1NL6A

Crystal structure of the cysteine protease human cathepsin k in complex with a covalent azepanone inhibitor
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin K
publication title Azepanone-based inhibitors of human and rat cathepsin K
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 54
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2003-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1nl6A00
4MSXA 4QRVA 8PCHA 4BS5A 2IPPB 4PADA 1ME4A 4FIPA 4DMYA 2BDZA 1TU6A 2FQ9A 6PADA 3BPMA 1KFXL 2Y5BA 2E03A 1AU3A 1AYUA 3WXFA 1VJVA 4PI3A 4HWYA 3HD3A 3IUTA 1MEGA 2FO5A 1BP4A 4P6GA 3OVZA 2DC9A 2ARYA 3I06A 1PBHA 3H6SA 3RVXA 1CPJA 2E00A 1PPDA 1AU2A 4QH6A 1AYWA 1NPZA 4YV8A 1VSNA 4YYRA 1F2AA 1PPNA 1KXRA 3F75A 3OISA 2NQIA 4AXMA 3IOQA 1QMYA 1PCIA 2DCAA 1CVZA 2PADA 1SP4B 2JQGR 3KW9A 1MIRA 3U8EA 2VHSA 4FK5A 4X6JA 3OF8A 4X6IA 4X6HA 4MZOA 5K16A 4G54A 3OVXA 4AXLA 1U9XA 2PBHA 1Y08A 2FT2A 2DZZA 2AYNA 2AU1A 2HXZA 1GLOA 2Y6EA 4CDCB 2P0RA 2DCCA 3H8CA 3V6CA 1BY8A 1CV8A 4PP2E 3CH3X 1SNKA 1U9VA 2E01A 3PNRA 1PXVA 3KWBX 3OF9A 4Q8GA 1X9YA 4I07A 2GFOA 3QJ3A 3AI8A 3KSEA 4W4UA 4BQVA 2PNSA 4OELA 1YT7A 3P5VA 1GMYA 4W5BA 4YYSA 4QBBA 1NL6A 1PADA 2PREA 2FRQA 1CB5A 4P6EA 3BC3A 3F5VA 2NQGA 2DCBA 2IBIA 1EWMA 5JA7A 4CDEB 4K7CA 4MZSA 2G6DA 4PP1A 5EF4A 3S3RA 2P7UA 1QXPA 2BDLA 1M6DA 1GECE 5CVOB 4I04A 3BCNA 1PPOA 4CZWA 2WBFX 3P5UA 2F7DA 2AUZA 1ICFA 1ME3A 1NB3A 3P5WA 3K24A 1TL9A 3CBJA 5A24A 2AIMA 1DEUA 2R9OA 2ATOA 2FUDA 1NLJA 2G8JA 2AYOA 5FPWA 3K8UA 3PDFA 1F29A 1DF0A 1Q6KA 3BWKA 1U9WA 2E02A 3BPFA 3QT4A 2B1MA 3QSDA 3MHSA 1AIMA 1HUCB 9PAPA 4YYUA 1IWDA 1GCBA 1JQPA 1ZIVA 3HHIA 4N8WA 1NQCA 1MDWA 3B79A 2OZ2A 1TLOA 1F2BA 2R9MA 3PBHA 1EF7A 4BSQA 3N4CA 1BQIA 2O6XA 2CB5A 2DC8A 4I05A 2YJ2A 3O1GA 3WXGA 2JQFR 2HH5A 1AU0A 1PPPA 1KFUL 2G7YA 3ERVA 2OULA 3IV2A 4N4ZA 3KWZA 4CDDB 4YYWA 4QRGA 3V6EA 1A6RA 1BGOA 1XKGA 2YJ8A 3WXEA 2AUXA 1KHQA 4BS6A 1EWLA 3N3GA 4OEMA 4XUIA 3E1ZB 1PIPA 2NQAA 1THEA 3ZUAA 2R9NA 4KLBA 4XR7A 2R9CA 4CDFB 2DZYA 1ZCMA 3RVVA 1AECA 3D6SA 1YK8A 4ZUXU 3N3KA 5CVMA 3CBKA 2YJCA 4RY2A 