1NL6A

Crystal structure of the cysteine protease human cathepsin k in complex with a covalent azepanone inhibitor
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
215
structure length
215
Chain Sequence
b'APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin K
publication title Azepanone-based inhibitors of human and rat cathepsin K
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 54
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2003-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1nl6A00
1GECE 2FYEA 2F7DA 2BDLA 2NQIA 4PP2E 1F29A 3ERVA 1PBHA 3CBJA 3IV2A 1KXRA 4N79A 1ZIVA 4QBBA 4QH6A 1F2CA 1YK7A 3BPFA 3KKUA 4Q8GA 4YYVA 2DC9A 2IPPB 1U9WA 3HHAA 4YYRA 1KHPA 1CPJA 1VJVA 3QSDA 5CHVA 1MDWA 3KWBX 2YJBA 3F75A 3ZUAA 1NL6A 3LFYA 2FRQA 2DC6A 3WXGA 5A24A 4FIPA 1DF0A 4CDEB 2XU4A 3IEJA 2ARYA 1TL9A 3CH2X 2DCAA 2DC7A 1YK8A 1PADA 2AVWA 2PADA 1ME4A 3H89A 1POPA 3N3KA 1AYUA 4RY2A 5FPWA 2HHNA 2DJGB 1EWLA 3S3RA 2YJ9A 1NB3A 2CB5A 3H6SA 2FQ9A 1BP4A 3IOQA 4P6EA 3MHSA 3KW9A 1SNKA 3CH3X 2R9OA 4I07A 1QDQA 3U8EA 1O0EA 2B1MA 1SP4B 3K9MA 3MHHA 3P5WA 1U5IA 2C0YA 2GHUA 2R9MA 3AI8A 3C9EA 2AIMA 2F1GA 2DZYA 3IHPA 1QOLA 3H8BA 2DC8A 1F2BA 1Y08A 3O1GA 3HHIA 4X6IA 3I06A 1XKGA 2G7YA 1CSBB 3MORA 3N4CA 4OEMA 3K8UA 2XU3A 2DJFB 1CQDA 2PNSA 8PCHA 2HXZA 1X9YA 4QRGA 1AYVA 1M6DA 5K16A 2FUDA 7PCKA 1PCIA 1STFE 3D6SA 3LXSA 1EWMA 2O6XA 2NQGA 1MEGA 4CZWA 2AUXA 5CHTA 4MZOA 1BQIA 3E1ZB 1AU0A 1DEUA 2IBIA 3M99A 2FRAA 3RVXA 2PREA 1EF7A 2H7JA 4BQVA 4DMYA 3PNRA 4XR7A 4YV8A 3WXFA 3KX1A 4BS5A 1JQPA 3OVXA 1S4VA 1CJLA 1IWDA 3BOWA 1PIPA 3V6CA 2FTDA 1U9VA 2JQFR 2R9CA 1EWPA 1NB5A 4QRVA 1Y4HA 2NQDB 4YVAA 3H8CA 1QMYA 3F5VA 3BWKA 4W4UA 1HUCB 2CIOA 2ACTA 2BDZA 3KSEA 2DCCA 3TNXA 3MTNA 1BGOA 4WA6A 2Y6EA 3QT4A 2DZZA 4MSXA 2FO5A 1MS6A 4ZUXU 4W5CA 3PBHA 2AYOA 2PBHA 2VHSA 3CBKA 3PDFA 5CVNB 1AECA 5PADA 2NQAA 2ATOA 4X6HA 4X6JA 1YALA 1PPDA 3V6EA 4HWYA 2E01A 4N8WA 3IMAA 4PI3A 2R6NA 2HD5A 1ATKA 3BCNA 1CB5A 1QXPA 1ICFA 2GFOA 4YYWA 3K24A 1AU2A 1PPOA 5F02A 4I04A 3B79A 1THEA 1NLJA 4PADA 5J94A 3P5XA 3OF9A 1AU4A 1VSNA 1ZCMA 2P7UA 2FT2A 1TU6A 1KHQA 3KFQA 1GCBA 4BPVA 4BSQA 2WBFX 2OULA 1CTEA 2OP3A 2R9FA 1BY8A 4KLBA 1PPPA 4XUIA 1CVZA 3OF8A 4OELA 4YYSA 1TLOA 1A6RA 4YYUA 2Y5BA 1AIMA 4CDDB 2G6DA 4FK5A 3HWNA 2E00A 4K7CA 1PPNA 4CDCB 4AXLA 1K3BB 2AS8A 5JA7A 2E02A 2JQGR 3S3QA 2P86A 2G8EA 2YJCA 2AYNA 1MEMA 2AUZA 3O0UA 2P0RA 3DF0A 2DCBA 1U9QX 4AXMA 3NHEA 4N4ZA 3RVVA 2R9NA 3OVZA 1KFUL 2HH5A 1CV8A 3PW3A 1AU3A 4G54A 4BS6A 4Q8HA 