3U8EA

Crystal structure of cysteine protease from bulbs of crocus sativus at 1.3 a resolution
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
222
structure length
216
Chain Sequence
APASIDWRKKGAVTSVKDQGACGMCWAFGATGAIEGIDAITTGRLISVSEQQIVDCDTGGDADDAFRWVITNGGIASDANYPYTGVDGTCDLNKPIAARIDGYTNVPNSSSALLDAVAKQPVSVNIYTSSTSFQLYTGPGIFAGSSCSDDPATVDHTVLIVGYGSNGTNADYWIVKNSWGTEWGIDGYILIRRNTNRPDGVCAIDAWGSYPTKSTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Papain-like Cysteine Protease
publication title Crystal Structure of A Papain-like Cysteine Protease from Bulbs of Crocus sativum at 1.3 A resolution
rcsb
total genus 62
structure length 216
sequence length 222
ec nomenclature
pdb deposition date 2011-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3u8eA00
4YVAA 1MHWA 1PPDA 2AVWA 4WA6A 3O1GA 3HD3A 2YJBA 1QXPA 2B1NA 1TLOA 2FQ9A 3KWBX 3HHIA 1PPOA 1GCBA 2NQDB 1AYWA 4I05A 2HHNA 1DEUA 1POPA 4N4ZA 5CHTA 1STFE 3P5WA 4QRXA 2OULA 5K16A 1AECA 2DC8A 1QOLA 3IV2A 1PPNA 1F29A 3CH3X 3S3RA 3PW3A 3BC3A 4G54A 3H8BA 4W5CA 1NB3A 2R9MA 2G7YA 3KX1A 1PCIA 3BPFA 4X6IA 2VHFA 1YALA 3K8UA 5EF4A 3KFQA 2FTDA 5JH3A 4I04A 1SP4B 1F2CA 2E02A 3K24A 3O0UA 9PAPA 4CZWA 1O0EA 1PADA 2DC9A 3KSEA 1AU4A 2DZYA 1AYVA 1NL6A 1S4VA 1U5IA 1AU0A 4PP2E 1QMYA 3BOWA 2R9CA 1ZCMA 1MDWA 1ME4A 2Y5BA 1XKGA 1CJLA 4XR7A 3U8EA 3RVVA 3WXEA 4K7CA 3N3GA 4DMYA 1EWPA 3LXSA 3P5VA 1YT7A 2P0RA 5JA7A 1YVBA 5CVNB 2E00A 1ITOA 1KXRA 3B79A 3N4CA 1ICFA 2AIMA 2JQFR 1AU3A 1NQCA 2IPPB 4FK5A 4FIPA 3MTNA 2C0YA 3DF0A 3IMAA 3NHEA 4CDDB 2YJ9A 3I06A 8PCHA 1QDQA 3QT4A 1BQIA 3PNRA 1NLJA 4I07A 4CDEB 3PBHA 3F5VA 1AU2A 3OF8A 1U9VA 2XU1A 5J94A 2PBHA 2DCBA 4QRVA 3ERVA 3M99A 2FRAA 2PNSA 2HXZA 3OF9A 1AIMA 1AYUA 3GCBA 3V6CA 1NPZA 4AXMA 1KHPA 2DJGB 3P5UA 5PADA 1KFUL 2WBFX 1CS8A 3BWKA 3RVWA 2F1GA 4W4UA 2PREA 2H7JA 3AI8A 2VHSA 3H89A 4YYVA 1ME3A 4X6HA 1FH0A 4QRGA 1MIRA 1U9WA 2F7DA 1VJVA 1BY8A 2XU5A 4DMXA 3MORA 4YYUA 5A24A 2FRQA 2CB5A 4Q8HA 1MEMA 2DCCA 1PE6A 4RY2A 3QSDA 1ATKA 3CBKA 1U9XA 4BS6A 2BDLA 1EWOA 2DZZA 2NQIA 2ACTA 4MSXA 2R9FA 2AUZA 4ZUXU 2FUDA 2E01A 1CTEA 3KW9A 2PADA 4W5BA 1CPJA 1Y4HA 3I3TA 1GECE 3F75A 2XU3A 1PBHA 3BPMA 2R9OA 2AU1A 2P86A 3H6SA 3QJ3A 2G6DA 2DC6A 3KWZA 4PI3A 2FT2A 2Y6EA 2ARYA 3OVXA 2IBIA 2YJCA 1A6RA 4CDCB 1YK7A 2G8JA 3S3QA 1U9QX 1PPPA 7PCKA 3TNXA 3IOQA 2R9NA 1PXVA 5FPWA 2DJFB 1NB5A 1TL9A 3PDFA 3HHAA 4YYRA 2OP3A 3V6EA 1IWDA 4HWYA 2CIOA 3WXGA 4QBBA 5CVOB 3IEJA 3ZUAA 3BCNA 4FJCA 1F2AA 4BSQA 1EF7A 2B1MA 4P6EA 1CSBB 4YYQA 1PIPA 5CVMA 2YJ8A 4X6JA 2DC7A 6PADA 