1MHWA 3IEJA 3I3TA 5F02A 3NHEA 1STFE 1EWPA 2G8EA 3KX1A 1AU4A 1CTEA 3MHHA 1YALA 1YVBA 2AS8A 2GHUA 1POPA 2HD5A 2P86A 1NB5A 3MORA 1Y4HA 3KFQA 3DF0A 3PW3A 2H7JA 1K3BB 2NQDB 3TNXA 1S4VA 5CHTA 1KHPA 4YVAA 2YJBA 4W5CA 1O0EA 5CHVA 2C0YA 5EGWA 4WA6A 2YJ9A 2XU1A 1QDQA 3BOWA 2FRAA 1CJLA 2DC6A 3P5XA 3LXSA 1F2CA 4DMXA 3MTNA 2R9FA 5PADA 1CQDA 3M99A 4Q8HA 2FTDA 3RVWA 5CVNB 3KKUA 1FH0A 1U9QX 3HWNA 5JH3A 1ATKA 3CH2X 1U5IA 3K9MA 1ITOA 2OP3A 2HHNA 3O0UA 4YYVA 1MS6A 2DC7A 2F1GA 2R6NA 2CIOA 3C9EA 3USVA 4YYQA 3S3QA 3H89A 2AVWA 2ACTA 1CS8A 4QRXA 7PCKA 2XU5A 1QOLA 3H8BA 2FYEA 4BPVA 1PE6A 3LFYA 3GCBA 4FJCA 1EWOA 1AYVA 3H7DA 4N79A 1YK7A 5J94A 2DJGB 3IHPA 2XU4A 3IMAA 1MEMA 2VHFA 1CSBB 2B1NA 2DJFB 2XU3A 3HHAA 2DCDA
chains in the Genus database with same CATH superfamily
4MSXA 4QRVA 8PCHA 4BS5A 2IPPB 3PHUA 4PADA 2BTWB 1ME4A 4FIPA 4DMYA 2BDZA 1TU6A 2FQ9A 6PADA 3BPMA 1KFXL 2Y5BA 4D8EA 4OVZB 2E03A 1AU3A 1AYUA 3WXFA 1VJVA 1DKIA 4PI3A 4BOQA 4HWYA 3HD3A 3IUTA 1MEGA 2FO5A 1BP4A 3W31A 4P6GA 2DOSA 3OVZA 2DC9A 2ARYA 3I06A 1PBHA 3BB7A 3H6SA 3PHXA 3RVXA 1CPJA 2E00A 1PPDA 1AU2A 4BOSA 4QH6A 1AYWA 1NPZA 4YV8A 2Z84A 1VSNA 4YYRA 3MP2A 2J7QC 1F2AA 1PPNA 1KXRA 3F75A 3OISA 2NQIA 4AXMA 3IOQA 1QMYA 3PSEA 1PCIA 2DCAA 1CVZA 2PADA 1SP4B 2JQGR 3KW9A 1MIRA 3U8EA 2VHSA 4FK5A 4X6JA 1YZBA 3OF8A 4X6IA 4X6HA 4MZOA 5K16A 4G54A 3OVXA 2HWKA 3C0RA 4WURA 4AXLA 1U9XA 2PBHA 4REZA 1Y08A 2FT2A 3BY4A 2DZZA 2AYNA 2AU1A 2HXZA 1GLOA 2Y6EA 4CDCB 2P0RA 2DCCA 3PRPA 3H8CA 3V6CA 2UZJA 1BY8A 3PT2A 1CV8A 4PP2E 3CH3X 1SNKA 1U9VA 3E9SA 3BBAA 2E01A 2BU3A 4RF0A 3PNRA 1PXVA 3KWBX 3OF9A 4Q8GA 1X9YA 3IFUA 4I07A 4XZXA 2GFOA 3QJ3A 3AI8A 3KSEA 4W4UA 5EZQA 4BQVA 2PNSA 4OELA 1YT7A 3P5VA 4R3DA 1GMYA 4W5BA 4YYSA 4QBBA 1NL6A 1PADA 2PREA 2FRQA 1CB5A 4P6EA 3BC3A 3F5VA 2NQGA 1UKFA 2DCBA 2IBIA 1EWMA 5JA7A 4CDEB 4PT5A 4K7CA 4MZSA 2G6DA 4PP1A 5EF4A 3S3RA 2P7UA 4IP3A 1QXPA 2BDLA 1PVJA 3ZNHA 1M6DA 1GECE 5CVOB 4I04A 3BCNA 1PPOA 4CZWA 2WBFX 3P5UA 5EZSA 2F7DA 2AUZA 1ICFA 1ME3A 1NB3A 3P5WA 4BOUA 3K24A 1TL9A 3CBJA 5A24A 2AIMA 1DEUA 2R9OA 2ATOA 2FUDA 1NLJA 