3I3TA 3RVWA 1FH0A 2YJ8A 1U9XA 1ITOA 2E03A 5CVOB 1MHWA 3N3GA 2YJ2A 1F2AA 3QJ3A 2VHFA 2DCDA 1GMYA 3BPMA 3IUTA 4P6GA 6PADA 3P5UA 1EWOA 2OZ2A 3H7DA 3WXEA 4FJCA 1NPZA 3P5VA 1CS8A 1MIRA 1PXVA 5CVMA 3HD3A 4YYQA 2XU5A 1KFXL 1PE6A 1Q6KA 1AYWA 4W5BA 5JH3A 1ME3A 3BC3A 5EF4A 3GCBA 1NQCA 4I05A 3KWZA 1GLOA 1YVBA 9PAPA 2G8JA 4PP1A 3OISA 4QRXA 4MZSA 1YT7A 5EGWA 2B1NA 4DMXA 2XU1A 2AU1A 3USVA 4CDFB
chains in the Genus database with same CATH superfamily
1GECE 2FYEA 2F7DA 2FE8A 2BDLA 2NQIA 4PP2E 1F29A 3ERVA 4P16A 4BOZA 4D8BA 3MTVA 1PBHA 3CBJA 3IV2A 3PRPA 1KXRA 4N79A 1ZIVA 4QBBA 4ZTBA 4QH6A 1F2CA 1YK7A 3BPFA 3KKUA 4Q8GA 4YYVA 2DC9A 2IPPB 1U9WA 3HHAA 4YYRA 1KHPA 1CPJA 1VJVA 2JRIA 3QSDA 5CHVA 1MDWA 3KWBX 2YJBA 3F75A 3ZUAA 1NL6A 3LFYA 2FRQA 2DC6A 3WXGA 5A24A 4FIPA 1DF0A 4CDEB 2XU4A 3IEJA 2ARYA 1TL9A 3CH2X 2DCAA 4RNAA 2DC7A 1YK8A 1PADA 4MI7A 2AVWA 2PADA 1ME4A 3H89A 1POPA 3N3KA 1AYUA 4RY2A 1UKFA 5FPWA 2HHNA 4BOPA 2DJGB 1EWLA 3S3RA 2YJ9A 1NB3A 2CB5A 3H6SA 2FQ9A 1BP4A 3IOQA 4P6EA 5E6JA 3PT2A 4WURA 3MHSA 3KW9A 1SNKA 3CH3X 3PRMA 2R9OA 4I07A 1QDQA 2BTWA 4A5UA 3U8EA 1O0EA 2B1MA 1SP4B 3K9MA 3MHHA 3P5WA 1U5IA 2C0YA 2GHUA 2R9MA 3AI8A 3MJ5A 3C9EA 4RKXA 2AIMA 2F1GA 2DZYA 3PHXA 3IHPA 1QOLA 3H8BA 2DC8A 4REZA 4XZXA 1F2BA 1Y08A 3O1GA 3ZNHA 3HHIA 3BY4A 2DOSA 4X6IA 3I06A 1XKGA 2G7YA 1CSBB 3MORA 4BOSA 3N4CA 3B21A 4OEMA 3K8UA 2XU3A 2DJFB 1CQDA 2BTWB 2PNSA 8PCHA 2HXZA 1X9YA 4QRGA 1AYVA 1M6DA 5K16A 3W30A 2FUDA 7PCKA 2J7QC 1PCIA 1STFE 3D6SA 3LXSA 1EWMA 2O6XA 2NQGA 1MEGA 4CZWA 2AUXA 5CHTA 4MZOA 3C0RA 1BQIA 3RNVA 3E1ZB 1AU0A 1DEUA 2IBIA 3M99A 5EZSA 2FRAA 3RVXA 3PHUA 2PREA 3OQCA 1EF7A 2H7JA 4BQVA 4DMYA 3PNRA 4XR7A 4YV8A 3WXFA 3KX1A 4BS5A 1JQPA 3OVXA 1S4VA 1CJLA 1IWDA 3BOWA 1PIPA 3V6CA 2FTDA 1U9VA 2JQFR 2R9CA 1EWPA 1NB5A 4QRVA 1Y4HA 2NQDB 4YVAA 3H8CA 1QMYA 4HXDB 3F5VA 3BWKA 4W4UA 5EZQA 1HUCB 2BU3A 2CIOA 2ACTA 2BDZA 3KSEA 2DCCA 3TNXA 3MTNA 1BGOA 4WA6A 2Y6EA 1DKIA 3QT4A 3BBAA 2DZZA 4MSXA 1YZBA 3IFUA 4RF1A 2FO5A 1MS6A 4ZUXU 4W5CA 3PBHA 2JTCA 2AYOA 2PBHA 2VHSA 3CBKA 3PDFA 5CVNB 1AECA 4RF0A 4OW0A 5PADA 2NQAA 2ATOA 4X6HA 4X6JA 1YALA 1PPDA 3V6EA 4HWYA 4IP3A 2E01A 4N8WA 4BOUA 3IMAA 4D8IA 4PI3A 3W31A 2R6NA 2HD5A 1ATKA 4OVZB 3MP2A 3BCNA 1CB5A 1QXPA 1ICFA 2GFOA 3E9SA 4YYWA 3K24A 1AU2A 1PPOA 5F02A 2Z84A 4I04A 3B79A 1THEA 1NLJA 4PADA 4PT5A 5J94A 3P5XA 3OF9A 1AU4A 1VSNA 1ZCMA 2P7UA 3O65A 2FT2A 1TU6A 4D8EA 1KHQA 3KFQA 1GCBA 4BPVA 4BSQA 2WBFX 2OULA 1CTEA 2OP3A 2R9FA 1BY8A 4KLBA 1PPPA 4XUIA 1PVJA 4M0WA 3PHWA 3PSEA 1CVZA 