2ACTA

Crystallographic refinement of the structure of actinidin at 1.7 angstroms resolution by fast fourier least-squares methods
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
218
structure length
217
Chain Sequence
b'LPSYVDWRSAGAVVDIKSQGECGGWAFSAIATVEGINKITSGSLISLSEQELIDCGRTQNTRGCDGGYITDGFQFIINDGGINTEENYPYTAQDGDCDVALQDQKYVTIDTYENVPYNNEWALQTAVTYQPVSVALDAAGDAFKQYASGIFTGPCGTAVDHAIVIVGYGTEGGVDYWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIATMPSYPVKY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACTINIDIN PRECURSOR
molecule tags Hydrolase (proteinase)
source organism Actinidia chinensis
publication title Crystallographic Refinement of the Structure of Actinidin at 1.7 Angstroms Resolution by Fast Fourier Least-Squares Methods
pubmed rcsb
total genus 68
structure length 217
sequence length 218
ec nomenclature ec 3.4.22.14: Actinidain.
pdb deposition date 1979-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2actA00
2O6XA 3I3TA 5JA7A 1S4VA 4DMXA 3BC3A 2DCCA 2YJ9A 1NB3A 4PI3A 1CB5A 1CSBB 1AYVA 2FUDA 2NQAA 5CVOB 2R6NA 3OF9A 2ARYA 3P5UA 1IWDA 4N8WA 5CVMA 1Y08A 2E00A 1KXRA 3KWZA 4YYWA 1HUCB 3M99A 1AYUA 2DJFB 3I06A 1BP4A 1MHWA 1TU6A 1JQPA 3OF8A 4OEMA 3RVVA 1AU0A 1F2CA 2GFOA 1U9VA 2HH5A 3F75A 1GCBA 4BPVA 1SNKA 8PCHA 2FO5A 1MS6A 4BS6A 5J94A 3P5VA 3OVXA 1U5IA 1QOLA 2DJGB 3WXGA 1ZCMA 5F02A 3S3QA 3OISA 2PNSA 1U9QX 1NLJA 4HWYA 1GMYA 2R9CA 1NB5A 3NHEA 3GCBA 2H7JA 2JQGR 3MHSA 3E1ZB 1AECA 1X9YA 3H7DA 4OELA 2DC7A 1PPPA 2P86A 4K7CA 2FT2A 3V6CA 3AI8A 3V6EA 4WA6A 3MHHA 3HWNA 2FQ9A 1U9XA 5EGWA 4QRGA 3K24A 2XU4A 1A6RA 1THEA 1PPOA 2AUXA 4YYRA 3QT4A 3CBJA 4PP2E 2F7DA 1AU3A 1CS8A 2R9NA 1CV8A 3KW9A 1MIRA 1KFXL 2CB5A 3H6SA 1ZIVA 2FRQA 1POPA 3BCNA 3O0UA 1F2AA 3BPMA 2AIMA 3PBHA 3KX1A 1NPZA 3IMAA 2B1MA 1ME3A 4XR7A 4YYQA 3F5VA 4CDFB 2E03A 1BQIA 4G54A 1CJLA 2IPPB 4YVAA 3MORA 4N79A 1CQDA 3H8BA 1KHQA 2Y5BA 1XKGA 3DF0A 2NQIA 4I05A 4YYUA 5CHTA 4QH6A 1YVBA 2VHFA 2DZYA 1PE6A 1PBHA 3C9EA 4QRXA 1AYWA 1CTEA 1EWLA 5EF4A 2PREA 4CDCB 3PNRA 1Q6KA 2HXZA 3KKUA 3KWBX 4FK5A 1TLOA 3K9MA 2AUZA 1DEUA 3PW3A 3K8UA 2P0RA 4FJCA 2VHSA 4BSQA 1BY8A 3QSDA 2DC9A 2E02A 3WXFA 2R9OA 2NQGA 1YK7A 2OP3A 1NL6A 3PDFA 3HD3A 2R9MA 2AS8A 5PADA 1STFE 5A24A 3S3RA 3USVA 4YYSA 1PPDA 9PAPA 1SP4B 3IEJA 1TL9A 3N4CA 1ICFA 1VSNA 4CZWA 3IOQA 4KLBA 3TNXA 1DF0A 2AU1A 1F29A 5K16A 1BGOA 3U8EA 1FH0A 3ZUAA 1EF7A 3QJ3A 2G8JA 1Y4HA 3WXEA 4QRVA 1PCIA 2BDZA 1ME4A 3H8CA 1MEGA 4XUIA 1YK8A 3BPFA 2YJ2A 3ERVA 4X6HA 4PP1A 3IHPA 1YALA 1PPNA 4BQVA 5CHVA 2E01A 3OVZA 4YV8A 4Q8GA 