2G8JA 2AYOA 5FPWA 4RNAA 3K8UA 3PDFA 1F29A 1DF0A 1Q6KA 3BWKA 1U9WA 2E02A 3BPFA 3QT4A 2B1MA 3QSDA 3MHSA 1AIMA 1HUCB 9PAPA 4YYUA 1IWDA 1GCBA 1JQPA 1ZIVA 3HHIA 4N8WA 1NQCA 1MDWA 3B79A 3OQCA 2OZ2A 3RNVA 1TLOA 1F2BA 2R9MA 3PBHA 1EF7A 4BSQA 3N4CA 1BQIA 2O6XA 2CB5A 2DC8A 4I05A 2YJ2A 3O1GA 3WXGA 2JQFR 2HH5A 1AU0A 1PPPA 1KFUL 2G7YA 3ERVA 2OULA 4P16A 3IV2A 4N4ZA 3KWZA 4CDDB 4YYWA 4QRGA 3V6EA 1A6RA 1BGOA 1XKGA 2YJ8A 5E6JA 3W30A 3WXEA 2AUXA 4MI7A 1KHQA 4BS6A 1EWLA 4IUMA 3N3GA 4MM3B 4OEMA 4XUIA 4D8IA 3B21A 3E1ZB 1PIPA 2AGAA 4ZTBA 4A5UA 4GUAA 2NQAA 3PRMA 1THEA 3ZUAA 2R9NA 4KLBA 4XR7A 2R9CA 4CDFB 2DZYA 1ZCMA 3RVVA 1AECA 2JRIA 3D6SA 4HXDB 1YK8A 4ZUXU 3N3KA 5CVMA 3CBKA 2YJCA 4RY2A 1MHWA 3IEJA 3I3TA 5F02A 3TRKA 3NHEA 4RKXA 1STFE 1EWPA 2G8EA 3KX1A 1AU4A 1CTEA 3MHHA 1YALA 1YVBA 2AS8A 2GHUA 4RF1A 1POPA 2HD5A 2P86A 1NB5A 3MORA 4BOZA 1Y4HA 3KFQA 3DF0A 3PW3A 2H7JA 3MJ5A 1K3BB 2NQDB 3TNXA 4BOPA 1S4VA 5CHTA 1KHPA 4YVAA 2YJBA 3MTVA 4W5CA 1O0EA 5CHVA 2C0YA 5EGWA 4WA6A 2YJ9A 2XU1A 4OW0A 1QDQA 3BOWA 2FRAA 1CJLA 2DC6A 3P5XA 3LXSA 1F2CA 4DMXA 3MTNA 2R9FA 5PADA 5JZEA 1CQDA 3M99A 4Q8HA 2FTDA 3TMPA 3RVWA 5CVNB 3KKUA 1FH0A 1U9QX 3HWNA 5JH3A 2J7QA 1ATKA 3CH2X 1U5IA 3K9MA 1ITOA 2OP3A 3O65A 2HHNA 3O0UA 4YYVA 1MS6A 2DC7A 2F1GA 2R6NA 2CIOA 4D8BA 3C9EA 3USVA 2BTWA 4YYQA 3S3QA 3H89A 2AVWA 2ACTA 1CS8A 4QRXA 7PCKA 2XU5A 1QOLA 2FE8A 3H8BA 5KO3A 2FYEA 4BPVA 3PHWA 4OVZA 1PE6A 3LFYA 3GCBA 4M0WA 4FJCA 1EWOA 1AYVA 3H7DA 2JTCA 4N79A 1YK7A 5J94A 2DJGB 3IHPA 2XU4A 3IMAA 1MEMA 2VHFA 1CSBB 2B1NA 2DJFB 2XU3A 3HHAA 2DCDA
chains in the Genus database with same CATH topology
4MSXA 4QRVA 8PCHA 4BS5A 2IPPB 4PADA 1ME4A 4FIPA 4DMYA 2BDZA 1TU6A 2FQ9A 4C5PA 3BPMA 6PADA 3D9WA 1KFXL 2Y5BA 2E03A 1AU3A 1AYUA 3WXFA 1VJVA 4PI3A 4HWYA 3HD3A 3IUTA 1MEGA 2FO5A 1BP4A 4P6GA 4BGFA 3OVZA 2DC9A 2ARYA 3I06A 1PBHA 3H6SA 3RVXA 1CPJA 2E00A 1PPDA 1AU2A 4QH6A 1AYWA 1NPZA 4YV8A 1VSNA 4YYRA 1F2AA 1PPNA 1KXRA 3F75A 3OISA 1W4TA 4NV7A 2NQIA 4AXMA 3IOQA 1QMYA 1PCIA 2DCAA 1CVZA 2PADA 1SP4B 2JQGR 3KW9A 1MIRA 3U8EA 2VHSA 4FK5A 4X6JA 3OF8A 