5KO3A 3OF8A 4OELA 4YYSA 1TLOA 1A6RA 4YYUA 2Y5BA 1AIMA 4CDDB 2G6DA 4FK5A 3HWNA 2E00A 2AGAA 4K7CA 1PPNA 4CDCB 4AXLA 1K3BB 2AS8A 5JA7A 2E02A 2JQGR 3S3QA 2P86A 2G8EA 2YJCA 2AYNA 1MEMA 2AUZA 3O0UA 2P0RA 3DF0A 2J7QA 2DCBA 1U9QX 4AXMA 3NHEA 3BB7A 4N4ZA 3RVVA 2R9NA 3OVZA 1KFUL 2HH5A 1CV8A 3PW3A 1AU3A 4G54A 4BS6A 4Q8HA 3I3TA 3RVWA 1FH0A 2YJ8A 1U9XA 1ITOA 2E03A 5CVOB 1MHWA 3N3GA 4OVZA 2UZJA 2YJ2A 1F2AA 3QJ3A 2VHFA 3TRKA 2DCDA 1GMYA 4MM3B 3BPMA 3TMPA 3IUTA 4P6GA 6PADA 3P5UA 1EWOA 2OZ2A 3H7DA 4GUAA 5JZEA 3WXEA 4FJCA 1NPZA 2HWKA 3P5VA 1CS8A 1MIRA 1PXVA 5CVMA 3HD3A 4YYQA 2XU5A 1KFXL 1PE6A 1Q6KA 1AYWA 4W5BA 5JH3A 1ME3A 3BC3A 4IUMA 5EF4A 3GCBA 1NQCA 4R3DA 4I05A 3KWZA 1GLOA 1YVBA 9PAPA 2G8JA 4PP1A 3OISA 4QRXA 4MZSA 1YT7A 5EGWA 2B1NA 4DMXA 2XU1A 2AU1A 3USVA 4BOQA 4CDFB
chains in the Genus database with same CATH topology
1GECE 2FYEA 2F7DA 2BDLA 2NQIA 4PP2E 1F29A 3ERVA 1PBHA 3CBJA 3IV2A 4B55A 1KXRA 4N79A 1ZIVA 4QBBA 4QH6A 1F2CA 1YK7A 3BPFA 3KKUA 4Q8GA 4YYVA 2DC9A 2IPPB 1U9WA 3HHAA 4YYRA 1KHPA 1CPJA 1VJVA 3QSDA 5CHVA 1MDWA 3KWBX 2YJBA 3F75A 3ZUAA 1NL6A 3LFYA 2FRQA 2DC6A 3WXGA 4NV8A 5A24A 4FIPA 1DF0A 4CDEB 2XU4A 3IEJA 2ARYA 1TL9A 3CH2X 2DCAA 2DC7A 1YK8A 1PADA 1W5RA 2AVWA 2PADA 1ME4A 3H89A 1POPA 3N3KA 1AYUA 4RY2A 5FPWA 2HHNA 2DJGB 1EWLA 3S3RA 2YJ9A 1NB3A 2CB5A 3H6SA 2FQ9A 1BP4A 3IOQA 4P6EA 3MHSA 3KW9A 1SNKA 3CH3X 2R9OA 4I07A 1QDQA 3U8EA 1W4TA 1O0EA 2B1MA 1SP4B 3K9MA 3MHHA 3P5WA 1U5IA 2C0YA 2GHUA 2R9MA 3AI8A 3C9EA 2AIMA 2F1GA 2DZYA 3IHPA 1QOLA 3H8BA 2DC8A 1F2BA 1Y08A 3O1GA 3HHIA 4X6IA 3I06A 1XKGA 2G7YA 1CSBB 3MORA 3N4CA 4OEMA 3K8UA 2XU3A 2DJFB 1CQDA 2PNSA 8PCHA 2HXZA 1X9YA 4QRGA 1AYVA 1M6DA 5K16A 2FUDA 7PCKA 1PCIA 1STFE 3D6SA 3LXSA 1W6FA 1EWMA 2O6XA 4BGFA 2NQGA 1MEGA 4CZWA 2AUXA 5CHTA 4MZOA 1BQIA 3E1ZB 1AU0A 1DEUA 2IBIA 3M99A 2FRAA 3RVXA 2PREA 1EF7A 2H7JA 4BQVA 4DMYA 3PNRA 4XR7A 4YV8A 3WXFA 3KX1A 4BS5A 1JQPA 3OVXA 1S4VA 1CJLA 1IWDA 3BOWA 1PIPA 3V6CA 2FTDA 1U9VA 2JQFR 2R9CA 1EWPA 1NB5A 4QRVA 1Y4HA 2NQDB 4YVAA 3H8CA 1QMYA 3F5VA 3BWKA 4W4UA 1HUCB 2CIOA 2ACTA 2BDZA 3KSEA 2DCCA 3TNXA 3MTNA 1BGOA 4WA6A 2Y6EA 3QT4A 2DZZA 2VFCA 4MSXA 2FO5A 1MS6A 4ZUXU 4W5CA 3PBHA 1GX3A 2AYOA 2PBHA 2VHSA 3CBKA 3PDFA 5CVNB 1AECA 5PADA 2NQAA 2ATOA 4X6HA 4X6JA 1YALA 4GUZA 1PPDA 3V6EA 4HWYA 2E01A 4N8WA 3IMAA 4PI3A 2R6NA 2HD5A 1ATKA 3BCNA 1CB5A 1QXPA 1ICFA 2GFOA 4YYWA 3K24A 1AU2A 1PPOA 5F02A 4I04A 3B79A 1THEA 1NLJA 4PADA 5J94A 3P5XA 3OF9A 1AU4A 1VSNA 1ZCMA 2P7UA 2FT2A 1TU6A 1KHQA 3KFQA 1GCBA 4BPVA 4BSQA 