3ZUAA

A c39-like domain
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
142
structure length
142
Chain Sequence
GAMANSDSCHKIDYGLYALEILAQYHNVSVNPEEIKHRFDTDGTGLGLTSWLLAAKSLELKVKQVKKTIDRLNFISLPALVWREDGRHFILTKVSKEANRYLIFDLEQRNPRVLEQSEFEALYQGHIILIASRSSVAGKLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING PROTEIN HLYB
publication title An Rtx Transporter Tethers its Unfolded Substrate During Secretion Via a Unique N-Terminal Domain.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 26
structure length 142
sequence length 142
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 2011-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03412 Peptidase_C39 Peptidase C39 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3zuaA01
1S4VA 3KKUA 4P6GA 2AUXA 2BDLA 4OELA 3WXEA 3F5VA 2DC6A 2NQAA 2R9CA 1CVZA 1YK8A 3MTNA 1SP4B 1THEA 3KX1A 5CHVA 2P0RA 1IWDA 6PADA 2YJ2A 1PIPA 2GHUA 2PADA 1U9WA 1AU3A 2DCBA 2NQIA 3IV2A 2E03A 2AYOA 1CQDA 3H6SA 1STFE 1XKGA 2B1MA 2CIOA 3O1GA 3OF9A 1VJVA 1PE6A 2Y6EA 1TLOA 1EWPA 4HWYA 3K9MA 1X9YA 3BOWA 1DEUA 2ATOA 2JQGR 2DCCA 4KLBA 3USVA 1U9QX 2NQGA 3OVZA 3N4CA 3BC3A 3BWKA 2GFOA 2FT2A 1ZCMA 2DCDA 3HHIA 1EWMA 2FO5A 3WXGA 2IPPB 4BS6A 9PAPA 2DZYA 1MIRA 2FYEA 1F2CA 4PP2E 1EF7A 3D6SA 3NHEA 3BPMA 4ZUXU 3P5VA 1POPA 4I04A 1VSNA 1CPJA 2E00A 3TNXA 5CVMA 3V6EA 3H89A 4QBBA 3E1ZB 2ACTA 2HD5A 1EWLA 1KHQA 2AIMA 4P6EA 3M99A 2B1NA 2AVWA 1PBHA 1MHWA 1MDWA 4XR7A 4YYUA 2FRQA 1BQIA 1AECA 1TU6A 4OEMA 4N8WA 4CDDB 3KSEA 2VHSA 4WA6A 2PREA 3WXFA 3GCBA 1O0EA 3I3TA 4AXMA 5JH3A 5JA7A 1GCBA 4X6IA 4YYQA 1F29A 1CSBB 1PPNA 1KFXL 2E01A 4PP1A 2WBFX 4PADA 1CJLA 2YJ9A 2HH5A 3IMAA 1PPDA 2OZ2A 1U9VA 5CVOB 2BDZA 2G8EA 3S3QA 2DJFB 1CTEA 2IBIA 4YYSA 3OISA 3KWBX 4DMXA 1ZIVA 2R9MA 1JQPA 3PW3A 2XU3A 3CBJA 3N3GA 1PPOA 1CV8A 4BSQA 1QXPA 3IUTA 2R6NA 1U5IA 3N3KA 1QDQA 3O0UA 2FQ9A 4QRVA 2R9OA 4BPVA 2FUDA 4QH6A 1HUCB 1YVBA 2AS8A 2OULA 4MZSA 2AUZA 2H7JA 3RVVA 1GECE 1AU0A 1GMYA 3IEJA 1YT7A 5EF4A 2G7YA 3PBHA 4BS5A 2R9NA 4QRGA 4G54A 1NL6A 3BPFA 3PDFA 1NB3A 1AU2A 3DF0A 1PPPA 2FTDA 4BQVA 2PNSA 2YJ8A 1NQCA 4PI3A 4W4UA 4FIPA 3HHAA 3MORA 1ATKA 3IOQA 4Q8HA 2F1GA 3BCNA 4I05A 4CDCB 4DMYA 3CH3X 5EGWA 4CZWA 8PCHA 3CBKA 2F7DA 1KXRA 1ME3A 5FPWA 2FRAA 4AXLA 2C0YA 1MS6A 1YALA 3MHSA 1NB5A 1QMYA 3RVWA 3P5WA 5K16A 4MZOA 1TL9A 1MEMA 3RVXA 3C9EA 2DCAA 4YYRA 1Y4HA 7PCKA 2XU4A 3F75A 5A24A 4YYVA 1ICFA 3PNRA 1CB5A 2CB5A 1EWOA 4YV8A 1SNKA 4FJCA 3H7DA 1Q6KA 4RY2A 5PADA 2P86A 3B79A 3ERVA 2Y5BA 4N4ZA 1KFUL 1F2BA 5CVNB 1F2AA 2HHNA 3P5UA 