4YYSA 3H8CA 1BP4A 1EWMA 1SNKA 2AS8A 3LFYA 4QH6A 2NQGA 3E1ZB 4YYWA 2XU4A 1MEGA 4YV8A 4BS5A 2DCAA 5F02A 2FO5A 4CDFB 3HWNA 3IHPA 2AYNA 4PADA 3CBJA 1VSNA 3H7DA 1GLOA 4N79A 4MZSA 1CQDA 2HH5A 1GMYA 3K9MA 2E03A 3N3KA 1DF0A 3RVXA 1K3BB 1BGOA 4KLBA 1TU6A 3KKUA 3USVA 4OELA 1HUCB 2P7UA 2OZ2A 1CV8A 3OISA 1JQPA 4OEMA 2GFOA 4AXLA 3IUTA 1M6DA 4MZOA 2AYOA 1ZIVA 2YJ2A 4P6GA 1THEA 3MHSA 5EGWA 2R6NA 3P5XA 3CH2X 2BDZA 2HD5A 1CVZA 4Q8GA 3C9EA 1EWLA 1X9YA 1F2BA 1CB5A 1KFXL 2O6XA 3OVZA 5CHVA 3WXFA 2AUXA 1MS6A 2GHUA 4N8WA 1KHQA 2JQGR 2ATOA 1Y08A 4BQVA 2NQAA 2DCDA 2G8EA 3MHHA 4XUIA 1Q6KA 3D6SA 1YK8A 2FYEA 4BPVA 4PP1A
chains in the Genus database with same CATH superfamily
4YVAA 1MHWA 1PPDA 2AVWA 4WA6A 3O1GA 3HD3A 2YJBA 1QXPA 3W30A 2B1NA 1TLOA 2FQ9A 3KWBX 4IP3A 3HHIA 1PPOA 1GCBA 2NQDB 1AYWA 4I05A 2HHNA 1DEUA 1POPA 4N4ZA 5CHTA 1STFE 3P5WA 4QRXA 2OULA 5K16A 1AECA 2DC8A 3PSEA 1QOLA 3IV2A 1PPNA 1F29A 3CH3X 3S3RA 3PW3A 3BC3A 4G54A 3H8BA 4W5CA 1NB3A 3PT2A 2R9MA 2G7YA 3KX1A 1PCIA 3BPFA 4X6IA 2VHFA 4OW0A 1YALA 3K8UA 5EF4A 3KFQA 2FTDA 5JH3A 4OVZA 4I04A 1SP4B 1F2CA 2E02A 3K24A 3O0UA 9PAPA 4CZWA 1O0EA 1PADA 2DC9A 3KSEA 1AU4A 3O65A 3MTVA 2DZYA 1AYVA 1NL6A 1S4VA 1U5IA 3W31A 3BB7A 1AU0A 4PP2E 1QMYA 3BOWA 2R9CA 1ZCMA 1MDWA 1ME4A 2Y5BA 1XKGA 1CJLA 4BOPA 4M0WA 4MI7A 4XR7A 3U8EA 3RVVA 3PRMA 3WXEA 4K7CA 3N3GA 4DMYA 1EWPA 3LXSA 3P5VA 1YT7A 2P0RA 4XZXA 5JA7A 1YVBA 5CVNB 4RF0A 2E00A 1ITOA 1KXRA 3B79A 4RNAA 3N4CA 1ICFA 2AIMA 4A5UA 2JQFR 4OVZB 1AU3A 3RNVA 1NQCA 2IPPB 4FK5A 4FIPA 4GUAA 3MTNA 2C0YA 3DF0A 3MJ5A 3E9SA 3IMAA 3NHEA 4CDDB 2YJ9A 4D8BA 3I06A 8PCHA 1QDQA 3QT4A 1BQIA 3PNRA 1NLJA 4I07A 4CDEB 3OQCA 1PVJA 3BBAA 3PBHA 3F5VA 1AU2A 3OF8A 4BOZA 1U9VA 2XU1A 5J94A 4RKXA 2PBHA 5EZQA 2DCBA 4QRVA 3ERVA 3M99A 2FRAA 2DOSA 2PNSA 2HXZA 3OF9A 1AIMA 1AYUA 3GCBA 3V6CA 2HWKA 1NPZA 3PHXA 4AXMA 4REZA 1KHPA 2DJGB 3P5UA 5PADA 1KFUL 2BTWB 2WBFX 1CS8A 2J7QA 3BWKA 3RVWA 2F1GA 2J7QC 4W4UA 5JZEA 2PREA 2H7JA 3AI8A 2VHSA 3H89A 4D8IA 4YYVA 1ME3A 4X6HA 1FH0A 4QRGA 1MIRA 1U9WA 2F7DA 1VJVA 1BY8A 2XU5A 4DMXA 3ZNHA 1YZBA 3MORA 4YYUA 5A24A 2AGAA 2FRQA 2CB5A 4Q8HA 1MEMA 2DCCA 1PE6A 4RY2A 3QSDA 1ATKA 3CBKA 4D8EA 1U9XA 4BS6A 2BDLA 1EWOA 2DZZA 2NQIA 2ACTA 4MSXA 2R9FA 2AUZA 4ZUXU 2FUDA 2E01A 1CTEA 3KW9A 2PADA 4W5BA 1CPJA 1Y4HA 3I3TA 1GECE 3F75A 2XU3A 3MP2A 1PBHA 3BPMA 4PT5A 2R9OA 2AU1A 4P16A 2P86A 2FE8A 3H6SA 3QJ3A 2G6DA 2DC6A 3KWZA 4PI3A 2FT2A 2JTCA 2Y6EA 2ARYA 3OVXA 2IBIA 2YJCA 1A6RA 4CDCB 1YK7A 4BOUA 4RF1A 3TRKA 4BOSA 2G8JA 3S3QA 2JRIA 1U9QX 1PPPA 7PCKA 3TNXA 3C0RA 