4C5PA 2WBFX 2OULA 1CTEA 2OP3A 2R9FA 1BY8A 4KLBA 1PPPA 4XUIA 4NV7A 1CVZA 3OF8A 4OELA 4YYSA 1TLOA 1A6RA 4YYUA 2Y5BA 1AIMA 4CDDB 2G6DA 4FK5A 3HWNA 2E00A 4K7CA 1PPNA 4CDCB 4AXLA 1K3BB 2AS8A 5JA7A 2E02A 2JQGR 3S3QA 2P86A 2G8EA 2YJCA 2AYNA 1MEMA 2AUZA 3O0UA 2P0RA 3DF0A 2DCBA 1U9QX 3D9WA 4AXMA 3NHEA 4N4ZA 2VFBA 3RVVA 2R9NA 3OVZA 1KFUL 2HH5A 1CV8A 3PW3A 1AU3A 4G54A 4BS6A 4Q8HA 3I3TA 3RVWA 1FH0A 2YJ8A 1U9XA 1ITOA 1E2TA 2E03A 5CVOB 1MHWA 3N3GA 2YJ2A 1F2AA 3QJ3A 2VHFA 2DCDA 1GMYA 3BPMA 3IUTA 4P6GA 6PADA 3P5UA 1EWOA 2OZ2A 3H7DA 3WXEA 4FJCA 1NPZA 3P5VA 1CS8A 1MIRA 1PXVA 5CVMA 3HD3A 4YYQA 2XU5A 1KFXL 1PE6A 1Q6KA 1AYWA 4W5BA 5JH3A 1ME3A 3BC3A 5EF4A 3GCBA 1NQCA 2BSZA 4I05A 3KWZA 1GLOA 3LTWA 1YVBA 9PAPA 2G8JA 4PP1A 3OISA 4QRXA 4MZSA 1YT7A 5EGWA 2B1NA 4DMXA 2XU1A 2AU1A 3USVA 4CDFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GEC E;  2FYE A;  2F7D A;  2BDL A;  2NQI A;  4PP2 E;  1F29 A;  3ERV A;  1PBH A;  3CBJ A;  3IV2 A;  1KXR A;  4N79 A;  1ZIV A;  4QBB A;  4QH6 A;  1F2C A;  1YK7 A;  3BPF A;  3KKU A;  4Q8G A;  4YYV A;  2DC9 A;  2IPP B;  1U9W A;  3HHA A;  4YYR A;  1KHP A;  1CPJ A;  1VJV A;  3QSD A;  5CHV A;  1MDW A;  3KWB X;  2YJB A;  3F75 A;  3ZUA A;  1NL6 A;  3LFY A;  2FRQ A;  2DC6 A;  3WXG A;  5A24 A;  4FIP A;  1DF0 A;  4CDE B;  2XU4 A;  3IEJ A;  2ARY A;  1TL9 A;  3CH2 X;  2DCA A;  2DC7 A;  1YK8 A;  1PAD A;  2AVW A;  2PAD A;  1ME4 A;  3H89 A;  1POP A;  3N3K A;  1AYU A;  4RY2 A;  5FPW A;  2HHN A;  2DJG B;  1EWL A;  3S3R A;  2YJ9 A;  1NB3 A;  2CB5 A;  3H6S A;  2FQ9 A;  1BP4 A;  3IOQ A;  4P6E A;  3MHS A;  3KW9 A;  1SNK A;  3CH3 X;  2R9O A;  4I07 A;  1QDQ A;  3U8E A;  1O0E A;  2B1M A;  1SP4 B;  3K9M A;  3MHH A;  3P5W A;  1U5I A;  2C0Y A;  2GHU A;  2R9M A;  3AI8 A;  3C9E A;  2AIM A;  2F1G A;  2DZY A;  3IHP A;  1QOL A;  3H8B A;  2DC8 A;  1F2B A;  1Y08 A;  3O1G A;  3HHI A;  4X6I A;  3I06 A;  1XKG A;  2G7Y A;  1CSB B;  3MOR A;  3N4C A;  4OEM A;  3K8U A;  2XU3 A;  2DJF B;  1CQD A;  2PNS A;  8PCH A;  2HXZ A;  1X9Y A;  4QRG A;  1AYV A;  1M6D A;  5K16 A;  2FUD A;  7PCK A;  1PCI A;  1STF E;  3D6S A;  3LXS A;  1EWM A;  2O6X A;  2NQG A;  1MEG A;  4CZW A;  2AUX A;  5CHT A;  4MZO A;  1BQI A;  3E1Z B;  1AU0 A;  1DEU A;  2IBI A;  3M99 A;  2FRA A;  3RVX A;  2PRE A;  1EF7 A;  2H7J A;  4BQV A;  4DMY A;  3PNR A;  4XR7 A;  4YV8 A;  3WXF A;  3KX1 A;  4BS5 A;  1JQP A;  3OVX A;  1S4V A;  1CJL A;  1IWD A;  3BOW A;  1PIP A;  3V6C A;  2FTD A;  1U9V A;  2JQF R;  2R9C A;  1EWP A;  1NB5 A;  4QRV