2JQFR 3HHIA 3IV2A 2YJCA 1CPJA 3N3KA 4CDEB 4YYVA 3LFYA 2G8EA 2NQDB 5FPWA 2G7YA 2Y6EA 1EWMA 3BWKA 1VJVA 2DCDA 1KFUL 1NQCA 4MZSA 4X6IA 3D6SA 1QMYA 1MEMA 4X6JA 1KHPA 2DC6A 1AU2A 4QBBA 3RVXA 2G6DA 1O0EA 3BOWA 1PIPA 2OZ2A 2PADA 2XU5A 2HD5A 1QDQA 1K3BB 1PXVA 2F1GA 2YJBA 4I04A 1EWOA 2YJ8A 1AU4A 4CDDB 2DZZA 3H89A 2BDLA 3KSEA 4ZUXU 4MZOA 3KFQA 1MDWA 2AYNA 5CVNB 2C0YA 6PADA 3CH2X 1F2BA 3P5WA 2ATOA 2FRAA 2GHUA 2AVWA 4MSXA 1EWPA 4RY2A 2R9FA 2P7UA 1AIMA 2FYEA 4DMYA 1CVZA 2ACTA 1GLOA 1M6DA 2CIOA 2WBFX 1QXPA 3CBKA 7PCKA 3P5XA 4P6GA 5JH3A 4FIPA 4AXLA 1PADA 1ITOA 3MTNA 3CH3X 4W4UA 3RVWA 2AYOA 4AXMA 1YT7A 2XU3A 1U9WA 2OULA 2DCBA 2XU1A 4Q8HA 2B1NA 4N4ZA 3IUTA 2DCAA 4PADA 4I07A 2IBIA 4W5CA 2DC8A 3O1GA 4P6EA 2PBHA 3B79A 1GECE 1ATKA 3N3GA 2HHNA 2FTDA 3HHAA 3LXSA 4W5BA 4BS5A
chains in the Genus database with same CATH superfamily
3PRPA 2O6XA 3I3TA 5JA7A 1S4VA 4RKXA 4DMXA 4IUMA 3BC3A 2DCCA 2YJ9A 1NB3A 4PI3A 1CB5A 1CSBB 1AYVA 1UKFA 2FUDA 2NQAA 5CVOB 2BU3A 2BTWA 3RNVA 2R6NA 3OF9A 4ZTBA 2ARYA 3P5UA 4BOUA 1IWDA 4N8WA 5CVMA 1Y08A 2E00A 1KXRA 3KWZA 3MP2A 4YYWA 1HUCB 3M99A 1AYUA 2DJFB 3I06A 1BP4A 1MHWA 1TU6A 1JQPA 3OF8A 4OEMA 3RVVA 1AU0A 1F2CA 2GFOA 1U9VA 2HH5A 3F75A 1GCBA 3ZNHA 4BPVA 1SNKA 8PCHA 4REZA 2FO5A 1MS6A 4BS6A 5J94A 3P5VA 3OVXA 1U5IA 1QOLA 3E9SA 2DJGB 3WXGA 1ZCMA 5F02A 3S3QA 3OISA 4D8EA 2PNSA 3O65A 1U9QX 1NLJA 4HWYA 1GMYA 2R9CA 1NB5A 3NHEA 3GCBA 2H7JA 2JQGR 3MHSA 3E1ZB 1AECA 1X9YA 2FE8A 3H7DA 4OELA 2DC7A 1PPPA 2P86A 4K7CA 2FT2A 3V6CA 3AI8A 3V6EA 4WA6A 3MHHA 3HWNA 2FQ9A 1U9XA 3IFUA 2JTCA 2JRIA 3TRKA 5EGWA 4QRGA 3K24A 2XU4A 1A6RA 1THEA 2AGAA 1PPOA 2AUXA 4YYRA 3C0RA 3QT4A 4OW0A 3CBJA 4R3DA 4PP2E 2DOSA 2F7DA 1AU3A 1CS8A 2R9NA 1CV8A 3KW9A 1MIRA 4BOZA 1KFXL 3W30A 2CB5A 2J7QC 3H6SA 1ZIVA 2FRQA 1POPA 3BCNA 3O0UA 1F2AA 3BPMA 2AIMA 3PBHA 3KX1A 1NPZA 3IMAA 2B1MA 1ME3A 4XR7A 2J7QA 4YYQA 3F5VA 4IP3A 1YZBA 4CDFB 2E03A 1BQIA 4G54A 1CJLA 2IPPB 4YVAA 3MORA 4N79A 1CQDA 3H8BA 1KHQA 2Y5BA 1XKGA 3DF0A 2NQIA 4I05A 4YYUA 5CHTA 4QH6A 1YVBA 2VHFA 2DZYA 1PE6A 1PBHA 3C9EA 1AYWA 4QRXA 1CTEA 1EWLA 5EF4A 3PHXA 2PREA 4CDCB 3PNRA 1Q6KA 2HXZA 3KKUA 3KWBX 4FK5A 1TLOA 3K9MA 4BOQA 2AUZA 1DEUA 3PW3A 3K8UA 4RF1A 2P0RA 4FJCA 5JZEA 2VHSA 4BSQA 1BY8A 3QSDA 2DC9A 2E02A 3WXFA 2R9OA 2NQGA 1YK7A 2OP3A 5E6JA 1NL6A 3BBAA 3B21A 3PDFA 4GUAA 3TMPA 3PSEA 3HD3A 2R9MA 2AS8A 5PADA 1STFE 5A24A 3S3RA 3PRMA 3USVA 4YYSA 1PPDA 5EZQA 9PAPA 1SP4B 3IEJA 1TL9A 3N4CA 1ICFA 1VSNA 4CZWA 3IOQA 4KLBA 3TNXA 1DF0A 2AU1A 1F29A 5K16A 1BGOA 3W31A 3U8EA 1FH0A 3ZUAA 4RF0A 1EF7A 3QJ3A 5EZSA 2G8JA 1Y4HA 