3IOQA 2R9NA 1PXVA 5FPWA 2DJFB 1NB5A 1TL9A 3PDFA 3HHAA 4YYRA 2OP3A 3V6EA 1IWDA 4HWYA 2CIOA 3WXGA 4QBBA 5CVOB 3IEJA 3ZUAA 3BCNA 4FJCA 1F2AA 4BSQA 1EF7A 3BY4A 2B1MA 4P6EA 1CSBB 4HXDB 4YYQA 1PIPA 5CVMA 2YJ8A 4X6JA 2DC7A 6PADA 4YYSA 3H8CA 1BP4A 1EWMA 1SNKA 2AS8A 3LFYA 4QH6A 2NQGA 3E1ZB 5EZSA 4WURA 4YYWA 2XU4A 1MEGA 4YV8A 4BS5A 2DCAA 5F02A 2FO5A 4CDFB 3HWNA 1UKFA 3IHPA 2AYNA 4PADA 3CBJA 4MM3B 3PRPA 1VSNA 3H7DA 1GLOA 4N79A 4MZSA 1CQDA 2HH5A 1GMYA 3K9MA 2E03A 3N3KA 1DF0A 3RVXA 1K3BB 1BGOA 4KLBA 3B21A 1TU6A 3KKUA 3USVA 4OELA 1HUCB 2P7UA 2OZ2A 1CV8A 2Z84A 3PHUA 3OISA 1JQPA 4OEMA 3PHWA 2GFOA 4AXLA 3IUTA 1M6DA 5E6JA 4MZOA 2AYOA 1ZIVA 2YJ2A 4P6GA 1THEA 3MHSA 5EGWA 2R6NA 3P5XA 2UZJA 3CH2X 2BDZA 2HD5A 1CVZA 4Q8GA 2BU3A 3C9EA 1EWLA 1X9YA 1F2BA 4BOQA 1CB5A 1KFXL 2O6XA 3OVZA 5CHVA 4ZTBA 3WXFA 2AUXA 1MS6A 3IFUA 2BTWA 2GHUA 4N8WA 1KHQA 2JQGR 2ATOA 1Y08A 4BQVA 2NQAA 3TMPA 2DCDA 4R3DA 2G8EA 3MHHA 4XUIA 1Q6KA 3D6SA 1YK8A 2FYEA 4BPVA 4IUMA 1DKIA 5KO3A 4PP1A
chains in the Genus database with same CATH topology
4YVAA 1MHWA 1PPDA 2AVWA 4WA6A 4BGFA 3O1GA 3HD3A 2YJBA 1QXPA 2B1NA 1TLOA 2FQ9A 2VFCA 3KWBX 3HHIA 1PPOA 1GCBA 2NQDB 3D9WA 1AYWA 4I05A 2HHNA 1DEUA 1POPA 4N4ZA 5CHTA 1STFE 3P5WA 4QRXA 2OULA 5K16A 1AECA 2DC8A 1QOLA 3IV2A 1PPNA 1F29A 3CH3X 3S3RA 3PW3A 3BC3A 4G54A 3H8BA 4W5CA 1NB3A 2R9MA 2G7YA 3KX1A 1PCIA 3BPFA 4X6IA 2VHFA 4NV7A 1YALA 3K8UA 5EF4A 3KFQA 2FTDA 5JH3A 4I04A 1SP4B 1F2CA 2E02A 3K24A 3O0UA 9PAPA 4CZWA 1O0EA 1PADA 2DC9A 3KSEA 1AU4A 2DZYA 1AYVA 1NL6A 1S4VA 1U5IA 1AU0A 4PP2E 1QMYA 3BOWA 2R9CA 1ZCMA 1MDWA 1ME4A 2Y5BA 1XKGA 1CJLA 4XR7A 3U8EA 3RVVA 3WXEA 4K7CA 3N3GA 4DMYA 1EWPA 3LXSA 3P5VA 1YT7A 2P0RA 5JA7A 1YVBA 5CVNB 2E00A 1ITOA 1KXRA 3B79A 3N4CA 1ICFA 2AIMA 2JQFR 1AU3A 1NQCA 2IPPB 4FK5A 4FIPA 3MTNA 2C0YA 3DF0A 1W4TA 3IMAA 3NHEA 4CDDB 2YJ9A 3I06A 8PCHA 1GX3A 1QDQA 3QT4A 1BQIA 3PNRA 1NLJA 4I07A 4CDEB 3PBHA 3F5VA 1AU2A 3OF8A 1U9VA 2XU1A 1W5RA 5J94A 2PBHA 2DCBA 4QRVA 3ERVA 3M99A 2FRAA 2PNSA 2HXZA 3OF9A 1AIMA 1W6FA 1AYUA 3GCBA 3V6CA 1NPZA 4AXMA 1KHPA 2DJGB 3P5UA 5PADA 1KFUL 2WBFX 1CS8A 3BWKA 3RVWA 2F1GA 4W4UA 2PREA 2H7JA 3AI8A 2VHSA 3H89A 4YYVA 1ME3A 4X6HA 1FH0A 4QRGA 1MIRA 1U9WA 2F7DA 1VJVA 1BY8A 2XU5A 4DMXA 3MORA 4YYUA 4NV8A 5A24A 2FRQA 2CB5A 4Q8HA 1MEMA 2DCCA 1PE6A 4RY2A 3QSDA 1ATKA 3CBKA 1U9XA 4BS6A 2BDLA 1EWOA 2DZZA 2NQIA 2ACTA 4MSXA 2R9FA 2AUZA 4ZUXU 2FUDA 2E01A 1CTEA 3KW9A 2PADA 4W5BA 1CPJA 1Y4HA 3I3TA 1GECE 3F75A 2XU3A 1PBHA 3BPMA 2R9OA 2AU1A 2P86A 3H6SA 3QJ3A 2BSZA 2G6DA 2DC6A 3KWZA 4PI3A 2FT2A 