  2AIM A;  3TNX A;  1QXP A;  3N3K A;  2HD5 A;  1AU0 A;  1ICF A;  2AU1 A;  1BQI A;  9PAP A;  5JH3 A;  2FRQ A;  1F2C A;  4MSX A;  4I07 A;  1GMY A;  3ERV A;  2JQF R;  1PPD A;  5FPW A;  1MDW A;  4P6G A;  3BPF A;  4X6H A;  5CHV A;  4DMX A;  3O1G A;  2AYO A;  3QJ3 A;  4N79 A;  4K7C A;  4AXM A;  3H6S A;  1TL9 A;  2GHU A;  2DZZ A;  2FTD A;  4XUI A;  1A6R A;  1AEC A;  4W5B A;  4OEM A;  1PIP A;  2NQI A;  2YJC A;  1IWD A;  3H8B A;  3I3T A;  1CVZ A;  2FRA A;  1ATK A;  1U9X A;  2BDL A; 
#chains in the Genus database with same CATH topology
 1YZB A;  2R9O A;  2G8J A;  2Y5B A;  3KWZ A;  2DCB A;  1CJL A;  2R9F A;  4Q8G A;  4YYV A;  4HWY A;  3K24 A;  3CBK A;  1AIM A;  5EZQ A;  4A5U A;  3P5X A;  3TMP A;  4X6J A;  1YT7 A;  2HXZ A;  1KXR A;  4D8B A;  1POP A;  4BOP A;  3W30 A;  5EF4 A;  3OQC A;  4X6I A;  4BSQ A;  3BCN A;  3BPM A;  2IPP B;  3H89 A;  3RNV A;  1VJV A;  3PHU A;  1ZIV A;  4KLB A;  1U9V A;  1XKG A;  1PPN A;  4N8W A;  1PPO A;  1AU4 A;  3U8E A;  4MI7 A;  3KFQ A;  3P5V A;  4PAD A;  4QRV A;  1NL6 A;  2XU1 A;  3B79 A;  4RY2 A;  4RKX A;  3F5V A;  4CZW A;  3IOQ A;  4MZS A;  2DC8 A;  3KWB X;  1KFX L;  2DJF B;  4GUA A;  4QBB A;  3OVX A;  3PNR A;  3QSD A;  2R6N A;  3CH3 X;  1STF E;  2BU3 A;  2AYN A;  3PRP A;  2VHS A;  3BWK A;  2E01 A;  2YJB A;  3WXG A;  1CV8 A;  3PHW A;  4BOU A;  3C0R A;  3IEJ A;  2ACT A;  4BOZ A;  4W4U A;  3M99 A;  2O6X A;  1NQC A;  1QOL A;  2XU5 A;  3K8U A;  2DOS A;  3LFY A;  1PCI A;  1UKF A;  2E00 A;  4ZUX U;  4BOQ A;  4FIP A;  2DCC A;  3WXE A;  1PXV A;  2PRE A;  4YVA A;  2HWK A;  4PT5 A;  1EWO A;  2JRI A;  4I05 A;  4XZX A;  5CHT A;  4BPV A;  5EGW A;  4PP1 A;  3MHS A;  2IBI A;  4MM3 B;  1AYV A;  3MOR A;  2P7U A;  1FH0 A;  4N4Z A;  1PAD A;  5CVM A;  1JQP A;  3CBJ A;  4AXL A;  1NB3 A;  1BY8 A;  4QH6 A;  4YYS A;  3C9E A;  3OIS A;  3D6S A;  2GFO A;  4PP2 E;  6PAD A;  1MIR A;  1CS8 A;  1EWL A;  1QDQ A;  3W31 A;  1TLO A;  3KX1 A;  3E1Z B;  2DCD A;  3OVZ A;  1BGO A;  1CQD A;  2G8E A;  3CH2 X;  4IUM A;  1F29 A;  2JQG R;  1Y4H A;  1VSN A;  1SP4 B;  1TU6 A;  1THE A;  5EZS A;  4BQV A;  2OUL A;  3F75 A;  2Z84 A;  3S3Q A;  2CB5 A;  3HHA