3QSDA 1PADA 4W5CA 1Y08A 4X6HA 4N79A 2R9FA 3MHHA 2AYNA 2ARYA 3V6CA 3K24A 3ZUAA 3K8UA 2DJGB 1AYWA 3HWNA 4CDFB 3S3RA 5F02A 1MEGA 2P7UA 5J94A 1AIMA 4CDEB 3I06A 3IHPA 3OF8A 1ME4A 2VHFA 1ITOA 1CS8A 4YVAA 1KHPA 3QJ3A 2G8JA 3LXSA 2DC7A 3H8BA 1PCIA 2YJCA 2JQFR 1BGOA 2XU1A 3U8EA 3H8CA 2YJBA 1BP4A 2DC9A 4YYWA 3OVXA 4FK5A 1GLOA 1DF0A 3HD3A 4XUIA 1AYVA 1BY8A 1QOLA 2NQDB 1NLJA 3QT4A 4MSXA 2DZZA 2O6XA 4W5BA 3CH2X 1NPZA 3LFYA 1AYUA 4Q8GA 2DC8A 2E02A 4X6JA 4I07A 1U9XA 1YK7A 4K7CA 2XU5A 3KFQA 2PBHA 5CHTA 3KWZA 2AU1A 1M6DA 1PXVA 3AI8A 1K3BB 2HXZA 2G6DA 3KW9A 4QRXA 1AU4A 2OP3A 1FH0A 3P5XA 1A6RA
chains in the Genus database with same CATH superfamily
1S4VA 3KKUA 4P6GA 2AUXA 2BDLA 4OELA 3PRPA 3WXEA 3F5VA 2DC6A 2NQAA 3BY4A 4BOSA 4OVZA 2R9CA 1CVZA 1YK8A 4R3DA 3MTNA 1SP4B 1THEA 3KX1A 5CHVA 2P0RA 1IWDA 6PADA 4REZA 2YJ2A 1PIPA 2GHUA 2PADA 1U9WA 1AU3A 2DCBA 2NQIA 3IV2A 2E03A 2AYOA 1CQDA 3H6SA 1STFE 1XKGA 2B1MA 2CIOA 3O1GA 3OF9A 1VJVA 1PE6A 2J7QC 2Y6EA 4OVZB 1TLOA 4D8EA 1EWPA 4HWYA 3K9MA 1X9YA 3BOWA 1DEUA 2ATOA 2JQGR 2DCCA 4KLBA 3USVA 1U9QX 2NQGA 3OVZA 3N4CA 3BC3A 3BWKA 3BB7A 2GFOA 2FT2A 5E6JA 1ZCMA 2DCDA 3HHIA 1EWMA 2FO5A 3WXGA 3MJ5A 2IPPB 4BS6A 9PAPA 2DOSA 2DZYA 1MIRA 2FYEA 1F2CA 4PP2E 1EF7A 3D6SA 3NHEA 3BPMA 4ZUXU 3P5VA 1POPA 4IUMA 4I04A 1VSNA 1CPJA 2E00A 3TNXA 5CVMA 3V6EA 4IP3A 3H89A 4QBBA 3E1ZB 2ACTA 2HD5A 1EWLA 1KHQA 2AIMA 4P6EA 3M99A 2B1NA 2JTCA 2AVWA 1PBHA 1MHWA 4BOQA 4M0WA 1MDWA 4XR7A 3B21A 4RNAA 4YYUA 2FRQA 4A5UA 3C0RA 1BQIA 1AECA 1TU6A 4OEMA 4P16A 4N8WA 1DKIA 4CDDB 3KSEA 2VHSA 4WA6A 2PREA 3WXFA 3GCBA 5EZSA 1O0EA 3I3TA 3TMPA 4AXMA 5JH3A 5JA7A 1GCBA 4X6IA 4YYQA 1F29A 1CSBB 1PPNA 1KFXL 2E01A 4PP1A 4PT5A 2WBFX 4PADA 1CJLA 2YJ9A 2UZJA 2HH5A 3IMAA 1PPDA 4BOUA 2OZ2A 1U9VA 5CVOB 2BDZA 2G8EA 3S3QA 2DJFB 1CTEA 2IBIA 4D8IA 4YYSA 3OISA 3KWBX 4DMXA 3PT2A 1ZIVA 2R9MA 1JQPA 3PW3A 2XU3A 3CBJA 3N3GA 1PPOA 1CV8A 4BSQA 1QXPA 3IUTA 2R6NA 1U5IA 3N3KA 1QDQA 3O0UA 2FQ9A 4QRVA 2R9OA 4BPVA 2FUDA 4QH6A 2Z84A 1HUCB 1YVBA 2AS8A 2OULA 4MZSA 2AUZA 4RF0A 4XZXA 2H7JA 3RVVA 1GECE 1AU0A 1GMYA 3IEJA 1YT7A 4MI7A 5EF4A 2G7YA 2J7QA 3PBHA 4BS5A 2R9NA 4QRGA 3W31A 4G54A 3PHUA 4ZTBA 1NL6A 3BPFA 3PDFA 1NB3A 1AU2A 3DF0A 1PPPA 2HWKA 4WURA 2FTDA 4HXDB 4BQVA 3RNVA 2PNSA 2YJ8A 1NQCA 4PI3A 4W4UA 4FIPA 3HHAA 3MORA 1ATKA 3IOQA 4Q8HA 2F1GA 3BCNA 4I05A 1PVJA 4CDCB 4DMYA 3CH3X 5EGWA 4CZWA 8PCHA 3CBKA 2F7DA 1KXRA 1ME3A 5EZQA 5FPWA 2FRAA 4AXLA 2C0YA 1MS6A 1YALA 3MHSA 1NB5A 1QMYA 3RVWA 3P5WA 5K16A 4MZOA 1TL9A 1MEMA 3RVXA 3C9EA 2DCAA 4YYRA 1Y4HA 3MTVA 