2Y6EA 2ARYA 3OVXA 2IBIA 2YJCA 1A6RA 4CDCB 1YK7A 2G8JA 3S3QA 1U9QX 1PPPA 7PCKA 3TNXA 3IOQA 2R9NA 1PXVA 5FPWA 2DJFB 1NB5A 1TL9A 3PDFA 3HHAA 4C5PA 4YYRA 2OP3A 3V6EA 1IWDA 4HWYA 2CIOA 3WXGA 4QBBA 5CVOB 3IEJA 3ZUAA 3BCNA 4FJCA 1F2AA 4BSQA 1EF7A 2B1MA 4P6EA 1CSBB 4YYQA 1PIPA 5CVMA 2YJ8A 4X6JA 2DC7A 6PADA 4YYSA 3H8CA 1BP4A 1EWMA 1SNKA 2AS8A 3LFYA 4QH6A 2NQGA 3E1ZB 4YYWA 2XU4A 1MEGA 4YV8A 4BS5A 2DCAA 5F02A 2FO5A 4CDFB 3HWNA 3IHPA 2AYNA 4PADA 3CBJA 1VSNA 3H7DA 1GLOA 4N79A 4MZSA 1CQDA 2HH5A 1GMYA 3K9MA 1E2TA 2E03A 3N3KA 1DF0A 3RVXA 1K3BB 1BGOA 4KLBA 1TU6A 3KKUA 3USVA 4OELA 1HUCB 4B55A 2P7UA 2OZ2A 1CV8A 3OISA 1JQPA 4OEMA 2GFOA 4AXLA 3IUTA 1M6DA 4MZOA 2AYOA 1ZIVA 2YJ2A 4P6GA 1THEA 3MHSA 5EGWA 2R6NA 3P5XA 3CH2X 2BDZA 2HD5A 1CVZA 4Q8GA 3C9EA 1EWLA 4GUZA 1X9YA 1F2BA 1CB5A 1KFXL 2O6XA 3OVZA 5CHVA 3WXFA 2AUXA 2VFBA 1MS6A 2GHUA 3LTWA 1KHQA 2JQGR 4N8WA 2ATOA 1Y08A 4BQVA 2NQAA 2DCDA 2G8EA 3MHHA 4XUIA 1Q6KA 3D6SA 1YK8A 2FYEA 4BPVA 4PP1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YVA A;  1MHW A;  1PPD A;  2AVW A;  4WA6 A;  3O1G A;  3HD3 A;  2YJB A;  1QXP A;  2B1N A;  1TLO A;  2FQ9 A;  3KWB X;  3HHI A;  1PPO A;  1GCB A;  2NQD B;  1AYW A;  4I05 A;  2HHN A;  1DEU A;  1POP A;  4N4Z A;  5CHT A;  1STF E;  3P5W A;  4QRX A;  2OUL A;  5K16 A;  1AEC A;  2DC8 A;  1QOL A;  3IV2 A;  1PPN A;  1F29 A;  3CH3 X;  3S3R A;  3PW3 A;  3BC3 A;  4G54 A;  3H8B A;  4W5C A;  1NB3 A;  2R9M A;  2G7Y A;  3KX1 A;  1PCI A;  3BPF A;  4X6I A;  2VHF A;  1YAL A;  3K8U A;  5EF4 A;  3KFQ A;  2FTD A;  5JH3 A;  4I04 A;  1SP4 B;  1F2C A;  2E02 A;  3K24 A;  3O0U A;  9PAP A;  4CZW A;  1O0E A;  1PAD A;  2DC9 A;  3KSE A;  1AU4 A;  2DZY A;  1AYV A;  1NL6 A;  1S4V A;  1U5I A;  1AU0 A;  4PP2 E;  1QMY A;  3BOW A;  2R9C A;  1ZCM A;  1MDW A;  1ME4 A;  2Y5B A;  1XKG A;  1CJL A;  4XR7 A;  3U8E A;  3RVV A;  3WXE A;  4K7C A;  3N3G A;  4DMY A;  1EWP A;  3LXS A;  3P5V A;  1YT7 A;  2P0R A;  5JA7 A;  1YVB A;  5CVN B;  2E00 A;  1ITO A;  1KXR A;  3B79 A;  3N4C A;  1ICF A;  2AIM A;  2JQF R;  1AU3 A;  1NQC A;  2IPP B;  4FK5 A;  4FIP A;  3MTN A;  2C0Y A;  3DF0 A;  3IMA A;  3NHE A;  4CDD B;  2YJ9 A;  3I06 A;  8PCH A;  1QDQ A;  3QT4 A;  1BQI A;  3PNR A;  1NLJ A;  4I07 A;  4CDE B;  3PBH A;  3F5V A;  1AU2 A;  3OF8 A;  1U9V A;  2XU1 A;  5J94 A;  2PBH A;  2DCB A;  4QRV A;  3ERV A;  3M99 A;  2FRA A;  2PNS A;  2HXZ A;  3OF9 A;  1AIM A;  1AYU A;  3GCB A;  3V6C A;  1NPZ A;  4AXM A;  1KHP A;  2DJG B;  3P5U A;  5PAD A;  1KFU L;  2WBF X;  1CS8 A;  3BWK A;  3RVW A;  2F1G A;  