A;  1Y4H A;  2NQD B;  4YVA A;  3H8C A;  1QMY A;  3F5V A;  3BWK A;  4W4U A;  1HUC B;  2CIO A;  2ACT A;  2BDZ A;  3KSE A;  2DCC A;  3TNX A;  3MTN A;  1BGO A;  4WA6 A;  2Y6E A;  3QT4 A;  2DZZ A;  4MSX A;  2FO5 A;  1MS6 A;  4ZUX U;  4W5C A;  3PBH A;  2AYO A;  2PBH A;  2VHS A;  3CBK A;  3PDF A;  5CVN B;  1AEC A;  5PAD A;  2NQA A;  2ATO A;  4X6H A;  4X6J A;  1YAL A;  1PPD A;  3V6E A;  4HWY A;  2E01 A;  4N8W A;  3IMA A;  4PI3 A;  2R6N A;  2HD5 A;  1ATK A;  3BCN A;  1CB5 A;  1QXP A;  1ICF A;  2GFO A;  4YYW A;  3K24 A;  1AU2 A;  1PPO A;  5F02 A;  4I04 A;  3B79 A;  1THE A;  1NLJ A;  4PAD A;  5J94 A;  3P5X A;  3OF9 A;  1AU4 A;  1VSN A;  1ZCM A;  2P7U A;  2FT2 A;  1TU6 A;  1KHQ A;  3KFQ A;  1GCB A;  4BPV A;  4BSQ A;  2WBF X;  2OUL A;  1CTE A;  2OP3 A;  2R9F A;  1BY8 A;  4KLB A;  1PPP A;  4XUI A;  1CVZ A;  3OF8 A;  4OEL A;  4YYS A;  1TLO A;  1A6R A;  4YYU A;  2Y5B A;  1AIM A;  4CDD B;  2G6D A;  4FK5 A;  3HWN A;  2E00 A;  4K7C A;  1PPN A;  4CDC B;  4AXL A;  1K3B B;  2AS8 A;  5JA7 A;  2E02 A;  2JQG R;  3S3Q A;  2P86 A;  2G8E A;  2YJC A;  2AYN A;  1MEM A;  2AUZ A;  3O0U A;  2P0R A;  3DF0 A;  2DCB A;  1U9Q X;  4AXM A;  3NHE A;  4N4Z A;  3RVV A;  2R9N A;  3OVZ A;  1KFU L;  2HH5 A;  1CV8 A;  3PW3 A;  1AU3 A;  4G54 A;  4BS6 A;  4Q8H A;  3I3T A;  3RVW A;  1FH0 A;  2YJ8 A;  1U9X A;  1ITO A;  2E03 A;  5CVO B;  1MHW A;  3N3G A;  2YJ2 A;  1F2A A;  3QJ3 A;  2VHF A;  2DCD A;  1GMY A;  3BPM A;  3IUT A;  4P6G A;  6PAD A;  3P5U A;  1EWO A;  2OZ2 A;  3H7D A;  3WXE A;  4FJC A;  1NPZ A;  3P5V A;  1CS8 A;  1MIR A;  1PXV A;  5CVM A;  3HD3 A;  4YYQ A;  2XU5 A;  1KFX L;  1PE6 A;  1Q6K A;  1AYW A;  4W5B A;  5JH3 A;  1ME3 A;  3BC3 A;  5EF4 A;  3GCB A;  1NQC A;  4I05 A;  3KWZ A;  1GLO A;  1YVB A;  9PAP A;  2G8J A;  4PP1 A;  3OIS A;  4QRX A;  4MZS A;  1YT7 A;  5EGW A;  2B1N A;  4DMX A;  2XU1 A;  2AU1 A;  3USV A;  4CDF B; 
#chains in the Genus database with same CATH topology
 1GEC E;  2FYE A;  2F7D A;  2FE8 A;  2BDL A;  2NQI A;  4PP2 E;  1F29 A;  3ERV A;  4P16 A;  4BOZ A;  4D8B A;  3MTV A;  1PBH A;  3CBJ A;  3IV2 A;  3PRP A;  1KXR A;  4N79 A;  1ZIV A;  4QBB A;  4ZTB A;  4QH6 A;  1F2C A;  1YK7 A;  3BPF A;  3KKU A;  4Q8G A;  4YYV A;  2DC9 A;  2IPP B;  1U9W A;  3HHA A;  4YYR A;  1KHP A;  1CPJ A;  1VJV A;  2JRI A;  3QSD A;  5CHV A;  1MDW A;  3KWB X;  2YJB A;  3F75 A;  3ZUA A;  1NL6 A;  3LFY A;  2FRQ A;  2DC6 A;  3WXG A;  5A24 A;  4FIP A;  1DF0 A;  4CDE B;  2XU4 A;  3IEJ A;  2ARY A;  1TL9 A;  3CH2 