7PCKA 2XU4A 3F75A 5A24A 4YYVA 1ICFA 3PNRA 1CB5A 2CB5A 4BOPA 1EWOA 4YV8A 1UKFA 1SNKA 3OQCA 3H7DA 4FJCA 3PSEA 1Q6KA 4RY2A 5PADA 3IFUA 2P86A 3B79A 4MM3B 3ERVA 2Y5BA 4N4ZA 1KFUL 1F2BA 5CVNB 1F2AA 2HHNA 3P5UA 3QSDA 3W30A 1PADA 4W5CA 1Y08A 4X6HA 4N79A 2R9FA 3MHHA 2AYNA 3O65A 2ARYA 3V6CA 3K24A 3ZUAA 3K8UA 2DJGB 1AYWA 3HWNA 4CDFB 3S3RA 5F02A 1MEGA 2P7UA 5J94A 1AIMA 4RKXA 4CDEB 3I06A 3IHPA 3OF8A 2BTWA 1ME4A 4OW0A 2VHFA 1ITOA 1CS8A 4YVAA 1KHPA 3QJ3A 2JRIA 2G8JA 3LXSA 2DC7A 3H8BA 3PRMA 1PCIA 2YJCA 2FE8A 3TRKA 2JQFR 1BGOA 2XU1A 3U8EA 3H8CA 2YJBA 1BP4A 2DC9A 1YZBA 4YYWA 3OVXA 3ZNHA 4FK5A 1GLOA 4BOZA 1DF0A 3HD3A 4XUIA 1AYVA 2BTWB 4GUAA 1BY8A 5KO3A 5JZEA 1QOLA 2NQDB 1NLJA 3QT4A 4MSXA 4D8BA 2DZZA 2O6XA 4W5BA 3CH2X 1NPZA 3LFYA 1AYUA 3PHWA 4Q8GA 3PHXA 2DC8A 2E02A 4X6JA 4I07A 1U9XA 3BBAA 1YK7A 4K7CA 2XU5A 3KFQA 2PBHA 4RF1A 5CHTA 3KWZA 2AU1A 2AGAA 1M6DA 1PXVA 3AI8A 3MP2A 2BU3A 1K3BB 2HXZA 2G6DA 3KW9A 4QRXA 3E9SA 1AU4A 2OP3A 1FH0A 3P5XA 1A6RA
chains in the Genus database with same CATH topology
1S4VA 3KKUA 4P6GA 2AUXA 2BDLA 4OELA 3WXEA 3F5VA 2DC6A 2NQAA 2R9CA 1CVZA 1YK8A 3D9WA 3MTNA 1SP4B 1THEA 3KX1A 5CHVA 2P0RA 1IWDA 6PADA 2YJ2A 1PIPA 2GHUA 2PADA 1U9WA 1AU3A 2DCBA 2NQIA 3IV2A 2E03A 2AYOA 1CQDA 3H6SA 1STFE 1XKGA 2B1MA 2CIOA 3O1GA 3OF9A 1VJVA 1PE6A 2Y6EA 1TLOA 1EWPA 4HWYA 3K9MA 1X9YA 3BOWA 1DEUA 2ATOA 2JQGR 2DCCA 4KLBA 3USVA 1U9QX 2NQGA 3OVZA 3N4CA 3BC3A 3BWKA 1GX3A 2GFOA 2FT2A 1ZCMA 2DCDA 3HHIA 1EWMA 2FO5A 3WXGA 2IPPB 4BS6A 9PAPA 2DZYA 1MIRA 2FYEA 1F2CA 4PP2E 1EF7A 4C5PA 3D6SA 3NHEA 3BPMA 4ZUXU 3P5VA 1POPA 4I04A 1VSNA 1CPJA 2E00A 3TNXA 5CVMA 3V6EA 3H89A 4QBBA 3E1ZB 2ACTA 2HD5A 1EWLA 1KHQA 2AIMA 4P6EA 3M99A 2B1NA 2AVWA 1PBHA 1MHWA 1MDWA 4XR7A 4YYUA 2FRQA 1BQIA 1AECA 1TU6A 4OEMA 4N8WA 4CDDB 3KSEA 2VHSA 4WA6A 2PREA 3WXFA 3GCBA 1O0EA 3I3TA 4AXMA 5JH3A 5JA7A 1GCBA 4X6IA 4YYQA 1F29A 1CSBB 1PPNA 1KFXL 2E01A 4PP1A 2WBFX 4PADA 1CJLA 2YJ9A 2HH5A 3IMAA 1PPDA 2OZ2A 1U9VA 5CVOB 2BDZA 2G8EA 3S3QA 2DJFB 1CTEA 2IBIA 4YYSA 3OISA 3KWBX 4DMXA 1ZIVA 2R9MA 1JQPA 3PW3A 2XU3A 3CBJA 3N3GA 1PPOA 1CV8A 4BSQA 1QXPA 3IUTA 2R6NA 1U5IA 3N3KA 1QDQA 3O0UA 2FQ9A 4QRVA 2R9OA 4BPVA 2FUDA 4QH6A 1HUCB 1YVBA 2AS8A 2OULA 4MZSA 2AUZA 2H7JA 4GUZA 3RVVA 1GECE 1AU0A 1GMYA 3IEJA 1YT7A 5EF4A 2G7YA 3PBHA 4BS5A 2R9NA 4QRGA 4G54A 1NL6A 3BPFA 3PDFA 1NB3A 1W4TA 1AU2A 3DF0A 1PPPA 2FTDA 4BQVA 2PNSA 2YJ8A 1NQCA 4PI3A 4W4UA 4FIPA 3HHAA 3MORA 1ATKA 4BGFA 3IOQA 4Q8HA 2F1GA 3BCNA 4I05A 4CDCB 4DMYA 3CH3X 5EGWA 4CZWA 8PCHA 3CBKA 2F7DA 1KXRA 1ME3A 5FPWA 2FRAA 