4X6IA 4X6HA 4MZOA 5K16A 4G54A 3OVXA 4AXLA 1U9XA 2PBHA 1Y08A 2FT2A 2DZZA 2AYNA 2AU1A 2HXZA 1GLOA 2Y6EA 4CDCB 2P0RA 2DCCA 3H8CA 3V6CA 1BY8A 1CV8A 4PP2E 3CH3X 1SNKA 1U9VA 2E01A 3PNRA 4B55A 1PXVA 3KWBX 3OF9A 4Q8GA 1X9YA 4I07A 2GFOA 3QJ3A 3AI8A 3KSEA 4W4UA 4BQVA 2PNSA 4OELA 1YT7A 3P5VA 1GMYA 4W5BA 4YYSA 4QBBA 1NL6A 1PADA 2PREA 2FRQA 1CB5A 4P6EA 3LTWA 3BC3A 3F5VA 2NQGA 2DCBA 2IBIA 1EWMA 5JA7A 4CDEB 4K7CA 4MZSA 2G6DA 4PP1A 5EF4A 3S3RA 2P7UA 1QXPA 2BDLA 1M6DA 1GECE 5CVOB 4I04A 3BCNA 1PPOA 4CZWA 2WBFX 3P5UA 2F7DA 2AUZA 1ICFA 1ME3A 1NB3A 3P5WA 2BSZA 3K24A 1TL9A 3CBJA 5A24A 2AIMA 1DEUA 2R9OA 2ATOA 2FUDA 1NLJA 2VFBA 2G8JA 2AYOA 5FPWA 3K8UA 3PDFA 1F29A 1DF0A 1Q6KA 3BWKA 1GX3A 1U9WA 2E02A 3BPFA 3QT4A 2B1MA 3QSDA 3MHSA 1AIMA 1HUCB 9PAPA 4YYUA 1IWDA 1GCBA 1JQPA 1ZIVA 3HHIA 4N8WA 1NQCA 1MDWA 3B79A 2OZ2A 1E2TA 1TLOA 1F2BA 2R9MA 3PBHA 1EF7A 4BSQA 3N4CA 1BQIA 2O6XA 2CB5A 2DC8A 4I05A 2YJ2A 3O1GA 3WXGA 2JQFR 2HH5A 1AU0A 1PPPA 1KFUL 2G7YA 3ERVA 2OULA 4GUZA 3IV2A 4N4ZA 3KWZA 4CDDB 4YYWA 4QRGA 3V6EA 1A6RA 1BGOA 1XKGA 2YJ8A 3WXEA 2AUXA 1KHQA 4BS6A 1EWLA 3N3GA 4OEMA 4XUIA 3E1ZB 1PIPA 4NV8A 2NQAA 1THEA 3ZUAA 2R9NA 4KLBA 4XR7A 2R9CA 4CDFB 2DZYA 1ZCMA 3RVVA 1AECA 3D6SA 1YK8A 4ZUXU 3N3KA 5CVMA 3CBKA 2YJCA 4RY2A 1MHWA 3IEJA 3I3TA 5F02A 3NHEA 1STFE 1EWPA 2G8EA 3KX1A 1AU4A 1CTEA 3MHHA 1YALA 1YVBA 2AS8A 2GHUA 1POPA 2HD5A 2P86A 1NB5A 3MORA 1Y4HA 3KFQA 3DF0A 3PW3A 2H7JA 1K3BB 2NQDB 3TNXA 1S4VA 5CHTA 1KHPA 4YVAA 2YJBA 4W5CA 1O0EA 5CHVA 2C0YA 5EGWA 4WA6A 2YJ9A 2XU1A 1QDQA 3BOWA 2FRAA 1CJLA 2DC6A 3P5XA 3LXSA 1F2CA 4DMXA 3MTNA 2R9FA 5PADA 1CQDA 3M99A 4Q8HA 1W6FA 2FTDA 3RVWA 5CVNB 3KKUA 1FH0A 1U9QX 3HWNA 5JH3A 1ATKA 3CH2X 1U5IA 3K9MA 1ITOA 2OP3A 2HHNA 3O0UA 4YYVA 1MS6A 2DC7A 2F1GA 2R6NA 2CIOA 1W5RA 3C9EA 2VFCA 3USVA 4YYQA 3S3QA 3H89A 2AVWA 2ACTA 1CS8A 4QRXA 7PCKA 2XU5A 1QOLA 3H8BA 2FYEA 4BPVA 1PE6A 3LFYA 3GCBA 4FJCA 1EWOA 1AYVA 3H7DA 4N79A 1YK7A 5J94A 2DJGB 3IHPA 2XU4A 3IMAA 1MEMA 2VHFA 1CSBB 2B1NA 2DJFB 2XU3A 3HHAA 2DCDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MSX A;  4QRV A;  