X;  2DCA A;  4RNA A;  2DC7 A;  1YK8 A;  1PAD A;  4MI7 A;  2AVW A;  2PAD A;  1ME4 A;  3H89 A;  1POP A;  3N3K A;  1AYU A;  4RY2 A;  1UKF A;  5FPW A;  2HHN A;  4BOP A;  2DJG B;  1EWL A;  3S3R A;  2YJ9 A;  1NB3 A;  2CB5 A;  3H6S A;  2FQ9 A;  1BP4 A;  3IOQ A;  4P6E A;  5E6J A;  3PT2 A;  4WUR A;  3MHS A;  3KW9 A;  1SNK A;  3CH3 X;  3PRM A;  2R9O A;  4I07 A;  1QDQ A;  2BTW A;  4A5U A;  3U8E A;  1O0E A;  2B1M A;  1SP4 B;  3K9M A;  3MHH A;  3P5W A;  1U5I A;  2C0Y A;  2GHU A;  2R9M A;  3AI8 A;  3MJ5 A;  3C9E A;  4RKX A;  2AIM A;  2F1G A;  2DZY A;  3PHX A;  3IHP A;  1QOL A;  3H8B A;  2DC8 A;  4REZ A;  4XZX A;  1F2B A;  1Y08 A;  3O1G A;  3ZNH A;  3HHI A;  3BY4 A;  2DOS A;  4X6I A;  3I06 A;  1XKG A;  2G7Y A;  1CSB B;  3MOR A;  4BOS A;  3N4C A;  3B21 A;  4OEM A;  3K8U A;  2XU3 A;  2DJF B;  1CQD A;  2BTW B;  2PNS A;  8PCH A;  2HXZ A;  1X9Y A;  4QRG A;  1AYV A;  1M6D A;  5K16 A;  3W30 A;  2FUD A;  7PCK A;  2J7Q C;  1PCI A;  1STF E;  3D6S A;  3LXS A;  1EWM A;  2O6X A;  2NQG A;  1MEG A;  4CZW A;  2AUX A;  5CHT A;  4MZO A;  3C0R A;  1BQI A;  3RNV A;  3E1Z B;  1AU0 A;  1DEU A;  2IBI A;  3M99 A;  5EZS A;  2FRA A;  3RVX A;  3PHU A;  2PRE A;  3OQC A;  1EF7 A;  2H7J A;  4BQV A;  4DMY A;  3PNR A;  4XR7 A;  4YV8 A;  3WXF A;  3KX1 A;  4BS5 A;  1JQP A;  3OVX A;  1S4V A;  1CJL A;  1IWD A;  3BOW A;  1PIP A;  3V6C A;  2FTD A;  1U9V A;  2JQF R;  2R9C A;  1EWP A;  1NB5 A;  4QRV A;  1Y4H A;  2NQD B;  4YVA A;  3H8C A;  1QMY A;  4HXD B;  3F5V A;  3BWK A;  4W4U A;  5EZQ A;  1HUC B;  2BU3 A;  2CIO A;  2ACT A;  2BDZ A;  3KSE A;  2DCC A;  3TNX A;  3MTN A;  1BGO A;  4WA6 A;  2Y6E A;  1DKI A;  3QT4 A;  3BBA A;  2DZZ A;  4MSX A;  1YZB A;  3IFU A;  4RF1 A;  2FO5 A;  1MS6 A;  4ZUX U;  4W5C A;  3PBH A;  2JTC A;  2AYO A;  2PBH A;  2VHS A;  3CBK A;  3PDF A;  5CVN B;  1AEC A;  4RF0 A;  4OW0 A;  5PAD A;  2NQA A;  2ATO A;  4X6H A;  4X6J A;  1YAL A;  1PPD A;  3V6E A;  4HWY A;  4IP3 A;  2E01 A;  4N8W A;  4BOU A;  3IMA A;  4D8I A;  4PI3 A;  3W31 A;  2R6N A;  2HD5 A;  1ATK A;  4OVZ B;  3MP2 A;  3BCN A;  1CB5 A;  1QXP A;  1ICF A;  2GFO A;  3E9S A;  4YYW A;  3K24 A;  1AU2 A;  1PPO A;  5F02 A;  2Z84 A;  4I04 A;  3B79 A;  1THE A;  1NLJ A;  4PAD A;  4PT5 A;  5J94 A;  3P5X A;  3OF9 A;  1AU4 A;  1VSN A;  1ZCM A;  2P7U A;  3O65 A;  2FT2 A;  1TU6 A;  4D8E A;  1KHQ A;  3KFQ A;  1GCB A;  4BPV A;  4BSQ A;  2WBF X;  2OUL A;  1CTE A;  2OP3 A;  2R9F A;  1BY8 A;  4KLB A;  1PPP A;  4XUI A;  1PVJ A;  4M0W A;  3PHW A;  3PSE