4AXLA 2C0YA 1MS6A 1YALA 3MHSA 1NB5A 1QMYA 3RVWA 3P5WA 5K16A 4MZOA 1TL9A 1MEMA 3RVXA 3C9EA 2DCAA 4YYRA 1Y4HA 7PCKA 2XU4A 3F75A 5A24A 4YYVA 1ICFA 3PNRA 1CB5A 2CB5A 1EWOA 4YV8A 1SNKA 1W6FA 4FJCA 3H7DA 1Q6KA 4RY2A 4NV7A 5PADA 2P86A 3B79A 4B55A 3ERVA 2Y5BA 4N4ZA 1KFUL 2VFBA 1F2BA 5CVNB 3LTWA 1F2AA 2HHNA 3P5UA 3QSDA 1PADA 4W5CA 1Y08A 4X6HA 4N79A 2R9FA 3MHHA 2AYNA 2ARYA 3V6CA 3K24A 3ZUAA 3K8UA 2DJGB 1AYWA 1W5RA 3HWNA 4CDFB 3S3RA 5F02A 1MEGA 2P7UA 5J94A 1AIMA 4CDEB 3I06A 3IHPA 3OF8A 1ME4A 2VHFA 1ITOA 1CS8A 4YVAA 1KHPA 3QJ3A 2G8JA 3LXSA 2DC7A 3H8BA 1PCIA 2YJCA 2JQFR 1BGOA 2XU1A 3U8EA 3H8CA 2YJBA 1BP4A 2DC9A 4YYWA 3OVXA 4FK5A 1GLOA 1DF0A 3HD3A 4XUIA 1AYVA 1BY8A 1QOLA 2NQDB 4NV8A 1NLJA 3QT4A 4MSXA 2DZZA 2O6XA 4W5BA 3CH2X 1NPZA 3LFYA 1AYUA 4Q8GA 2VFCA 2DC8A 2E02A 4X6JA 4I07A 1U9XA 1YK7A 4K7CA 2XU5A 3KFQA 2PBHA 5CHTA 3KWZA 2AU1A 1M6DA 1PXVA 3AI8A 1E2TA 2BSZA 1K3BB 2HXZA 2G6DA 3KW9A 4QRXA 1AU4A 2OP3A 1FH0A 3P5XA 1A6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S4V A;  3KKU A;  4P6G A;  2AUX A;  2BDL A;  4OEL A;  3WXE A;  3F5V A;  2DC6 A;  2NQA A;  2R9C A;  1CVZ A;  1YK8 A;  3MTN A;  1SP4 B;  1THE A;  3KX1 A;  5CHV A;  2P0R A;  1IWD A;  6PAD A;  2YJ2 A;  1PIP A;  2GHU A;  2PAD A;  1U9W A;  1AU3 A;  2DCB A;  2NQI A;  3IV2 A;  2E03 A;  2AYO A;  1CQD A;  3H6S A;  1STF E;  1XKG A;  2B1M A;  2CIO A;  3O1G A;  3OF9 A;  1VJV A;  1PE6 A;  2Y6E A;  1TLO A;  1EWP A;  4HWY A;  3K9M A;  1X9Y A;  3BOW A;  1DEU A;  2ATO A;  2JQG R;  2DCC A;  4KLB A;  3USV A;  1U9Q X;  2NQG A;  3OVZ A;  3N4C A;  3BC3 A;  3BWK A;  2GFO A;  2FT2 A;  1ZCM A;  2DCD A;  3HHI A;  1EWM A;  2FO5 A;  3WXG A;  2IPP B;  4BS6 A;  9PAP A;  2DZY A;  1MIR A;  2FYE A;  1F2C A;  4PP2 E;  1EF7 A;  3D6S A;  3NHE A;  3BPM A;  4ZUX U;  3P5V A;  1POP A;  4I04 A;  1VSN A;  1CPJ A;  2E00 A;  3TNX A;  5CVM A;  3V6E A;  3H89 A;  4QBB A;  3E1Z B;  2ACT A;  2HD5 A;  1EWL A;  1KHQ A;  2AIM A;  4P6E A;  3M99 A;  2B1N A;  2AVW A;  1PBH A;  1MHW A;  1MDW A;  4XR7 A;  4YYU A;  2FRQ A;  1BQI A;  1AEC A;  1TU6 A;  4OEM A;  4N8W A;  4CDD B;  3KSE A;  2VHS A;  4WA6 A;  2PRE A;  3WXF A;  3GCB A;  1O0E A;  3I3T A;  4AXM A;  5JH3 A;  5JA7 A;  1GCB A;  4X6I A;  4YYQ A;  1F29 A;  1CSB B;  1PPN A;  1KFX L;  2E01 A;  4PP1 A;  2WBF X;  4PAD A;  1CJL A;  2YJ9 A;  2HH5 A;  3IMA A;  1PPD A;  2OZ2 A;  1U9V A;  5CVO B;  2BDZ A;  2G8E A;  3S3Q A;  2DJF B;  1CTE A;  2IBI A;  4YYS A;  3OIS A;  3KWB X;  4DMX A;  1ZIV A;  2R9M A;  1JQP A;  3PW3 A;  2XU3 A;  3CBJ A;  3N3G A;  