3BY4A 3WXEA 4QRVA 1PCIA 2BDZA 4A5UA 1ME4A 3H8CA 1MEGA 4XUIA 2BTWB 1YK8A 3BPFA 4D8IA 2YJ2A 3ERVA 4X6HA 4PP1A 3IHPA 1YALA 1PPNA 2UZJA 4BQVA 5CHVA 2E01A 3OVZA 4YV8A 2JQFR 4Q8GA 4WURA 3HHIA 4D8BA 3IV2A 2YJCA 1CPJA 3N3KA 4PT5A 4CDEB 4YYVA 3LFYA 2G8EA 2NQDB 5FPWA 2G7YA 2Y6EA 3PHWA 1EWMA 3BWKA 1VJVA 3OQCA 4RNAA 5KO3A 2DCDA 4M0WA 1KFUL 1NQCA 4MZSA 1PVJA 4X6IA 3D6SA 1QMYA 1MEMA 4X6JA 3PHUA 1KHPA 2DC6A 1AU2A 4QBBA 3RVXA 2G6DA 1O0EA 3BOWA 1PIPA 2OZ2A 2PADA 2XU5A 2HD5A 1QDQA 1K3BB 1PXVA 2F1GA 3MJ5A 2YJBA 4I04A 1EWOA 2YJ8A 1AU4A 4CDDB 2DZZA 4XZXA 3H89A 2BDLA 3KSEA 4ZUXU 4MZOA 4MI7A 3KFQA 1MDWA 2AYNA 4OVZA 5CVNB 2C0YA 6PADA 3CH2X 1F2BA 3P5WA 4BOSA 2ATOA 1DKIA 2FRAA 2GHUA 2AVWA 4MSXA 1EWPA 4RY2A 2R9FA 2HWKA 2P7UA 1AIMA 2FYEA 4DMYA 1CVZA 2ACTA 4MM3B 1GLOA 1M6DA 4OVZB 2CIOA 2WBFX 1QXPA 3CBKA 7PCKA 4P16A 3P5XA 4P6GA 5JH3A 4FIPA 4AXLA 1PADA 1ITOA 3MTNA 3CH3X 4W4UA 3RVWA 2AYOA 4AXMA 1YT7A 4BOPA 2XU3A 1U9WA 2OULA 2DCBA 3BB7A 2Z84A 2XU1A 4HXDB 3MTVA 4Q8HA 2B1NA 4N4ZA 3IUTA 2DCAA 4PADA 4I07A 2IBIA 4W5CA 2DC8A 3O1GA 4P6EA 2PBHA 3B79A 1GECE 1ATKA 3PT2A 3N3GA 2HHNA 2FTDA 3HHAA 3LXSA 4W5BA 4BS5A
chains in the Genus database with same CATH topology
2O6XA 3I3TA 5JA7A 1S4VA 4DMXA 3BC3A 2DCCA 2YJ9A 1NB3A 4PI3A 1CB5A 1CSBB 1AYVA 2FUDA 2NQAA 5CVOB 2R6NA 3OF9A 3D9WA 2ARYA 3P5UA 1IWDA 4N8WA 5CVMA 1Y08A 2E00A 1KXRA 3KWZA 4YYWA 1HUCB 3M99A 1AYUA 2DJFB 3LTWA 3I06A 1BP4A 1MHWA 1TU6A 1JQPA 3OF8A 4OEMA 3RVVA 1AU0A 1F2CA 2BSZA 1E2TA 2GFOA 1U9VA 2HH5A 3F75A 1GCBA 4BPVA 1SNKA 8PCHA 2FO5A 1MS6A 4BS6A 5J94A 3P5VA 1W4TA 3OVXA 1U5IA 1QOLA 2DJGB 3WXGA 1ZCMA 5F02A 3S3QA 3OISA 2PNSA 1U9QX 1NLJA 4HWYA 1GMYA 2R9CA 1NB5A 3NHEA 3GCBA 2H7JA 2JQGR 3MHSA 3E1ZB 1AECA 1X9YA 3H7DA 4OELA 2DC7A 1PPPA 2P86A 4K7CA 2FT2A 3V6CA 3AI8A 3V6EA 4WA6A 3MHHA 3HWNA 2FQ9A 1U9XA 5EGWA 4QRGA 3K24A 2XU4A 1A6RA 1THEA 1PPOA 2AUXA 4YYRA 3QT4A 3CBJA 4PP2E 4C5PA 2F7DA 1AU3A 1CS8A 2R9NA 1CV8A 3KW9A 1MIRA 1KFXL 2CB5A 3H6SA 1ZIVA 4BGFA 2FRQA 1POPA 3BCNA 3O0UA 1F2AA 3BPMA 2VFCA 2AIMA 3PBHA 3KX1A 1NPZA 3IMAA 2B1MA 1ME3A 4XR7A 4YYQA 3F5VA 4CDFB 2E03A 1BQIA 4G54A 1CJLA 2IPPB 4YVAA 3MORA 4N79A 1CQDA 3H8BA 1KHQA 2Y5BA 1XKGA 3DF0A 2VFBA 2NQIA 4I05A 4YYUA 5CHTA 4QH6A 1YVBA 2VHFA 2DZYA 1PE6A 1PBHA 3C9EA 4QRXA 1AYWA 1CTEA 1EWLA 5EF4A 2PREA 4CDCB 3PNRA 1Q6KA 1W6FA 2HXZA 3KKUA 3KWBX 4FK5A 1TLOA 3K9MA 2AUZA 1DEUA 3PW3A 3K8UA 2P0RA 4FJCA 2VHSA 4NV8A 4B55A 4BSQA 1BY8A 3QSDA 2DC9A 2E02A 3WXFA 2R9OA 2NQGA 1YK7A 2OP3A 1NL6A 3PDFA 3HD3A 2R9MA 2AS8A 5PADA 1STFE 1W5RA 5A24A 3S3RA 3USVA 4YYSA 1PPDA 9PAPA 1SP4B 