A;  1CVZ A;  5KO3 A;  3OF8 A;  4OEL A;  4YYS A;  1TLO A;  1A6R A;  4YYU A;  2Y5B A;  1AIM A;  4CDD B;  2G6D A;  4FK5 A;  3HWN A;  2E00 A;  2AGA A;  4K7C A;  1PPN A;  4CDC B;  4AXL A;  1K3B B;  2AS8 A;  5JA7 A;  2E02 A;  2JQG R;  3S3Q A;  2P86 A;  2G8E A;  2YJC A;  2AYN A;  1MEM A;  2AUZ A;  3O0U A;  2P0R A;  3DF0 A;  2J7Q A;  2DCB A;  1U9Q X;  4AXM A;  3NHE A;  3BB7 A;  4N4Z A;  3RVV A;  2R9N A;  3OVZ A;  1KFU L;  2HH5 A;  1CV8 A;  3PW3 A;  1AU3 A;  4G54 A;  4BS6 A;  4Q8H A;  3I3T A;  3RVW A;  1FH0 A;  2YJ8 A;  1U9X A;  1ITO A;  2E03 A;  5CVO B;  1MHW A;  3N3G A;  4OVZ A;  2UZJ A;  2YJ2 A;  1F2A A;  3QJ3 A;  2VHF A;  3TRK A;  2DCD A;  1GMY A;  4MM3 B;  3BPM A;  3TMP A;  3IUT A;  4P6G A;  6PAD A;  3P5U A;  1EWO A;  2OZ2 A;  3H7D A;  4GUA A;  5JZE A;  3WXE A;  4FJC A;  1NPZ A;  2HWK A;  3P5V A;  1CS8 A;  1MIR A;  1PXV A;  5CVM A;  3HD3 A;  4YYQ A;  2XU5 A;  1KFX L;  1PE6 A;  1Q6K A;  1AYW A;  4W5B A;  5JH3 A;  1ME3 A;  3BC3 A;  4IUM A;  5EF4 A;  3GCB A;  1NQC A;  4R3D A;  4I05 A;  3KWZ A;  1GLO A;  1YVB A;  9PAP A;  2G8J A;  4PP1 A;  3OIS A;  4QRX A;  4MZS A;  1YT7 A;  5EGW A;  2B1N A;  4DMX A;  2XU1 A;  2AU1 A;  3USV A;  4BOQ A;  4CDF B; 
#chains in the Genus database with same CATH homology
 1GEC E;  2FYE A;  2F7D A;  2BDL A;  2NQI A;  4PP2 E;  1F29 A;  3ERV A;  1PBH A;  3CBJ A;  3IV2 A;  4B55 A;  1KXR A;  4N79 A;  1ZIV A;  4QBB A;  4QH6 A;  1F2C A;  1YK7 A;  3BPF A;  3KKU A;  4Q8G A;  4YYV A;  2DC9 A;  2IPP B;  1U9W A;  3HHA A;  4YYR A;  1KHP A;  1CPJ A;  1VJV A;  3QSD A;  5CHV A;  1MDW A;  3KWB X;  2YJB A;  3F75 A;  3ZUA A;  1NL6 A;  3LFY A;  2FRQ A;  2DC6 A;  3WXG A;  4NV8 A;  5A24 A;  4FIP A;  1DF0 A;  4CDE B;  2XU4 A;  3IEJ A;  2ARY A;  1TL9 A;  3CH2 X;  2DCA A;  2DC7 A;  1YK8 A;  1PAD A;  1W5R A;  2AVW A;  2PAD A;  1ME4 A;  3H89 A;  1POP A;  3N3K A;  1AYU A;  4RY2 A;  5FPW A;  2HHN A;  2DJG B;  1EWL A;  3S3R A;  2YJ9 A;  1NB3 A;  2CB5 A;  3H6S A;  2FQ9 A;  1BP4 A;  3IOQ A;  4P6E A;  3MHS A;  3KW9 A;  1SNK A;  3CH3 X;  2R9O A;  4I07 A;  1QDQ A;  3U8E A;  1W4T A;  1O0E A;  2B1M A;  1SP4 B;  3K9M A;  3MHH A;  3P5W A;  1U5I A;  2C0Y A;  2GHU A;  2R9M A;  3AI8 A;  3C9E A;  2AIM A;  2F1G A;  2DZY A;  3IHP A;  1QOL A;  3H8B A;  2DC8 A;  1F2B A;  1Y08 A;  3O1G A;  3HHI A;  4X6I A;  3I06 A;  1XKG A;  2G7Y A;  1CSB B;  3MOR A;  3N4C A;  4OEM A;  3K8U A;  2XU3 A;  2DJF B;  1CQD A;  2PNS A;  8PCH A;  2HXZ A;  1X9Y A;  4QRG A;  1AYV A;  1M6D A;  5K16 A;  2FUD