1PPO A;  1CV8 A;  4BSQ A;  1QXP A;  3IUT A;  2R6N A;  1U5I A;  3N3K A;  1QDQ A;  3O0U A;  2FQ9 A;  4QRV A;  2R9O A;  4BPV A;  2FUD A;  4QH6 A;  1HUC B;  1YVB A;  2AS8 A;  2OUL A;  4MZS A;  2AUZ A;  2H7J A;  3RVV A;  1GEC E;  1AU0 A;  1GMY A;  3IEJ A;  1YT7 A;  5EF4 A;  2G7Y A;  3PBH A;  4BS5 A;  2R9N A;  4QRG A;  4G54 A;  1NL6 A;  3BPF A;  3PDF A;  1NB3 A;  1AU2 A;  3DF0 A;  1PPP A;  2FTD A;  4BQV A;  2PNS A;  2YJ8 A;  1NQC A;  4PI3 A;  4W4U A;  4FIP A;  3HHA A;  3MOR A;  1ATK A;  3IOQ A;  4Q8H A;  2F1G A;  3BCN A;  4I05 A;  4CDC B;  4DMY A;  3CH3 X;  5EGW A;  4CZW A;  8PCH A;  3CBK A;  2F7D A;  1KXR A;  1ME3 A;  5FPW A;  2FRA A;  4AXL A;  2C0Y A;  1MS6 A;  1YAL A;  3MHS A;  1NB5 A;  1QMY A;  3RVW A;  3P5W A;  5K16 A;  4MZO A;  1TL9 A;  1MEM A;  3RVX A;  3C9E A;  2DCA A;  4YYR A;  1Y4H A;  7PCK A;  2XU4 A;  3F75 A;  5A24 A;  4YYV A;  1ICF A;  3PNR A;  1CB5 A;  2CB5 A;  1EWO A;  4YV8 A;  1SNK A;  4FJC A;  3H7D A;  1Q6K A;  4RY2 A;  5PAD A;  2P86 A;  3B79 A;  3ERV A;  2Y5B A;  4N4Z A;  1KFU L;  1F2B A;  5CVN B;  1F2A A;  2HHN A;  3P5U A;  3QSD A;  1PAD A;  4W5C A;  1Y08 A;  4X6H A;  4N79 A;  2R9F A;  3MHH A;  2AYN A;  2ARY A;  3V6C A;  3K24 A;  3ZUA A;  3K8U A;  2DJG B;  1AYW A;  3HWN A;  4CDF B;  3S3R A;  5F02 A;  1MEG A;  2P7U A;  5J94 A;  1AIM A;  4CDE B;  3I06 A;  3IHP A;  3OF8 A;  1ME4 A;  2VHF A;  1ITO A;  1CS8 A;  4YVA A;  1KHP A;  3QJ3 A;  2G8J A;  3LXS A;  2DC7 A;  3H8B A;  1PCI A;  2YJC A;  2JQF R;  1BGO A;  2XU1 A;  3U8E A;  3H8C A;  2YJB A;  1BP4 A;  2DC9 A;  4YYW A;  3OVX A;  4FK5 A;  1GLO A;  1DF0 A;  3HD3 A;  4XUI A;  1AYV A;  1BY8 A;  1QOL A;  2NQD B;  1NLJ A;  3QT4 A;  4MSX A;  2DZZ A;  2O6X A;  4W5B A;  3CH2 X;  1NPZ A;  3LFY A;  1AYU A;  4Q8G A;  2DC8 A;  2E02 A;  4X6J A;  4I07 A;  1U9X A;  1YK7 A;  4K7C A;  2XU5 A;  3KFQ A;  2PBH A;  5CHT A;  3KWZ A;  2AU1 A;  1M6D A;  1PXV A;  3AI8 A;  1K3B B;  2HXZ A;  2G6D A;  3KW9 A;  4QRX A;  1AU4 A;  2OP3 A;  1FH0 A;  3P5X A;  1A6R A; 
#chains in the Genus database with same CATH topology
 1S4V A;  3KKU A;  4P6G A;  2AUX A;  2BDL A;  4OEL A;  3PRP A;  3WXE A;  3F5V A;  2DC6 A;  2NQA A;  3BY4 A;  4BOS A;  4OVZ A;  2R9C A;  1CVZ A;  1YK8 A;  4R3D A;  3MTN A;  1SP4 B;  1THE A;  3KX1 A;  5CHV A;  2P0R A;  1IWD A;  6PAD A;  4REZ A;  2YJ2 A;  1PIP A;  2GHU A;  2PAD A;  1U9W A;  1AU3 A;  2DCB A;  2NQI A;  3IV2 A;  2E03 A;  2AYO A;  1CQD A;  3H6S A;  1STF E;  1XKG A;  2B1M A;  2CIO A;  3O1G A;  3OF9 A;  1VJV A;  1PE6 A;  2J7Q C;  