3IEJA 1TL9A 3N4CA 1ICFA 1VSNA 4CZWA 3IOQA 4KLBA 3TNXA 1GX3A 1DF0A 2AU1A 1F29A 5K16A 1BGOA 3U8EA 1FH0A 3ZUAA 1EF7A 3QJ3A 2G8JA 1Y4HA 3WXEA 4QRVA 1PCIA 2BDZA 1ME4A 3H8CA 1MEGA 4XUIA 1YK8A 3BPFA 2YJ2A 3ERVA 4X6HA 4PP1A 3IHPA 1YALA 1PPNA 4BQVA 5CHVA 2E01A 3OVZA 4YV8A 4Q8GA 2JQFR 3HHIA 3IV2A 2YJCA 1CPJA 3N3KA 4CDEB 4GUZA 4YYVA 3LFYA 2G8EA 2NQDB 5FPWA 2G7YA 2Y6EA 1EWMA 3BWKA 1VJVA 2DCDA 1KFUL 1NQCA 4MZSA 4X6IA 3D6SA 1QMYA 1MEMA 4X6JA 1KHPA 2DC6A 1AU2A 4QBBA 3RVXA 2G6DA 1O0EA 3BOWA 1PIPA 2OZ2A 2PADA 2XU5A 2HD5A 1QDQA 1K3BB 1PXVA 2F1GA 2YJBA 4I04A 1EWOA 2YJ8A 1AU4A 4NV7A 4CDDB 2DZZA 3H89A 2BDLA 3KSEA 4ZUXU 4MZOA 3KFQA 1MDWA 2AYNA 5CVNB 2C0YA 6PADA 3CH2X 1F2BA 3P5WA 2ATOA 2FRAA 2GHUA 2AVWA 4MSXA 1EWPA 4RY2A 2R9FA 2P7UA 1AIMA 2FYEA 4DMYA 1CVZA 2ACTA 1GLOA 1M6DA 2CIOA 2WBFX 1QXPA 3CBKA 7PCKA 3P5XA 4P6GA 5JH3A 4FIPA 4AXLA 1PADA 1ITOA 3MTNA 3CH3X 4W4UA 3RVWA 2AYOA 4AXMA 1YT7A 2XU3A 1U9WA 2OULA 2DCBA 2XU1A 4Q8HA 2B1NA 4N4ZA 3IUTA 2DCAA 4PADA 4I07A 2IBIA 4W5CA 2DC8A 3O1GA 4P6EA 2PBHA 3B79A 1GECE 1ATKA 3N3GA 2HHNA 2FTDA 3HHAA 3LXSA 4W5BA 4BS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O6X A;  3I3T A;  5JA7 A;  1S4V A;  4DMX A;  3BC3 A;  2DCC A;  2YJ9 A;  1NB3 A;  4PI3 A;  1CB5 A;  1CSB B;  1AYV A;  2FUD A;  2NQA A;  5CVO B;  2R6N A;  3OF9 A;  2ARY A;  3P5U A;  1IWD A;  4N8W A;  5CVM A;  1Y08 A;  2E00 A;  1KXR A;  3KWZ A;  4YYW A;  1HUC B;  3M99 A;  1AYU A;  2DJF B;  3I06 A;  1BP4 A;  1MHW A;  1TU6 A;  1JQP A;  3OF8 A;  4OEM A;  3RVV A;  1AU0 A;  1F2C A;  2GFO A;  1U9V A;  2HH5 A;  3F75 A;  1GCB A;  4BPV A;  1SNK A;  8PCH A;  2FO5 A;  1MS6 A;  4BS6 A;  5J94 A;  3P5V A;  3OVX A;  1U5I A;  1QOL A;  2DJG B;  3WXG A;  1ZCM A;  5F02 A;  3S3Q A;  3OIS A;  2PNS A;  1U9Q X;  1NLJ A;  4HWY A;  1GMY A;  2R9C A;  1NB5 A;  3NHE A;  3GCB A;  2H7J A;  2JQG R;  3MHS A;  3E1Z B;  1AEC A;  1X9Y A;  3H7D A;  4OEL A;  2DC7 A;  1PPP A;  2P86 A;  4K7C A;  2FT2 A;  3V6C A;  3AI8 A;  3V6E A;  4WA6 A;  3MHH A;  3HWN A;  2FQ9 A;  1U9X A;  5EGW A;  4QRG A;  3K24 A;  2XU4 A;  1A6R A;  1THE A;  1PPO A;  2AUX A;  4YYR A;  3QT4 A;  3CBJ A;  4PP2 E;  2F7D A;  1AU3 A;  1CS8 A;  2R9N A;  1CV8 A;  3KW9 A;  1MIR A;  1KFX L;  2CB5 A;  3H6S A;  1ZIV A;  2FRQ A;  1POP A;  3BCN A;  3O0U A;  1F2A A;  3BPM A;  2AIM A;  3PBH A;  3KX1 A;  1NPZ A;  3IMA A;  2B1M A;  1ME3 A;  4XR7 A;  4YYQ A;  3F5V A;  4CDF B;  2E03 A;  1BQI A;  4G54 A;  1CJL A;  2IPP B;  4YVA A;  3MOR A;  4N79 A;  1CQD A;  3H8B A;  1KHQ A;  2Y5B A;  1XKG A;  3DF0 A;  2NQI A;  4I05 A;  4YYU