8PCH A;  4BS5 A;  2IPP B;  4PAD A;  1ME4 A;  4FIP A;  4DMY A;  2BDZ A;  1TU6 A;  2FQ9 A;  6PAD A;  3BPM A;  1KFX L;  2Y5B A;  2E03 A;  1AU3 A;  1AYU A;  3WXF A;  1VJV A;  4PI3 A;  4HWY A;  3HD3 A;  3IUT A;  1MEG A;  2FO5 A;  1BP4 A;  4P6G A;  3OVZ A;  2DC9 A;  2ARY A;  3I06 A;  1PBH A;  3H6S A;  3RVX A;  1CPJ A;  2E00 A;  1PPD A;  1AU2 A;  4QH6 A;  1AYW A;  1NPZ A;  4YV8 A;  1VSN A;  4YYR A;  1F2A A;  1PPN A;  1KXR A;  3F75 A;  3OIS A;  2NQI A;  4AXM A;  3IOQ A;  1QMY A;  1PCI A;  2DCA A;  1CVZ A;  2PAD A;  1SP4 B;  2JQG R;  3KW9 A;  1MIR A;  3U8E A;  2VHS A;  4FK5 A;  4X6J A;  3OF8 A;  4X6I A;  4X6H A;  4MZO A;  5K16 A;  4G54 A;  3OVX A;  4AXL A;  1U9X A;  2PBH A;  1Y08 A;  2FT2 A;  2DZZ A;  2AYN A;  2AU1 A;  2HXZ A;  1GLO A;  2Y6E A;  4CDC B;  2P0R A;  2DCC A;  3H8C A;  3V6C A;  1BY8 A;  1CV8 A;  4PP2 E;  3CH3 X;  1SNK A;  1U9V A;  2E01 A;  3PNR A;  1PXV A;  3KWB X;  3OF9 A;  4Q8G A;  1X9Y A;  4I07 A;  2GFO A;  3QJ3 A;  3AI8 A;  3KSE A;  4W4U A;  4BQV A;  2PNS A;  4OEL A;  1YT7 A;  3P5V A;  1GMY A;  4W5B A;  4YYS A;  4QBB A;  1NL6 A;  1PAD A;  2PRE A;  2FRQ A;  1CB5 A;  4P6E A;  3BC3 A;  3F5V A;  2NQG A;  2DCB A;  2IBI A;  1EWM A;  5JA7 A;  4CDE B;  4K7C A;  4MZS A;  2G6D A;  4PP1 A;  5EF4 A;  3S3R A;  2P7U A;  1QXP A;  2BDL A;  1M6D A;  1GEC E;  5CVO B;  4I04 A;  3BCN A;  1PPO A;  4CZW A;  2WBF X;  3P5U A;  2F7D A;  2AUZ A;  1ICF A;  1ME3 A;  1NB3 A;  3P5W A;  3K24 A;  1TL9 A;  3CBJ A;  5A24 A;  2AIM A;  1DEU A;  2R9O A;  2ATO A;  2FUD A;  1NLJ A;  2G8J A;  2AYO A;  5FPW A;  3K8U A;  3PDF A;  1F29 A;  1DF0 A;  1Q6K A;  3BWK A;  1U9W A;  2E02 A;  3BPF A;  3QT4 A;  2B1M A;  3QSD A;  3MHS A;  1AIM A;  1HUC B;  9PAP A;  4YYU A;  1IWD A;  1GCB A;  1JQP A;  1ZIV A;  3HHI A;  4N8W A;  1NQC A;  1MDW A;  3B79 A;  2OZ2 A;  1TLO A;  1F2B A;  2R9M A;  3PBH A;  1EF7 A;  4BSQ A;  3N4C A;  1BQI A;  2O6X A;  2CB5 A;  2DC8 A;  4I05 A;  2YJ2 A;  3O1G A;  3WXG A;  2JQF R;  2HH5 A;  1AU0 A;  1PPP A;  1KFU L;  2G7Y A;  3ERV A;  2OUL A;  3IV2 A;  4N4Z A;  3KWZ A;  4CDD