2Y6E A;  4OVZ B;  1TLO A;  4D8E A;  1EWP A;  4HWY A;  3K9M A;  1X9Y A;  3BOW A;  1DEU A;  2ATO A;  2JQG R;  2DCC A;  4KLB A;  3USV A;  1U9Q X;  2NQG A;  3OVZ A;  3N4C A;  3BC3 A;  3BWK A;  3BB7 A;  2GFO A;  2FT2 A;  5E6J A;  1ZCM A;  2DCD A;  3HHI A;  1EWM A;  2FO5 A;  3WXG A;  3MJ5 A;  2IPP B;  4BS6 A;  9PAP A;  2DOS A;  2DZY A;  1MIR A;  2FYE A;  1F2C A;  4PP2 E;  1EF7 A;  3D6S A;  3NHE A;  3BPM A;  4ZUX U;  3P5V A;  1POP A;  4IUM A;  4I04 A;  1VSN A;  1CPJ A;  2E00 A;  3TNX A;  5CVM A;  3V6E A;  4IP3 A;  3H89 A;  4QBB A;  3E1Z B;  2ACT A;  2HD5 A;  1EWL A;  1KHQ A;  2AIM A;  4P6E A;  3M99 A;  2B1N A;  2JTC A;  2AVW A;  1PBH A;  1MHW A;  4BOQ A;  4M0W A;  1MDW A;  4XR7 A;  3B21 A;  4RNA A;  4YYU A;  2FRQ A;  4A5U A;  3C0R A;  1BQI A;  1AEC A;  1TU6 A;  4OEM A;  4P16 A;  4N8W A;  1DKI A;  4CDD B;  3KSE A;  2VHS A;  4WA6 A;  2PRE A;  3WXF A;  3GCB A;  5EZS A;  1O0E A;  3I3T A;  3TMP A;  4AXM A;  5JH3 A;  5JA7 A;  1GCB A;  4X6I A;  4YYQ A;  1F29 A;  1CSB B;  1PPN A;  1KFX L;  2E01 A;  4PP1 A;  4PT5 A;  2WBF X;  4PAD A;  1CJL A;  2YJ9 A;  2UZJ A;  2HH5 A;  3IMA A;  1PPD A;  4BOU A;  2OZ2 A;  1U9V A;  5CVO B;  2BDZ A;  2G8E A;  3S3Q A;  2DJF B;  1CTE A;  2IBI A;  4D8I A;  4YYS A;  3OIS A;  3KWB X;  4DMX A;  3PT2 A;  1ZIV A;  2R9M A;  1JQP A;  3PW3 A;  2XU3 A;  3CBJ A;  3N3G A;  1PPO A;  1CV8 A;  4BSQ A;  1QXP A;  3IUT A;  2R6N A;  1U5I A;  3N3K A;  1QDQ A;  3O0U A;  2FQ9 A;  4QRV A;  2R9O A;  4BPV A;  2FUD A;  4QH6 A;  2Z84 A;  1HUC B;  1YVB A;  2AS8 A;  2OUL A;  4MZS A;  2AUZ A;  4RF0 A;  4XZX A;  2H7J A;  3RVV A;  1GEC E;  1AU0 A;  1GMY A;  3IEJ A;  1YT7 A;  4MI7 A;  5EF4 A;  2G7Y A;  2J7Q A;  3PBH A;  4BS5 A;  2R9N A;  4QRG A;  3W31 A;  4G54 A;  3PHU A;  4ZTB A;  1NL6 A;  3BPF A;  3PDF A;  1NB3 A;  1AU2 A;  3DF0 A;  1PPP A;  2HWK A;  4WUR A;  2FTD A;  4HXD B;  4BQV A;  3RNV A;  2PNS A;  2YJ8 A;  1NQC A;  4PI3 A;  4W4U A;  4FIP A;  3HHA A;  3MOR A;  1ATK A;  3IOQ A;  4Q8H A;  2F1G A;  3BCN A;  4I05 A;  1PVJ A;  4CDC B;  4DMY A;  3CH3 X;  5EGW A;  4CZW A;  8PCH A;  3CBK A;  2F7D A;  1KXR A;  1ME3 A;  5EZQ A;  5FPW A;  2FRA A;  4AXL A;  2C0Y A;  1MS6 A;  1YAL A;  3MHS A;  1NB5 A;  1QMY A;  3RVW A;  3P5W A;  5K16 A;  4MZO A;  1TL9 A;  1MEM A;  3RVX A;  3C9E A;  2DCA A;  4YYR A;  1Y4H A;  3MTV A;  7PCK A;  2XU4 A;  3F75 A;  5A24 A;  4YYV A;  1ICF A;  3PNR A;  1CB5 A;  2CB5 A;  4BOP A;  1EWO A;  4YV8 A;  1UKF A;  1SNK A;  3OQC A;  3H7D A;  4FJC A;  3PSE A;  1Q6K A;  4RY2 A;  5PAD A;  