A;  5CHT A;  4QH6 A;  1YVB A;  2VHF A;  2DZY A;  1PE6 A;  1PBH A;  3C9E A;  4QRX A;  1AYW A;  1CTE A;  1EWL A;  5EF4 A;  2PRE A;  4CDC B;  3PNR A;  1Q6K A;  2HXZ A;  3KKU A;  3KWB X;  4FK5 A;  1TLO A;  3K9M A;  2AUZ A;  1DEU A;  3PW3 A;  3K8U A;  2P0R A;  4FJC A;  2VHS A;  4BSQ A;  1BY8 A;  3QSD A;  2DC9 A;  2E02 A;  3WXF A;  2R9O A;  2NQG A;  1YK7 A;  2OP3 A;  1NL6 A;  3PDF A;  3HD3 A;  2R9M A;  2AS8 A;  5PAD A;  1STF E;  5A24 A;  3S3R A;  3USV A;  4YYS A;  1PPD A;  9PAP A;  1SP4 B;  3IEJ A;  1TL9 A;  3N4C A;  1ICF A;  1VSN A;  4CZW A;  3IOQ A;  4KLB A;  3TNX A;  1DF0 A;  2AU1 A;  1F29 A;  5K16 A;  1BGO A;  3U8E A;  1FH0 A;  3ZUA A;  1EF7 A;  3QJ3 A;  2G8J A;  1Y4H A;  3WXE A;  4QRV A;  1PCI A;  2BDZ A;  1ME4 A;  3H8C A;  1MEG A;  4XUI A;  1YK8 A;  3BPF A;  2YJ2 A;  3ERV A;  4X6H A;  4PP1 A;  3IHP A;  1YAL A;  1PPN A;  4BQV A;  5CHV A;  2E01 A;  3OVZ A;  4YV8 A;  4Q8G A;  2JQF R;  3HHI A;  3IV2 A;  2YJC A;  1CPJ A;  3N3K A;  4CDE B;  4YYV A;  3LFY A;  2G8E A;  2NQD B;  5FPW A;  2G7Y A;  2Y6E A;  1EWM A;  3BWK A;  1VJV A;  2DCD A;  1KFU L;  1NQC A;  4MZS A;  4X6I A;  3D6S A;  1QMY A;  1MEM A;  4X6J A;  1KHP A;  2DC6 A;  1AU2 A;  4QBB A;  3RVX A;  2G6D A;  1O0E A;  3BOW A;  1PIP A;  2OZ2 A;  2PAD A;  2XU5 A;  2HD5 A;  1QDQ A;  1K3B B;  1PXV A;  2F1G A;  2YJB A;  4I04 A;  1EWO A;  2YJ8 A;  1AU4 A;  4CDD B;  2DZZ A;  3H89 A;  2BDL A;  3KSE A;  4ZUX U;  4MZO A;  3KFQ A;  1MDW A;  2AYN A;  5CVN B;  2C0Y A;  6PAD A;  3CH2 X;  1F2B A;  3P5W A;  2ATO A;  2FRA A;  2GHU A;  2AVW A;  4MSX A;  1EWP A;  4RY2 A;  2R9F A;  2P7U A;  1AIM A;  2FYE A;  4DMY A;  1CVZ A;  2ACT A;  1GLO A;  1M6D A;  2CIO A;  2WBF X;  1QXP A;  3CBK A;  7PCK A;  3P5X A;  4P6G A;  5JH3 A;  4FIP A;  4AXL A;  1PAD A;  1ITO A;  3MTN A;  3CH3 X;  4W4U A;  3RVW A;  2AYO A;  4AXM A;  1YT7 A;  2XU3 A;  1U9W A;  2OUL A;  2DCB A;  2XU1 A;  4Q8H A;  2B1N A;  4N4Z A;  3IUT A;  2DCA A;  4PAD A;  4I07 A;  2IBI A;  4W5C A;  2DC8 A;  3O1G A;  4P6E A;  2PBH A;  3B79 A;  1GEC E;  1ATK A;  3N3G A;  2HHN A;  2FTD A;  3HHA A;  3LXS A;  4W5B A;  4BS5 A; 
#chains in the Genus database with same CATH topology
 3PRP A;  2O6X A;  3I3T A;  5JA7 A;  1S4V A;  4RKX A;  4DMX A;  4IUM A;  3BC3 A;  2DCC A;  2YJ9 A;  1NB3 A;  4PI3 A;  1CB5 A;  1CSB B;  1AYV A;  1UKF A;  2FUD A;  2NQA A;  5CVO B;  2BU3 A;  2BTW A;  3RNV A;  2R6N A;  3OF9 A;  4ZTB A;  2ARY A;  3P5U A;  4BOU A;  1IWD A;  4N8W A;  5CVM A;  1Y08 A;  2E00 A;  1KXR A;  3KWZ A;  3MP2 A;  4YYW A;  1HUC B;  3M99 A;  1AYU A;  2DJF B;  3I06 A;  1BP4 A;  1MHW A;  1TU6 A;  1JQP A;  3OF8 A;  4OEM A;  3RVV A;  1AU0 A;  1F2C A;  2GFO A;  1U9V A;  2HH5 A;  3F75 A;  1GCB A;  3ZNH A;  4BPV A;  1SNK A;  8PCH A;  4REZ A;  2FO5 A;  1MS6 A;  4BS6 A;  5J94 A;  3P5V A;  3OVX A;  1U5I A;  1QOL A;  3E9S A;  2DJG B;  3WXG A;  1ZCM A;  5F02 A;  3S3Q A;  3OIS A;  4D8E A;  2PNS A;  3O65 A;  1U9Q X;  1NLJ A;  4HWY A;  1GMY A;  2R9C A;  1NB5 A;  3NHE A;  3GCB A;  2H7J A;  2JQG R;  3MHS A;  3E1Z B;  1AEC A;  1X9Y A;  2FE8 A;  3H7D A;  4OEL A;  2DC7 A;  1PPP A;  2P86 A;  4K7C A;  2FT2 A;  3V6C A;  3AI8 A;  3V6E A;  4WA6 A;  3MHH A;  3HWN A;  2FQ9 A;  1U9X A;  3IFU A;  2JTC A;  2JRI A;  3TRK A;  5EGW A;  4QRG A;  3K24 A;  2XU4 A;  1A6R A;  1THE A;  2AGA A;  1PPO A;  2AUX A;  4YYR A;  3C0R A;  3QT4 A;  4OW0 A;  3CBJ A;  4R3D A;  4PP2 E;  2DOS A;  2F7D A;  1AU3 A;  1CS8 A;  2R9N A;  1CV8 A;  3KW9 A;  1MIR A;  4BOZ A;  1KFX L;  3W30 A;  2CB5 A;  2J7Q C;  3H6S A;  1ZIV A;  2FRQ A;  1POP A;  3BCN A;  3O0U A;  1F2A A;  3BPM A;  2AIM A;  3PBH A;  3KX1 A;  1NPZ A;  3IMA A;  2B1M A;  1ME3 A;  4XR7 A;  2J7Q A;  4YYQ A;  3F5V A;  4IP3 A;  1YZB A;  4CDF B;  2E03 A;  1BQI A;  4G54 A;  1CJL A;  2IPP B;  4YVA A;  3MOR A;  4N79 A;  1CQD A;  3H8B A;  1KHQ A;  2Y5B A;  1XKG A;  3DF0 A;  2NQI A;  4I05 A;  4YYU A;  5CHT A;  4QH6 A;  1YVB A;  2VHF A;  2DZY A;  1PE6 A;  1PBH A;  3C9E A;  1AYW A;  4QRX A;  1CTE A;  1EWL A;  5EF4 A;  3PHX A;  2PRE A;  4CDC B;  3PNR A;  1Q6K A;  2HXZ A;  3KKU A;  3KWB X;  4FK5 A;  1TLO A;  3K9M A;  4BOQ A;  2AUZ A;  1DEU A;  3PW3 A;  3K8U A;  4RF1 A;  2P0R A;  4FJC A;  5JZE A;  2VHS A;  4BSQ A;  1BY8 A;  3QSD A;  2DC9 A;  2E02 A;  3WXF A;  2R9O A;  2NQG A;  1YK7 A;  2OP3 A;  5E6J A;  1NL6 A;  3BBA A;  3B21 A;  3PDF A;  4GUA A;  3TMP A;  3PSE A;  3HD3 A;  2R9M A;  2AS8 A;  5PAD A;  1STF E;  5A24 A;  3S3R A;  3PRM A;  3USV A;  4YYS A;  1PPD A;  5EZQ A;  9PAP A;  1SP4 B;  3IEJ A;  1TL9 A;  3N4C A;  1ICF A;  1VSN A;  4CZW A;  3IOQ A;  4KLB A;  3TNX A;  1DF0 A;  2AU1 A;  1F29 A;  5K16 A;  1BGO A;  3W31 A;  3U8E A;  1FH0 A;  3ZUA A;  4RF0 A;  1EF7 A;  3QJ3 A;  5EZS A;  2G8J A;  1Y4H A;  3BY4 A;  3WXE A;  4QRV A;  1PCI A;  2BDZ A;  4A5U A;  1ME4 A;  3H8C A;  1MEG A;  4XUI A;  2BTW B;  1YK8 A;  3BPF A;  4D8I A;  2YJ2 A;  3ERV A;  4X6H A;  4PP1 A;  3IHP A;  1YAL A;  1PPN A;  2UZJ A;  4BQV A;  5CHV A;  2E01 A;  3OVZ A;  4YV8 A;  2JQF R;  4Q8G A;  4WUR A;  3HHI A;  4D8B A;  3IV2 A;  2YJC A;  1CPJ A;  3N3K A;  4PT5 A;  4CDE B;  4YYV A;  3LFY A;  2G8E