4W4U A;  2PRE A;  2H7J A;  3AI8 A;  2VHS A;  3H89 A;  4YYV A;  1ME3 A;  4X6H A;  1FH0 A;  4QRG A;  1MIR A;  1U9W A;  2F7D A;  1VJV A;  1BY8 A;  2XU5 A;  4DMX A;  3MOR A;  4YYU A;  5A24 A;  2FRQ A;  2CB5 A;  4Q8H A;  1MEM A;  2DCC A;  1PE6 A;  4RY2 A;  3QSD A;  1ATK A;  3CBK A;  1U9X A;  4BS6 A;  2BDL A;  1EWO A;  2DZZ A;  2NQI A;  2ACT A;  4MSX A;  2R9F A;  2AUZ A;  4ZUX U;  2FUD A;  2E01 A;  1CTE A;  3KW9 A;  2PAD A;  4W5B A;  1CPJ A;  1Y4H A;  3I3T A;  1GEC E;  3F75 A;  2XU3 A;  1PBH A;  3BPM A;  2R9O A;  2AU1 A;  2P86 A;  3H6S A;  3QJ3 A;  2G6D A;  2DC6 A;  3KWZ A;  4PI3 A;  2FT2 A;  2Y6E A;  2ARY A;  3OVX A;  2IBI A;  2YJC A;  1A6R A;  4CDC B;  1YK7 A;  2G8J A;  3S3Q A;  1U9Q X;  1PPP A;  7PCK A;  3TNX A;  3IOQ A;  2R9N A;  1PXV A;  5FPW A;  2DJF B;  1NB5 A;  1TL9 A;  3PDF A;  3HHA A;  4YYR A;  2OP3 A;  3V6E A;  1IWD A;  4HWY A;  2CIO A;  3WXG A;  4QBB A;  5CVO B;  3IEJ A;  3ZUA A;  3BCN A;  4FJC A;  1F2A A;  4BSQ A;  1EF7 A;  2B1M A;  4P6E A;  1CSB B;  4YYQ A;  1PIP A;  5CVM A;  2YJ8 A;  4X6J A;  2DC7 A;  6PAD A;  4YYS A;  3H8C A;  1BP4 A;  1EWM A;  1SNK A;  2AS8 A;  3LFY A;  4QH6 A;  2NQG A;  3E1Z B;  4YYW A;  2XU4 A;  1MEG A;  4YV8 A;  4BS5 A;  2DCA A;  5F02 A;  2FO5 A;  4CDF B;  3HWN A;  3IHP A;  2AYN A;  4PAD A;  3CBJ A;  1VSN A;  3H7D A;  1GLO A;  4N79 A;  4MZS A;  1CQD A;  2HH5 A;  1GMY A;  3K9M A;  2E03 A;  3N3K A;  1DF0 A;  3RVX A;  1K3B B;  1BGO A;  4KLB A;  1TU6 A;  3KKU A;  3USV A;  4OEL A;  1HUC B;  2P7U A;  2OZ2 A;  1CV8 A;  3OIS A;  1JQP A;  4OEM A;  2GFO A;  4AXL A;  3IUT A;  1M6D A;  4MZO A;  2AYO A;  1ZIV A;  2YJ2 A;  4P6G A;  1THE A;  3MHS A;  5EGW A;  2R6N A;  3P5X A;  3CH2 X;  2BDZ A;  2HD5 A;  1CVZ A;  4Q8G A;  3C9E A;  1EWL A;  1X9Y A;  1F2B A;  1CB5 A;  1KFX L;  2O6X A;  3OVZ A;  5CHV A;  3WXF A;  2AUX A;  1MS6 A;  2GHU A;  4N8W A;  1KHQ A;  2JQG R;  2ATO A;  1Y08 A;  4BQV A;  2NQA A;  2DCD A;  2G8E A;  3MHH A;  4XUI A;  1Q6K A;  3D6S A;  1YK8 A;  2FYE A;  4BPV A;  4PP1 A; 
#chains in the Genus database with same CATH topology
 4YVA A;  1MHW A;  1PPD A;  2AVW A;  4WA6 A;  3O1G A;  3HD3 A;  2YJB A;  1QXP A;  3W30 A;  2B1N A;  1TLO A;  2FQ9 A;  3KWB X;  4IP3 A;  3HHI A;  1PPO A;  1GCB A;  2NQD B;  1AYW A;  4I05 A;  2HHN A;  1DEU A;  1POP A;  4N4Z A;  5CHT A;  1STF E;  3P5W A;  4QRX A;  2OUL A;  5K16 A;  1AEC A;  2DC8 A;  3PSE A;  1QOL A;  3IV2 A;  1PPN A;  1F29 A;  3CH3 X;  3S3R A;  3PW3 A;  3BC3 A;  4G54 A;  3H8B A;  4W5C A;  1NB3 A;  3PT2 A;  2R9M A;  