3IFU A;  2P86 A;  3B79 A;  4MM3 B;  3ERV A;  2Y5B A;  4N4Z A;  1KFU L;  1F2B A;  5CVN B;  1F2A A;  2HHN A;  3P5U A;  3QSD A;  3W30 A;  1PAD A;  4W5C A;  1Y08 A;  4X6H A;  4N79 A;  2R9F A;  3MHH A;  2AYN A;  3O65 A;  2ARY A;  3V6C A;  3K24 A;  3ZUA A;  3K8U A;  2DJG B;  1AYW A;  3HWN A;  4CDF B;  3S3R A;  5F02 A;  1MEG A;  2P7U A;  5J94 A;  1AIM A;  4RKX A;  4CDE B;  3I06 A;  3IHP A;  3OF8 A;  2BTW A;  1ME4 A;  4OW0 A;  2VHF A;  1ITO A;  1CS8 A;  4YVA A;  1KHP A;  3QJ3 A;  2JRI A;  2G8J A;  3LXS A;  2DC7 A;  3H8B A;  3PRM A;  1PCI A;  2YJC A;  2FE8 A;  3TRK A;  2JQF R;  1BGO A;  2XU1 A;  3U8E A;  3H8C A;  2YJB A;  1BP4 A;  2DC9 A;  1YZB A;  4YYW A;  3OVX A;  3ZNH A;  4FK5 A;  1GLO A;  4BOZ A;  1DF0 A;  3HD3 A;  4XUI A;  1AYV A;  2BTW B;  4GUA A;  1BY8 A;  5KO3 A;  5JZE A;  1QOL A;  2NQD B;  1NLJ A;  3QT4 A;  4MSX A;  4D8B A;  2DZZ A;  2O6X A;  4W5B A;  3CH2 X;  1NPZ A;  3LFY A;  1AYU A;  3PHW A;  4Q8G A;  3PHX A;  2DC8 A;  2E02 A;  4X6J A;  4I07 A;  1U9X A;  3BBA A;  1YK7 A;  4K7C A;  2XU5 A;  3KFQ A;  2PBH A;  4RF1 A;  5CHT A;  3KWZ A;  2AU1 A;  2AGA A;  1M6D A;  1PXV A;  3AI8 A;  3MP2 A;  2BU3 A;  1K3B B;  2HXZ A;  2G6D A;  3KW9 A;  4QRX A;  3E9S A;  1AU4 A;  2OP3 A;  1FH0 A;  3P5X A;  1A6R A; 
#chains in the Genus database with same CATH homology
 1S4V A;  3KKU A;  4P6G A;  2AUX A;  2BDL A;  4OEL A;  3WXE A;  3F5V A;  2DC6 A;  2NQA A;  2R9C A;  1CVZ A;  1YK8 A;  3D9W A;  3MTN A;  1SP4 B;  1THE A;  3KX1 A;  5CHV A;  2P0R A;  1IWD A;  6PAD A;  2YJ2 A;  1PIP A;  2GHU A;  2PAD A;  1U9W A;  1AU3 A;  2DCB A;  2NQI A;  3IV2 A;  2E03 A;  2AYO A;  1CQD A;  3H6S A;  1STF E;  1XKG A;  2B1M A;  2CIO A;  3O1G A;  3OF9 A;  1VJV A;  1PE6 A;  2Y6E A;  1TLO A;  1EWP A;  4HWY A;  3K9M A;  1X9Y A;  3BOW A;  1DEU A;  2ATO A;  2JQG R;  2DCC A;  4KLB A;  3USV A;  1U9Q X;  2NQG A;  3OVZ A;  3N4C A;  3BC3 A;  3BWK A;  1GX3 A;  2GFO A;  2FT2 A;  1ZCM A;  2DCD A;  3HHI A;  1EWM A;  2FO5 A;  3WXG A;  2IPP B;  4BS6 A;  9PAP A;  2DZY A;  1MIR A;  2FYE A;  1F2C A;  4PP2 E;  1EF7 A;  4C5P A;  3D6S A;  3NHE A;  3BPM A;  4ZUX U;  3P5V A;  1POP A;  4I04 A;  1VSN A;  1CPJ A;  2E00 A;  3TNX A;  5CVM A;  3V6E A;  3H89 A;  4QBB A;  3E1Z B;  2ACT A;  2HD5 A;  1EWL A;  1KHQ A;  2AIM A;  4P6E A;  3M99 A;  2B1N A;  2AVW A;  1PBH A;  1MHW A;  1MDW A;  4XR7 A;  4YYU A;  2FRQ A;  1BQI A;  1AEC A;  1TU6 A;  4OEM A;  4N8W A;  4CDD B;  3KSE A;  2VHS A;  4WA6 A;  2PRE A;  3WXF A;  3GCB A;  1O0E A;  3I3T A;  4AXM A;  5JH3 A;  5JA7 