A;  2NQD B;  5FPW A;  2G7Y A;  2Y6E A;  3PHW A;  1EWM A;  3BWK A;  1VJV A;  3OQC A;  4RNA A;  5KO3 A;  2DCD A;  4M0W A;  1KFU L;  1NQC A;  4MZS A;  1PVJ A;  4X6I A;  3D6S A;  1QMY A;  1MEM A;  4X6J A;  3PHU A;  1KHP A;  2DC6 A;  1AU2 A;  4QBB A;  3RVX A;  2G6D A;  1O0E A;  3BOW A;  1PIP A;  2OZ2 A;  2PAD A;  2XU5 A;  2HD5 A;  1QDQ A;  1K3B B;  1PXV A;  2F1G A;  3MJ5 A;  2YJB A;  4I04 A;  1EWO A;  2YJ8 A;  1AU4 A;  4CDD B;  2DZZ A;  4XZX A;  3H89 A;  2BDL A;  3KSE A;  4ZUX U;  4MZO A;  4MI7 A;  3KFQ A;  1MDW A;  2AYN A;  4OVZ A;  5CVN B;  2C0Y A;  6PAD A;  3CH2 X;  1F2B A;  3P5W A;  4BOS A;  2ATO A;  1DKI A;  2FRA A;  2GHU A;  2AVW A;  4MSX A;  1EWP A;  4RY2 A;  2R9F A;  2HWK A;  2P7U A;  1AIM A;  2FYE A;  4DMY A;  1CVZ A;  2ACT A;  4MM3 B;  1GLO A;  1M6D A;  4OVZ B;  2CIO A;  2WBF X;  1QXP A;  3CBK A;  7PCK A;  4P16 A;  3P5X A;  4P6G A;  5JH3 A;  4FIP A;  4AXL A;  1PAD A;  1ITO A;  3MTN A;  3CH3 X;  4W4U A;  3RVW A;  2AYO A;  4AXM A;  1YT7 A;  4BOP A;  2XU3 A;  1U9W A;  2OUL A;  2DCB A;  3BB7 A;  2Z84 A;  2XU1 A;  4HXD B;  3MTV A;  4Q8H A;  2B1N A;  4N4Z A;  3IUT A;  2DCA A;  4PAD A;  4I07 A;  2IBI A;  4W5C A;  2DC8 A;  3O1G A;  4P6E A;  2PBH A;  3B79 A;  1GEC E;  1ATK A;  3PT2 A;  3N3G A;  2HHN A;  2FTD A;  3HHA A;  3LXS A;  4W5B A;  4BS5 A; 
#chains in the Genus database with same CATH homology
 2O6X A;  3I3T A;  5JA7 A;  1S4V A;  4DMX A;  3BC3 A;  2DCC A;  2YJ9 A;  1NB3 A;  4PI3 A;  1CB5 A;  1CSB B;  1AYV A;  2FUD A;  2NQA A;  5CVO B;  2R6N A;  3OF9 A;  3D9W A;  2ARY A;  3P5U A;  1IWD A;  4N8W A;  5CVM A;  1Y08 A;  2E00 A;  1KXR A;  3KWZ A;  4YYW A;  1HUC B;  3M99 A;  1AYU A;  2DJF B;  3LTW A;  3I06 A;  1BP4 A;  1MHW A;  1TU6 A;  1JQP A;  3OF8 A;  4OEM A;  3RVV A;  1AU0 A;  1F2C A;  2BSZ A;  1E2T A;  2GFO A;  1U9V A;  2HH5 A;  3F75 A;  1GCB A;  4BPV A;  1SNK A;  8PCH A;  2FO5 A;  1MS6 A;  4BS6 A;  5J94 A;  3P5V A;  1W4T A;  3OVX A;  1U5I A;  1QOL A;  2DJG B;  3WXG A;  1ZCM A;  5F02 A;  3S3Q A;  3OIS A;  2PNS A;  1U9Q X;  1NLJ A;  4HWY A;  1GMY A;  2R9C A;  1NB5 A;  3NHE A;  3GCB A;  2H7J A;  2JQG R;  3MHS A;  3E1Z B;  1AEC A;  1X9Y A;  3H7D A;  4OEL A;  2DC7 A;  1PPP A;  2P86 A;  4K7C A;  2FT2 A;  3V6C A;  3AI8 A;  3V6E A;  4WA6 A;  3MHH A;  3HWN A;  2FQ9 A;  1U9X A;  5EGW A;  4QRG A;  3K24 A;  2XU4 A;  1A6R A;  1THE A;  1PPO A;  2AUX A;  4YYR A;  3QT4 A;  3CBJ A;  4PP2 E;  4C5P A;  2F7D A;  1AU3 A;  1CS8 A;  2R9N A;  1CV8 A;  3KW9 A;  1MIR A;  1KFX L;  2CB5 A;  3H6S A;  1ZIV A;  4BGF A;  2FRQ A;  1POP