2G7Y A;  3KX1 A;  1PCI A;  3BPF A;  4X6I A;  2VHF A;  4OW0 A;  1YAL A;  3K8U A;  5EF4 A;  3KFQ A;  2FTD A;  5JH3 A;  4OVZ A;  4I04 A;  1SP4 B;  1F2C A;  2E02 A;  3K24 A;  3O0U A;  9PAP A;  4CZW A;  1O0E A;  1PAD A;  2DC9 A;  3KSE A;  1AU4 A;  3O65 A;  3MTV A;  2DZY A;  1AYV A;  1NL6 A;  1S4V A;  1U5I A;  3W31 A;  3BB7 A;  1AU0 A;  4PP2 E;  1QMY A;  3BOW A;  2R9C A;  1ZCM A;  1MDW A;  1ME4 A;  2Y5B A;  1XKG A;  1CJL A;  4BOP A;  4M0W A;  4MI7 A;  4XR7 A;  3U8E A;  3RVV A;  3PRM A;  3WXE A;  4K7C A;  3N3G A;  4DMY A;  1EWP A;  3LXS A;  3P5V A;  1YT7 A;  2P0R A;  4XZX A;  5JA7 A;  1YVB A;  5CVN B;  4RF0 A;  2E00 A;  1ITO A;  1KXR A;  3B79 A;  4RNA A;  3N4C A;  1ICF A;  2AIM A;  4A5U A;  2JQF R;  4OVZ B;  1AU3 A;  3RNV A;  1NQC A;  2IPP B;  4FK5 A;  4FIP A;  4GUA A;  3MTN A;  2C0Y A;  3DF0 A;  3MJ5 A;  3E9S A;  3IMA A;  3NHE A;  4CDD B;  2YJ9 A;  4D8B A;  3I06 A;  8PCH A;  1QDQ A;  3QT4 A;  1BQI A;  3PNR A;  1NLJ A;  4I07 A;  4CDE B;  3OQC A;  1PVJ A;  3BBA A;  3PBH A;  3F5V A;  1AU2 A;  3OF8 A;  4BOZ A;  1U9V A;  2XU1 A;  5J94 A;  4RKX A;  2PBH A;  5EZQ A;  2DCB A;  4QRV A;  3ERV A;  3M99 A;  2FRA A;  2DOS A;  2PNS A;  2HXZ A;  3OF9 A;  1AIM A;  1AYU A;  3GCB A;  3V6C A;  2HWK A;  1NPZ A;  3PHX A;  4AXM A;  4REZ A;  1KHP A;  2DJG B;  3P5U A;  5PAD A;  1KFU L;  2BTW B;  2WBF X;  1CS8 A;  2J7Q A;  3BWK A;  3RVW A;  2F1G A;  2J7Q C;  4W4U A;  5JZE A;  2PRE A;  2H7J A;  3AI8 A;  2VHS A;  3H89 A;  4D8I A;  4YYV A;  1ME3 A;  4X6H A;  1FH0 A;  4QRG A;  1MIR A;  1U9W A;  2F7D A;  1VJV A;  1BY8 A;  2XU5 A;  4DMX A;  3ZNH A;  1YZB A;  3MOR A;  4YYU A;  5A24 A;  2AGA A;  2FRQ A;  2CB5 A;  4Q8H A;  1MEM A;  2DCC A;  1PE6 A;  4RY2 A;  3QSD A;  1ATK A;  3CBK A;  4D8E A;  1U9X A;  4BS6 A;  2BDL A;  1EWO A;  2DZZ A;  2NQI A;  2ACT A;  4MSX A;  2R9F A;  2AUZ A;  4ZUX U;  2FUD A;  2E01 A;  1CTE A;  3KW9 A;  2PAD A;  4W5B A;  1CPJ A;  1Y4H A;  3I3T A;  1GEC E;  3F75 A;  2XU3 A;  3MP2 A;  1PBH A;  3BPM A;  4PT5 A;  2R9O A;  2AU1 A;  4P16 A;  2P86 A;  2FE8 A;  3H6S A;  3QJ3 A;  2G6D A;  2DC6 A;  3KWZ A;  4PI3 A;  2FT2 A;  2JTC A;  2Y6E A;  2ARY A;  3OVX A;  2IBI A;  2YJC A;  1A6R A;  4CDC B;  1YK7 A;  4BOU A;  4RF1 A;  3TRK A;  4BOS A;  2G8J A;  3S3Q A;  2JRI A;  1U9Q X;  1PPP A;  7PCK A;  3TNX A;  3C0R A;  3IOQ A;  2R9N A;  1PXV A;  5FPW A;  2DJF B;  1NB5 A;  1TL9 A;  3PDF A;  3HHA A;  4YYR A;  2OP3 A;  3V6E A;  1IWD A;  4HWY A;  2CIO A;  3WXG A;  4QBB A;  5CVO B;  3IEJ A;  3ZUA A;  3BCN A;  4FJC A;  1F2A