A;  3RVV A;  1F2A A;  2JTC A;  2DJG B;  3QT4 A;  2NQD B;  3BBA A;  5JA7 A;  2YJ9 A;  2AS8 A;  3MTN A;  1AU3 A;  2R9M A;  5K16 A;  2E02 A;  2FT2 A;  1CTE A;  4G54 A;  5JZE A;  4RF1 A;  1CB5 A;  2NQA A;  1K3B B;  1Y08 A;  4YYQ A;  1YK7 A;  3P5W A;  3KSE A;  4BS6 A;  1BP4 A;  3LXS A;  3RVX A;  2BTW B;  4I04 A;  4YYW A;  3RVW A;  2FE8 A;  1DF0 A;  3BY4 A;  1PBH A;  1KHP A;  2DC7 A;  2AUZ A;  2E03 A;  1DKI A;  4Q8H A;  1MS6 A;  2XU4 A;  1EWP A;  3MTV A;  1NB5 A;  2C0Y A;  2BDZ A;  2R9N A;  4XR7 A;  3E9S A;  3BB7 A;  2G6D A;  1MEM A;  3P5U A;  4DMY A;  3OF9 A;  2AGA A;  5PAD A;  3PT2 A;  1QMY A;  2R9C A;  4YV8 A;  3KKU A;  1PVJ A;  3HHI A;  4OVZ A;  1GLO A;  2XU3 A;  4RF0 A;  1PE6 A;  3OF8 A;  1YVB A;  1U9W A;  2FUD A;  1CPJ A;  2AUX A;  3PBH A;  3O65 A;  3MJ5 A;  1Q6K A;  2F7D A;  3IV2 A;  2PNS A;  4W5C A;  1GEC E;  4OEL A;  3BC3 A;  3ZUA A;  3BOW A;  2P0R A;  3H7D A;  2J7Q A;  3WXF A;  2VHF A;  3O0U A;  1EF7 A;  2OP3 A;  2FYE A;  4P16 A;  1O0E A;  1X9Y A;  3PW3 A;  3H8C A;  2HHN A;  3PDF A;  2CIO A;  4QRG A;  4CDF B;  3IMA A;  1U5I A;  1GCB A;  3IHP A;  3N3G A;  1M6D A;  1SNK A;  7PCK A;  1EWM A;  4CDD B;  1AU2 A;  1KFU L;  2NQG A;  2P86 A;  5KO3 A;  3HWN A;  3IUT A;  4MZO A;  4YYU A;  1PPP A;  1AYU A;  3USV A;  5CVO B;  1NLJ A;  3I06 A;  4REZ A;  1ZCM A;  2DC9 A;  4WUR A;  1ME3 A;  4YYR A;  1S4V A;  3V6E A;  4PI3 A;  1MHW A;  1DEU A;  2HH5 A;  3S3R A;  2F1G A;  5A24 A;  3PSE A;  1AYW A;  3TRK A;  2DZY A;  2DC6 A;  2WBF X;  4FK5 A;  5E6J A;  4CDE B;  2YJ8 A;  4BOS A;  2ATO A;  2OZ2 A;  2DCA A;  4M0W A;  4QRX A;  1U9Q X;  3NHE A;  3IFU A;  2PAD A;  2ARY A;  4CDC B;  1NPZ A;  2J7Q C;  4OVZ B;  5CVN B;  2YJ2 A;  3DF0 A;  1ME4 A;  3K9M A;  3HD3 A;  4BS5 A;  1KHQ A;  5F02 A;  3GCB A;  1YK8 A;  4WA6 A;  2Y6E A;  3V6C A;  3MHH A;  1HUC B;  4FJC A;  4RNA A;  3N4C A;  8PCH A;  1YAL A;  5J94 A;  1MEG A;  4P6E A;  2G7Y A;  2B1N A;  1CSB B;  3AI8 A;  2PBH A;  2B1M A;  2FO5 A;  3KW9 A;  2AVW A;  2BTW A;  1ITO A;  3PHX A;  2H7J A;  3ZNH A;  1F2B A;  2FQ9 A;  2AIM A;  3TNX A;  1QXP A;  3N3K A;  2HD5 A;  1AU0 A;  1ICF A;  4IP3 A;  2AU1 A;  1BQI