A;  3BCN A;  3O0U A;  1F2A A;  3BPM A;  2VFC A;  2AIM A;  3PBH A;  3KX1 A;  1NPZ A;  3IMA A;  2B1M A;  1ME3 A;  4XR7 A;  4YYQ A;  3F5V A;  4CDF B;  2E03 A;  1BQI A;  4G54 A;  1CJL A;  2IPP B;  4YVA A;  3MOR A;  4N79 A;  1CQD A;  3H8B A;  1KHQ A;  2Y5B A;  1XKG A;  3DF0 A;  2VFB A;  2NQI A;  4I05 A;  4YYU A;  5CHT A;  4QH6 A;  1YVB A;  2VHF A;  2DZY A;  1PE6 A;  1PBH A;  3C9E A;  4QRX A;  1AYW A;  1CTE A;  1EWL A;  5EF4 A;  2PRE A;  4CDC B;  3PNR A;  1Q6K A;  1W6F A;  2HXZ A;  3KKU A;  3KWB X;  4FK5 A;  1TLO A;  3K9M A;  2AUZ A;  1DEU A;  3PW3 A;  3K8U A;  2P0R A;  4FJC A;  2VHS A;  4NV8 A;  4B55 A;  4BSQ A;  1BY8 A;  3QSD A;  2DC9 A;  2E02 A;  3WXF A;  2R9O A;  2NQG A;  1YK7 A;  2OP3 A;  1NL6 A;  3PDF A;  3HD3 A;  2R9M A;  2AS8 A;  5PAD A;  1STF E;  1W5R A;  5A24 A;  3S3R A;  3USV A;  4YYS A;  1PPD A;  9PAP A;  1SP4 B;  3IEJ A;  1TL9 A;  3N4C A;  1ICF A;  1VSN A;  4CZW A;  3IOQ A;  4KLB A;  3TNX A;  1GX3 A;  1DF0 A;  2AU1 A;  1F29 A;  5K16 A;  1BGO A;  3U8E A;  1FH0 A;  3ZUA A;  1EF7 A;  3QJ3 A;  2G8J A;  1Y4H A;  3WXE A;  4QRV A;  1PCI A;  2BDZ A;  1ME4 A;  3H8C A;  1MEG A;  4XUI A;  1YK8 A;  3BPF A;  2YJ2 A;  3ERV A;  4X6H A;  4PP1 A;  3IHP A;  1YAL A;  1PPN A;  4BQV A;  5CHV A;  2E01 A;  3OVZ A;  4YV8 A;  4Q8G A;  2JQF R;  3HHI A;  3IV2 A;  2YJC A;  1CPJ A;  3N3K A;  4CDE B;  4GUZ A;  4YYV A;  3LFY A;  2G8E A;  2NQD B;  5FPW A;  2G7Y A;  2Y6E A;  1EWM A;  3BWK A;  1VJV A;  2DCD A;  1KFU L;  1NQC A;  4MZS A;  4X6I A;  3D6S A;  1QMY A;  1MEM A;  4X6J A;  1KHP A;  2DC6 A;  1AU2 A;  4QBB A;  3RVX A;  2G6D A;  1O0E A;  3BOW A;  1PIP A;  2OZ2 A;  2PAD A;  2XU5 A;  2HD5 A;  1QDQ A;  1K3B B;  1PXV A;  2F1G A;  2YJB A;  4I04 A;  1EWO A;  2YJ8 A;  1AU4 A;  4NV7 A;  4CDD B;  2DZZ A;  3H89 A;  2BDL A;  3KSE A;  4ZUX U;  4MZO A;  3KFQ A;  1MDW A;  2AYN A;  5CVN B;  2C0Y A;  6PAD A;  3CH2 X;  1F2B A;  3P5W A;  2ATO A;  2FRA A;  2GHU A;  2AVW A;  4MSX A;  1EWP A;  4RY2 A;  2R9F A;  2P7U A;  1AIM A;  2FYE A;  4DMY A;  1CVZ A;  2ACT A;  1GLO A;  1M6D A;  2CIO A;  2WBF X;  1QXP A;  3CBK A;  7PCK A;  3P5X A;  4P6G A;  5JH3 A;  4FIP A;  4AXL A;  1PAD A;  1ITO A;  3MTN A;  3CH3 X;  4W4U A;  3RVW A;  2AYO A;  4AXM A;  1YT7 A;  2XU3 A;  1U9W A;  2OUL A;  2DCB A;  2XU1 A;  4Q8H A;  2B1N A;  4N4Z A;  3IUT A;  2DCA A;  4PAD A;  4I07 A;  2IBI A;  4W5C A;  2DC8 A;  3O1G A;  4P6E A;  2PBH A;  3B79 A;  1GEC E;  1ATK A;  3N3G A;  2HHN A;  2FTD A;  3HHA A;  3LXS A;  4W5B A;  4BS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...