A;  4BSQ A;  1EF7 A;  3BY4 A;  2B1M A;  4P6E A;  1CSB B;  4HXD B;  4YYQ A;  1PIP A;  5CVM A;  2YJ8 A;  4X6J A;  2DC7 A;  6PAD A;  4YYS A;  3H8C A;  1BP4 A;  1EWM A;  1SNK A;  2AS8 A;  3LFY A;  4QH6 A;  2NQG A;  3E1Z B;  5EZS A;  4WUR A;  4YYW A;  2XU4 A;  1MEG A;  4YV8 A;  4BS5 A;  2DCA A;  5F02 A;  2FO5 A;  4CDF B;  3HWN A;  1UKF A;  3IHP A;  2AYN A;  4PAD A;  3CBJ A;  4MM3 B;  3PRP A;  1VSN A;  3H7D A;  1GLO A;  4N79 A;  4MZS A;  1CQD A;  2HH5 A;  1GMY A;  3K9M A;  2E03 A;  3N3K A;  1DF0 A;  3RVX A;  1K3B B;  1BGO A;  4KLB A;  3B21 A;  1TU6 A;  3KKU A;  3USV A;  4OEL A;  1HUC B;  2P7U A;  2OZ2 A;  1CV8 A;  2Z84 A;  3PHU A;  3OIS A;  1JQP A;  4OEM A;  3PHW A;  2GFO A;  4AXL A;  3IUT A;  1M6D A;  5E6J A;  4MZO A;  2AYO A;  1ZIV A;  2YJ2 A;  4P6G A;  1THE A;  3MHS A;  5EGW A;  2R6N A;  3P5X A;  2UZJ A;  3CH2 X;  2BDZ A;  2HD5 A;  1CVZ A;  4Q8G A;  2BU3 A;  3C9E A;  1EWL A;  1X9Y A;  1F2B A;  4BOQ A;  1CB5 A;  1KFX L;  2O6X A;  3OVZ A;  5CHV A;  4ZTB A;  3WXF A;  2AUX A;  1MS6 A;  3IFU A;  2BTW A;  2GHU A;  4N8W A;  1KHQ A;  2JQG R;  2ATO A;  1Y08 A;  4BQV A;  2NQA A;  3TMP A;  2DCD A;  4R3D A;  2G8E A;  3MHH A;  4XUI A;  1Q6K A;  3D6S A;  1YK8 A;  2FYE A;  4BPV A;  4IUM A;  1DKI A;  5KO3 A;  4PP1 A; 
#chains in the Genus database with same CATH homology
 4YVA A;  1MHW A;  1PPD A;  2AVW A;  4WA6 A;  4BGF A;  3O1G A;  3HD3 A;  2YJB A;  1QXP A;  2B1N A;  1TLO A;  2FQ9 A;  2VFC A;  3KWB X;  3HHI A;  1PPO A;  1GCB A;  2NQD B;  3D9W A;  1AYW A;  4I05 A;  2HHN A;  1DEU A;  1POP A;  4N4Z A;  5CHT A;  1STF E;  3P5W A;  4QRX A;  2OUL A;  5K16 A;  1AEC A;  2DC8 A;  1QOL A;  3IV2 A;  1PPN A;  1F29 A;  3CH3 X;  3S3R A;  3PW3 A;  3BC3 A;  4G54 A;  3H8B A;  4W5C A;  1NB3 A;  2R9M A;  2G7Y A;  3KX1 A;  1PCI A;  3BPF A;  4X6I A;  2VHF A;  4NV7 A;  1YAL A;  3K8U A;  5EF4 A;  3KFQ A;  2FTD A;  5JH3 A;  4I04 A;  1SP4 B;  1F2C A;  2E02 A;  3K24 A;  3O0U A;  9PAP A;  4CZW A;  1O0E A;  1PAD A;  2DC9 A;  3KSE A;  1AU4 A;  2DZY A;  1AYV A;  1NL6 A;  1S4V A;  1U5I A;  1AU0 A;  4PP2 E;  1QMY A;  3BOW A;  2R9C A;  1ZCM A;  1MDW A;  1ME4 A;  2Y5B A;  1XKG A;  1CJL A;  4XR7 A;  3U8E A;  3RVV A;  3WXE A;  4K7C A;  3N3G A;  4DMY A;  1EWP A;  3LXS A;  3P5V A;  1YT7 A;  2P0R A;  5JA7 A;  1YVB A;  5CVN B;  2E00 A;  1ITO A;  1KXR A;  3B79 A;  3N4C A;  1ICF A;  2AIM A;  2JQF R;  1AU3 A;  1NQC A;  2IPP B;  4FK5 A;  4FIP A;  3MTN A;  2C0Y A;  3DF0 A;  1W4T A;  3IMA A;  3NHE A;  4CDD B;  2YJ9 A;  3I06 A;  8PCH A;  1GX3 A;  