B;  4YYW A;  4QRG A;  3V6E A;  1A6R A;  1BGO A;  1XKG A;  2YJ8 A;  3WXE A;  2AUX A;  1KHQ A;  4BS6 A;  1EWL A;  3N3G A;  4OEM A;  4XUI A;  3E1Z B;  1PIP A;  2NQA A;  1THE A;  3ZUA A;  2R9N A;  4KLB A;  4XR7 A;  2R9C A;  4CDF B;  2DZY A;  1ZCM A;  3RVV A;  1AEC A;  3D6S A;  1YK8 A;  4ZUX U;  3N3K A;  5CVM A;  3CBK A;  2YJC A;  4RY2 A;  1MHW A;  3IEJ A;  3I3T A;  5F02 A;  3NHE A;  1STF E;  1EWP A;  2G8E A;  3KX1 A;  1AU4 A;  1CTE A;  3MHH A;  1YAL A;  1YVB A;  2AS8 A;  2GHU A;  1POP A;  2HD5 A;  2P86 A;  1NB5 A;  3MOR A;  1Y4H A;  3KFQ A;  3DF0 A;  3PW3 A;  2H7J A;  1K3B B;  2NQD B;  3TNX A;  1S4V A;  5CHT A;  1KHP A;  4YVA A;  2YJB A;  4W5C A;  1O0E A;  5CHV A;  2C0Y A;  5EGW A;  4WA6 A;  2YJ9 A;  2XU1 A;  1QDQ A;  3BOW A;  2FRA A;  1CJL A;  2DC6 A;  3P5X A;  3LXS A;  1F2C A;  4DMX A;  3MTN A;  2R9F A;  5PAD A;  1CQD A;  3M99 A;  4Q8H A;  2FTD A;  3RVW A;  5CVN B;  3KKU A;  1FH0 A;  1U9Q X;  3HWN A;  5JH3 A;  1ATK A;  3CH2 X;  1U5I A;  3K9M A;  1ITO A;  2OP3 A;  2HHN A;  3O0U A;  4YYV A;  1MS6 A;  2DC7 A;  2F1G A;  2R6N A;  2CIO A;  3C9E A;  3USV A;  4YYQ A;  3S3Q A;  3H89 A;  2AVW A;  2ACT A;  1CS8 A;  4QRX A;  7PCK A;  2XU5 A;  1QOL A;  3H8B A;  2FYE A;  4BPV A;  1PE6 A;  3LFY A;  3GCB A;  4FJC A;  1EWO A;  1AYV A;  3H7D A;  4N79 A;  1YK7 A;  5J94 A;  2DJG B;  3IHP A;  2XU4 A;  3IMA A;  1MEM A;  2VHF A;  1CSB B;  2B1N A;  2DJF B;  2XU3 A;  3HHA A;  2DCD A; 
#chains in the Genus database with same CATH topology
 4MSX A;  4QRV A;  8PCH A;  4BS5 A;  2IPP B;  3PHU A;  4PAD A;  2BTW B;  1ME4 A;  4FIP A;  4DMY A;  2BDZ A;  1TU6 A;  2FQ9 A;  6PAD A;  3BPM A;  1KFX L;  2Y5B A;  4D8E A;  4OVZ B;  2E03 A;  1AU3 A;  1AYU A;  3WXF A;  1VJV A;  1DKI A;  4PI3 A;  4BOQ A;  4HWY A;  3HD3 A;  3IUT A;  1MEG A;  2FO5 A;  1BP4 A;  3W31 A;  4P6G A;  2DOS A;  3OVZ A;  2DC9 A;  2ARY A;  3I06 A;  1PBH A;  3BB7 A;  3H6S A;  3PHX A;  3RVX A;  1CPJ A;  2E00 A;  1PPD A;  1AU2 A;  4BOS A;  4QH6 A;  1AYW A;  1NPZ A;  4YV8 A;  2Z84 A;  1VSN A;  4YYR A;  3MP2 A;  2J7Q C;  1F2A