A;  1GCB A;  4X6I A;  4YYQ A;  1F29 A;  1CSB B;  1PPN A;  1KFX L;  2E01 A;  4PP1 A;  2WBF X;  4PAD A;  1CJL A;  2YJ9 A;  2HH5 A;  3IMA A;  1PPD A;  2OZ2 A;  1U9V A;  5CVO B;  2BDZ A;  2G8E A;  3S3Q A;  2DJF B;  1CTE A;  2IBI A;  4YYS A;  3OIS A;  3KWB X;  4DMX A;  1ZIV A;  2R9M A;  1JQP A;  3PW3 A;  2XU3 A;  3CBJ A;  3N3G A;  1PPO A;  1CV8 A;  4BSQ A;  1QXP A;  3IUT A;  2R6N A;  1U5I A;  3N3K A;  1QDQ A;  3O0U A;  2FQ9 A;  4QRV A;  2R9O A;  4BPV A;  2FUD A;  4QH6 A;  1HUC B;  1YVB A;  2AS8 A;  2OUL A;  4MZS A;  2AUZ A;  2H7J A;  4GUZ A;  3RVV A;  1GEC E;  1AU0 A;  1GMY A;  3IEJ A;  1YT7 A;  5EF4 A;  2G7Y A;  3PBH A;  4BS5 A;  2R9N A;  4QRG A;  4G54 A;  1NL6 A;  3BPF A;  3PDF A;  1NB3 A;  1W4T A;  1AU2 A;  3DF0 A;  1PPP A;  2FTD A;  4BQV A;  2PNS A;  2YJ8 A;  1NQC A;  4PI3 A;  4W4U A;  4FIP A;  3HHA A;  3MOR A;  1ATK A;  4BGF A;  3IOQ A;  4Q8H A;  2F1G A;  3BCN A;  4I05 A;  4CDC B;  4DMY A;  3CH3 X;  5EGW A;  4CZW A;  8PCH A;  3CBK A;  2F7D A;  1KXR A;  1ME3 A;  5FPW A;  2FRA A;  4AXL A;  2C0Y A;  1MS6 A;  1YAL A;  3MHS A;  1NB5 A;  1QMY A;  3RVW A;  3P5W A;  5K16 A;  4MZO A;  1TL9 A;  1MEM A;  3RVX A;  3C9E A;  2DCA A;  4YYR A;  1Y4H A;  7PCK A;  2XU4 A;  3F75 A;  5A24 A;  4YYV A;  1ICF A;  3PNR A;  1CB5 A;  2CB5 A;  1EWO A;  4YV8 A;  1SNK A;  1W6F A;  4FJC A;  3H7D A;  1Q6K A;  4RY2 A;  4NV7 A;  5PAD A;  2P86 A;  3B79 A;  4B55 A;  3ERV A;  2Y5B A;  4N4Z A;  1KFU L;  2VFB A;  1F2B A;  5CVN B;  3LTW A;  1F2A A;  2HHN A;  3P5U A;  3QSD A;  1PAD A;  4W5C A;  1Y08 A;  4X6H A;  4N79 A;  2R9F A;  3MHH A;  2AYN A;  2ARY A;  3V6C A;  3K24 A;  3ZUA A;  3K8U A;  2DJG B;  1AYW A;  1W5R A;  3HWN A;  4CDF B;  3S3R A;  5F02 A;  1MEG A;  2P7U A;  5J94 A;  1AIM A;  4CDE B;  3I06 A;  3IHP A;  3OF8 A;  1ME4 A;  2VHF A;  1ITO A;  1CS8 A;  4YVA A;  1KHP A;  3QJ3 A;  2G8J A;  3LXS A;  2DC7 A;  3H8B A;  1PCI A;  2YJC A;  2JQF R;  1BGO A;  2XU1 A;  3U8E A;  3H8C A;  2YJB A;  1BP4 A;  2DC9 A;  4YYW A;  3OVX A;  4FK5 A;  1GLO A;  1DF0 A;  3HD3 A;  4XUI A;  1AYV A;  1BY8 A;  1QOL A;  2NQD B;  4NV8 A;  1NLJ A;  3QT4 A;  4MSX A;  2DZZ A;  2O6X A;  4W5B A;  3CH2 X;  1NPZ A;  3LFY A;  1AYU A;  4Q8G A;  2VFC A;  2DC8 A;  2E02 A;  4X6J A;  4I07 A;  1U9X A;  1YK7 A;  4K7C A;  2XU5 A;  3KFQ A;  2PBH A;  5CHT A;  3KWZ A;  2AU1 A;  1M6D A;  1PXV A;  3AI8 A;  1E2T A;  2BSZ A;  1K3B B;  2HXZ A;  2G6D A;  3KW9 A;  4QRX A;  1AU4 A;  2OP3 A;  1FH0 A;  3P5X A;  1A6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...