A;  9PAP A;  5JH3 A;  4D8E A;  2FRQ A;  4R3D A;  1F2C A;  4MSX A;  4I07 A;  1GMY A;  3ERV A;  2JQF R;  1PPD A;  5FPW A;  1MDW A;  4P6G A;  3BPF A;  4X6H A;  5CHV A;  4DMX A;  3O1G A;  2AYO A;  4OW0 A;  3QJ3 A;  4ZTB A;  4N79 A;  4K7C A;  4D8I A;  2UZJ A;  4AXM A;  3H6S A;  1TL9 A;  2GHU A;  2DZZ A;  4HXD B;  3MP2 A;  2FTD A;  4XUI A;  1A6R A;  1AEC A;  3PRM A;  4W5B A;  4OEM A;  1PIP A;  2NQI A;  2YJC A;  1IWD A;  3H8B A;  3I3T A;  1CVZ A;  2FRA A;  3B21 A;  1ATK A;  1U9X A;  2BDL A; 
#chains in the Genus database with same CATH homology
 4BGF A;  2R9O A;  2G8J A;  2Y5B A;  3KWZ A;  2DCB A;  1CJL A;  2R9F A;  4Q8G A;  4YYV A;  4HWY A;  3K24 A;  3CBK A;  1AIM A;  3P5X A;  4X6J A;  1YT7 A;  2HXZ A;  1KXR A;  1POP A;  5EF4 A;  4NV8 A;  4X6I A;  4BSQ A;  3BCN A;  3BPM A;  2IPP B;  3H89 A;  1VJV A;  1ZIV A;  4KLB A;  1U9V A;  1XKG A;  1PPN A;  4N8W A;  1PPO A;  1AU4 A;  3U8E A;  3KFQ A;  3P5V A;  4PAD A;  4GUZ A;  4QRV A;  1NL6 A;  2XU1 A;  3B79 A;  4RY2 A;  3F5V A;  4CZW A;  3IOQ A;  4MZS A;  2DC8 A;  3KWB X;  1KFX L;  2DJF B;  4QBB A;  3OVX A;  3PNR A;  3QSD A;  2R6N A;  3CH3 X;  4NV7 A;  1STF E;  2AYN A;  4C5P A;  2VHS A;  3BWK A;  2E01 A;  2YJB A;  3WXG A;  1CV8 A;  3IEJ A;  2ACT A;  2VFB A;  4W4U A;  3M99 A;  2O6X A;  1NQC A;  1QOL A;  2XU5 A;  3K8U A;  3LFY A;  1PCI A;  2E00 A;  4ZUX U;  4FIP A;  2DCC A;  3WXE A;  1PXV A;  2PRE A;  4YVA A;  1EWO A;  4I05 A;  5CHT A;  4BPV A;  5EGW A;  4PP1 A;  3MHS A;  2IBI A;  4B55 A;  1AYV A;  3MOR A;  2P7U A;  1FH0 A;  4N4Z A;  1PAD A;  5CVM A;  1JQP A;  3CBJ A;  4AXL A;  1NB3 A;  1BY8 A;  2BSZ A;  4QH6 A;  4YYS A;  3C9E A;  3OIS A;  3D6S A;  2GFO A;  4PP2 E;  6PAD A;  1MIR A;  1CS8 A;  1EWL A;  1QDQ A;  1TLO A;  3KX1 A;  3E1Z B;  2DCD A;  3OVZ A;  1BGO A;  1CQD A;  2G8E A;  3CH2 X;  1F29 A;  2JQG R;  1Y4H A;  1VSN A;  1SP4 B;  1TU6 A;  1THE A;  4BQV A;  2OUL A;  3F75 A;  3S3Q A;  3LTW A;  2CB5 A;  3HHA A;  3RVV A;  1F2A A;  2DJG B;  3QT4 A;  2NQD B;  5JA7 A;  2YJ9 A;  2AS8 A;  3MTN A;  1AU3 A;  2R9M A;  5K16 A;  2E02 A;  2FT2 A;  1CTE A;  4G54 A;  1CB5 A;  2NQA A;  1K3B B;  1Y08 A;  4YYQ A;  1YK7 A;  3P5W A;  3KSE A;  4BS6 A;  1BP4 A;  3LXS A;  3RVX A;  4I04 A;  4YYW A;  3RVW A;  1DF0 A;  1PBH A;  1KHP A;  2DC7 A;  2AUZ A;  2E03 A;  4Q8H A;  1MS6 A;  2XU4 A;  1EWP A;  1NB5 A;  2C0Y A;  2BDZ A;  2R9N A;  4XR7 A;  2G6D A;  1MEM A;  3P5U A;  4DMY A;  3OF9 A;  5PAD A;  1QMY A;  2R9C A;  4YV8 A;  3KKU A;  3HHI A;  1GLO A;  2XU3 A;  1PE6 A;  3OF8 A;  1YVB A;  1U9W A;  2FUD A;  1W5R A;  1CPJ A;  2AUX A;  3PBH A;  1Q6K A;  2F7D A;  3IV2 A;  2PNS A;  4W5C A;  1GEC E;  4OEL A;  3BC3 A;  3ZUA A;  3BOW A;  2P0R A;  3H7D A;  3WXF A;  2VHF A;  3O0U A;  1EF7 A;  2OP3 A;  2FYE A;  1O0E A;  1X9Y A;  3PW3 A;  3H8C A;  2HHN A;  3PDF A;  2CIO A;  4QRG A;  4CDF B;  3IMA A;  1U5I A;  1GCB A;  3IHP A;  3N3G A;  1M6D A;  1SNK A;  1W4T A;  7PCK A;  1EWM A;  4CDD B;  1AU2 A;  1KFU L;  2NQG A;  2P86 A;  3HWN A;  2VFC A;  3IUT A;  4MZO A;  4YYU A;  1PPP A;  1AYU A;  3USV A;  5CVO B;  1NLJ A;  3I06 A;  1ZCM A;  2DC9 A;  1ME3 A;  4YYR A;  1S4V A;  3V6E A;  4PI3 A;  1MHW A;  1DEU A;  2HH5 A;  3S3R A;  2F1G A;  5A24 A;  1AYW A;  2DZY A;  2DC6 A;  2WBF X;  4FK5 A;  4CDE B;  2YJ8 A;  2ATO A;  2OZ2 A;  2DCA A;  4QRX A;  1U9Q X;  3NHE A;  2PAD A;  2ARY A;  4CDC B;  1NPZ A;  5CVN B;  2YJ2 A;  3D9W A;  3DF0 A;  1ME4 A;  3K9M A;  3HD3 A;  4BS5 A;  1KHQ A;  5F02 A;  3GCB A;  1YK8 A;  4WA6 A;  2Y6E A;  3V6C A;  3MHH A;  1HUC B;  4FJC A;  3N4C A;  8PCH A;  1YAL A;  5J94 A;  1MEG A;  4P6E A;  2G7Y A;  2B1N A;  1CSB B;  3AI8 A;  2PBH A;  2B1M A;  2FO5 A;  1E2T A;  3KW9 A;  2AVW A;  1ITO A;  2H7J A;  1F2B A;  2FQ9 A;  2AIM A;  3TNX A;  1QXP A;  3N3K A;  2HD5 A;  1AU0 A;  1ICF A;  2AU1 A;  1BQI A;  9PAP A;  5JH3 A;  2FRQ A;  1F2C A;  4MSX A;  4I07 A;  1GMY A;  3ERV A;  2JQF R;  1PPD A;  5FPW A;  1MDW A;  4P6G A;  3BPF A;  4X6H A;  5CHV A;  4DMX A;  3O1G A;  2AYO A;  1W6F A;  3QJ3 A;  4N79 A;  4K7C A;  4AXM A;  3H6S A;  1TL9 A;  2GHU A;  2DZZ A;  2FTD A;  4XUI A;  1A6R A;  1AEC A;  4W5B A;  4OEM A;  1PIP A;  2NQI A;  2YJC A;  1IWD A;  3H8B A;  3I3T A;  1CVZ A;  1GX3 A;  2FRA A;  1ATK A;  1U9X A;  2BDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...