1QDQ A;  3QT4 A;  1BQI A;  3PNR A;  1NLJ A;  4I07 A;  4CDE B;  3PBH A;  3F5V A;  1AU2 A;  3OF8 A;  1U9V A;  2XU1 A;  1W5R A;  5J94 A;  2PBH A;  2DCB A;  4QRV A;  3ERV A;  3M99 A;  2FRA A;  2PNS A;  2HXZ A;  3OF9 A;  1AIM A;  1W6F A;  1AYU A;  3GCB A;  3V6C A;  1NPZ A;  4AXM A;  1KHP A;  2DJG B;  3P5U A;  5PAD A;  1KFU L;  2WBF X;  1CS8 A;  3BWK A;  3RVW A;  2F1G A;  4W4U A;  2PRE A;  2H7J A;  3AI8 A;  2VHS A;  3H89 A;  4YYV A;  1ME3 A;  4X6H A;  1FH0 A;  4QRG A;  1MIR A;  1U9W A;  2F7D A;  1VJV A;  1BY8 A;  2XU5 A;  4DMX A;  3MOR A;  4YYU A;  4NV8 A;  5A24 A;  2FRQ A;  2CB5 A;  4Q8H A;  1MEM A;  2DCC A;  1PE6 A;  4RY2 A;  3QSD A;  1ATK A;  3CBK A;  1U9X A;  4BS6 A;  2BDL A;  1EWO A;  2DZZ A;  2NQI A;  2ACT A;  4MSX A;  2R9F A;  2AUZ A;  4ZUX U;  2FUD A;  2E01 A;  1CTE A;  3KW9 A;  2PAD A;  4W5B A;  1CPJ A;  1Y4H A;  3I3T A;  1GEC E;  3F75 A;  2XU3 A;  1PBH A;  3BPM A;  2R9O A;  2AU1 A;  2P86 A;  3H6S A;  3QJ3 A;  2BSZ A;  2G6D A;  2DC6 A;  3KWZ A;  4PI3 A;  2FT2 A;  2Y6E A;  2ARY A;  3OVX A;  2IBI A;  2YJC A;  1A6R A;  4CDC B;  1YK7 A;  2G8J A;  3S3Q A;  1U9Q X;  1PPP A;  7PCK A;  3TNX A;  3IOQ A;  2R9N A;  1PXV A;  5FPW A;  2DJF B;  1NB5 A;  1TL9 A;  3PDF A;  3HHA A;  4C5P A;  4YYR A;  2OP3 A;  3V6E A;  1IWD A;  4HWY A;  2CIO A;  3WXG A;  4QBB A;  5CVO B;  3IEJ A;  3ZUA A;  3BCN A;  4FJC A;  1F2A A;  4BSQ A;  1EF7 A;  2B1M A;  4P6E A;  1CSB B;  4YYQ A;  1PIP A;  5CVM A;  2YJ8 A;  4X6J A;  2DC7 A;  6PAD A;  4YYS A;  3H8C A;  1BP4 A;  1EWM A;  1SNK A;  2AS8 A;  3LFY A;  4QH6 A;  2NQG A;  3E1Z B;  4YYW A;  2XU4 A;  1MEG A;  4YV8 A;  4BS5 A;  2DCA A;  5F02 A;  2FO5 A;  4CDF B;  3HWN A;  3IHP A;  2AYN A;  4PAD A;  3CBJ A;  1VSN A;  3H7D A;  1GLO A;  4N79 A;  4MZS A;  1CQD A;  2HH5 A;  1GMY A;  3K9M A;  1E2T A;  2E03 A;  3N3K A;  1DF0 A;  3RVX A;  1K3B B;  1BGO A;  4KLB A;  1TU6 A;  3KKU A;  3USV A;  4OEL A;  1HUC B;  4B55 A;  2P7U A;  2OZ2 A;  1CV8 A;  3OIS A;  1JQP A;  4OEM A;  2GFO A;  4AXL A;  3IUT A;  1M6D A;  4MZO A;  2AYO A;  1ZIV A;  2YJ2 A;  4P6G A;  1THE A;  3MHS A;  5EGW A;  2R6N A;  3P5X A;  3CH2 X;  2BDZ A;  2HD5 A;  1CVZ A;  4Q8G A;  3C9E A;  1EWL A;  4GUZ A;  1X9Y A;  1F2B A;  1CB5 A;  1KFX L;  2O6X A;  3OVZ A;  5CHV A;  3WXF A;  2AUX A;  2VFB A;  1MS6 A;  2GHU A;  3LTW A;  1KHQ A;  2JQG R;  4N8W A;  2ATO A;  1Y08 A;  4BQV A;  2NQA A;  2DCD A;  2G8E A;  3MHH A;  4XUI A;  1Q6K A;  3D6S A;  1YK8 A;  2FYE A;  4BPV A;  4PP1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...