A;  7PCK A;  1PCI A;  1STF E;  3D6S A;  3LXS A;  1W6F A;  1EWM A;  2O6X A;  4BGF A;  2NQG A;  1MEG A;  4CZW A;  2AUX A;  5CHT A;  4MZO A;  1BQI A;  3E1Z B;  1AU0 A;  1DEU A;  2IBI A;  3M99 A;  2FRA A;  3RVX A;  2PRE A;  1EF7 A;  2H7J A;  4BQV A;  4DMY A;  3PNR A;  4XR7 A;  4YV8 A;  3WXF A;  3KX1 A;  4BS5 A;  1JQP A;  3OVX A;  1S4V A;  1CJL A;  1IWD A;  3BOW A;  1PIP A;  3V6C A;  2FTD A;  1U9V A;  2JQF R;  2R9C A;  1EWP A;  1NB5 A;  4QRV A;  1Y4H A;  2NQD B;  4YVA A;  3H8C A;  1QMY A;  3F5V A;  3BWK A;  4W4U A;  1HUC B;  2CIO A;  2ACT A;  2BDZ A;  3KSE A;  2DCC A;  3TNX A;  3MTN A;  1BGO A;  4WA6 A;  2Y6E A;  3QT4 A;  2DZZ A;  2VFC A;  4MSX A;  2FO5 A;  1MS6 A;  4ZUX U;  4W5C A;  3PBH A;  1GX3 A;  2AYO A;  2PBH A;  2VHS A;  3CBK A;  3PDF A;  5CVN B;  1AEC A;  5PAD A;  2NQA A;  2ATO A;  4X6H A;  4X6J A;  1YAL A;  4GUZ A;  1PPD A;  3V6E A;  4HWY A;  2E01 A;  4N8W A;  3IMA A;  4PI3 A;  2R6N A;  2HD5 A;  1ATK A;  3BCN A;  1CB5 A;  1QXP A;  1ICF A;  2GFO A;  4YYW A;  3K24 A;  1AU2 A;  1PPO A;  5F02 A;  4I04 A;  3B79 A;  1THE A;  1NLJ A;  4PAD A;  5J94 A;  3P5X A;  3OF9 A;  1AU4 A;  1VSN A;  1ZCM A;  2P7U A;  2FT2 A;  1TU6 A;  1KHQ A;  3KFQ A;  1GCB A;  4BPV A;  4BSQ A;  4C5P A;  2WBF X;  2OUL A;  1CTE A;  2OP3 A;  2R9F A;  1BY8 A;  4KLB A;  1PPP A;  4XUI A;  4NV7 A;  1CVZ A;  3OF8 A;  4OEL A;  4YYS A;  1TLO A;  1A6R A;  4YYU A;  2Y5B A;  1AIM A;  4CDD B;  2G6D A;  4FK5 A;  3HWN A;  2E00 A;  4K7C A;  1PPN A;  4CDC B;  4AXL A;  1K3B B;  2AS8 A;  5JA7 A;  2E02 A;  2JQG R;  3S3Q A;  2P86 A;  2G8E A;  2YJC A;  2AYN A;  1MEM A;  2AUZ A;  3O0U A;  2P0R A;  3DF0 A;  2DCB A;  1U9Q X;  3D9W A;  4AXM A;  3NHE A;  4N4Z A;  2VFB A;  3RVV A;  2R9N A;  3OVZ A;  1KFU L;  2HH5 A;  1CV8 A;  3PW3 A;  1AU3 A;  4G54 A;  4BS6 A;  4Q8H A;  3I3T A;  3RVW A;  1FH0 A;  2YJ8 A;  1U9X A;  1ITO A;  1E2T A;  2E03 A;  5CVO B;  1MHW A;  3N3G A;  2YJ2 A;  1F2A A;  3QJ3 A;  2VHF A;  2DCD A;  1GMY A;  3BPM A;  3IUT A;  4P6G A;  6PAD A;  3P5U A;  1EWO A;  2OZ2 A;  3H7D A;  3WXE A;  4FJC A;  1NPZ A;  3P5V A;  1CS8 A;  1MIR A;  1PXV A;  5CVM A;  3HD3 A;  4YYQ A;  2XU5 A;  1KFX L;  1PE6 A;  1Q6K A;  1AYW A;  4W5B A;  5JH3 A;  1ME3 A;  3BC3 A;  5EF4 A;  3GCB A;  1NQC A;  2BSZ A;  4I05 A;  3KWZ A;  1GLO A;  3LTW A;  1YVB A;  9PAP A;  2G8J A;  4PP1 A;  3OIS A;  4QRX A;  4MZS A;  1YT7 A;  5EGW A;  2B1N A;  4DMX A;  2XU1 A;  2AU1 A;  3USV A;  4CDF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...