A;  1PPN A;  1KXR A;  3F75 A;  3OIS A;  2NQI A;  4AXM A;  3IOQ A;  1QMY A;  3PSE A;  1PCI A;  2DCA A;  1CVZ A;  2PAD A;  1SP4 B;  2JQG R;  3KW9 A;  1MIR A;  3U8E A;  2VHS A;  4FK5 A;  4X6J A;  1YZB A;  3OF8 A;  4X6I A;  4X6H A;  4MZO A;  5K16 A;  4G54 A;  3OVX A;  2HWK A;  3C0R A;  4WUR A;  4AXL A;  1U9X A;  2PBH A;  4REZ A;  1Y08 A;  2FT2 A;  3BY4 A;  2DZZ A;  2AYN A;  2AU1 A;  2HXZ A;  1GLO A;  2Y6E A;  4CDC B;  2P0R A;  2DCC A;  3PRP A;  3H8C A;  3V6C A;  2UZJ A;  1BY8 A;  3PT2 A;  1CV8 A;  4PP2 E;  3CH3 X;  1SNK A;  1U9V A;  3E9S A;  3BBA A;  2E01 A;  2BU3 A;  4RF0 A;  3PNR A;  1PXV A;  3KWB X;  3OF9 A;  4Q8G A;  1X9Y A;  3IFU A;  4I07 A;  4XZX A;  2GFO A;  3QJ3 A;  3AI8 A;  3KSE A;  4W4U A;  5EZQ A;  4BQV A;  2PNS A;  4OEL A;  1YT7 A;  3P5V A;  4R3D A;  1GMY A;  4W5B A;  4YYS A;  4QBB A;  1NL6 A;  1PAD A;  2PRE A;  2FRQ A;  1CB5 A;  4P6E A;  3BC3 A;  3F5V A;  2NQG A;  1UKF A;  2DCB A;  2IBI A;  1EWM A;  5JA7 A;  4CDE B;  4PT5 A;  4K7C A;  4MZS A;  2G6D A;  4PP1 A;  5EF4 A;  3S3R A;  2P7U A;  4IP3 A;  1QXP A;  2BDL A;  1PVJ A;  3ZNH A;  1M6D A;  1GEC E;  5CVO B;  4I04 A;  3BCN A;  1PPO A;  4CZW A;  2WBF X;  3P5U A;  5EZS A;  2F7D A;  2AUZ A;  1ICF A;  1ME3 A;  1NB3 A;  3P5W A;  4BOU A;  3K24 A;  1TL9 A;  3CBJ A;  5A24 A;  2AIM A;  1DEU A;  2R9O A;  2ATO A;  2FUD A;  1NLJ A;  2G8J A;  2AYO A;  5FPW A;  4RNA A;  3K8U A;  3PDF A;  1F29 A;  1DF0 A;  1Q6K A;  3BWK A;  1U9W A;  2E02 A;  3BPF A;  3QT4 A;  2B1M A;  3QSD A;  3MHS A;  1AIM A;  1HUC B;  9PAP A;  4YYU A;  1IWD A;  1GCB A;  1JQP A;  1ZIV A;  3HHI A;  4N8W A;  1NQC A;  1MDW A;  3B79 A;  3OQC A;  2OZ2 A;  3RNV A;  1TLO A;  1F2B A;  2R9M A;  3PBH A;  1EF7 A;  4BSQ A;  3N4C A;  1BQI A;  2O6X A;  2CB5 A;  2DC8 A;  4I05 A;  2YJ2 A;  3O1G A;  3WXG A;  2JQF R;  2HH5 A;  1AU0 A;  1PPP A;  1KFU L;  2G7Y A;  3ERV A;  2OUL A;  4P16 A;  3IV2 A;  4N4Z A;  3KWZ A;  4CDD B;  4YYW A;  4QRG A;  3V6E A;  1A6R A;  1BGO A;  1XKG A;  2YJ8 A;  5E6J A;  3W30 A;  3WXE A;  2AUX A;  4MI7 A;  1KHQ A;  4BS6 A;  1EWL A;  4IUM A;  3N3G A;  4MM3 B;  4OEM A;  4XUI A;  4D8I A;  3B21 A;  3E1Z B;  1PIP A;  2AGA A;  4ZTB A;  4A5U A;  4GUA A;  2NQA A;  3PRM A;  1THE A;  3ZUA A;  2R9N A;  4KLB A;  4XR7 A;  2R9C A;  4CDF B;  2DZY A;  1ZCM A;  3RVV A;  1AEC A;  2JRI A;  3D6S A;  4HXD B;  1YK8 A;  4ZUX U;  3N3K A;  5CVM A;  3CBK A;  2YJC A;  4RY2 A;  1MHW A;  3IEJ A;  3I3T A;  5F02 A;  3TRK A;  3NHE A;  4RKX A;  1STF E;  1EWP A;  2G8E A;  3KX1 A;  1AU4 A;  1CTE A;  3MHH A;  1YAL A;  1YVB A;  2AS8 A;  2GHU A;  4RF1 A;  1POP A;  2HD5 A;  2P86 A;  1NB5 A;  3MOR A;  4BOZ A;  1Y4H A;  3KFQ A;  3DF0 A;  3PW3 A;  2H7J A;  3MJ5 A;  1K3B B;  2NQD B;  3TNX A;  4BOP A;  1S4V A;  5CHT A;  1KHP A;  4YVA A;  2YJB A;  3MTV A;  4W5C A;  1O0E A;  5CHV A;  2C0Y A;  5EGW A;  4WA6 A;  2YJ9 A;  2XU1 A;  4OW0 A;  1QDQ A;  3BOW A;  2FRA A;  1CJL A;  2DC6 A;  3P5X A;  3LXS A;  1F2C A;  4DMX A;  3MTN A;  2R9F A;  5PAD A;  5JZE A;  1CQD A;  3M99 A;  4Q8H A;  2FTD A;  3TMP A;  3RVW A;  5CVN B;  3KKU A;  1FH0 A;  1U9Q X;  3HWN A;  5JH3 A;  2J7Q A;  1ATK A;  3CH2 X;  1U5I A;  3K9M A;  1ITO A;  2OP3 A;  3O65 A;  2HHN A;  3O0U A;  4YYV A;  1MS6 A;  2DC7 A;  2F1G A;  2R6N A;  2CIO A;  4D8B A;  3C9E A;  3USV A;  2BTW A;  4YYQ A;  3S3Q A;  3H89 A;  2AVW A;  2ACT A;  1CS8 A;  4QRX A;  7PCK A;  2XU5 A;  1QOL A;  2FE8 A;  3H8B A;  5KO3 A;  2FYE A;  4BPV A;  3PHW A;  4OVZ A;  1PE6 A;  3LFY A;  3GCB A;  4M0W A;  4FJC A;  1EWO A;  1AYV A;  3H7D A;  2JTC A;  4N79 A;  1YK7 A;  5J94 A;  2DJG B;  3IHP A;  2XU4 A;  3IMA A;  1MEM A;  2VHF A;  1CSB B;  2B1N A;  2DJF B;  2XU3 A;  3HHA A;  2DCD A; 
#chains in the Genus database with same CATH homology
 4MSX A;  4QRV A;  8PCH A;  4BS5 A;  2IPP B;  4PAD A;  1ME4 A;  4FIP A;  4DMY A;  2BDZ A;  1TU6 A;  2FQ9 A;  4C5P A;  3BPM A;  6PAD A;  3D9W A;  1KFX L;  2Y5B A;  2E03 A;  1AU3 A;  1AYU A;  3WXF A;  1VJV A;  4PI3 A;  4HWY A;  3HD3 A;  3IUT A;  1MEG A;  2FO5 A;  1BP4 A;  4P6G A;  4BGF A;  3OVZ A;  2DC9 A;  2ARY A;  3I06 A;  1PBH A;  3H6S A;  3RVX A;  1CPJ A;  2E00 A;  1PPD A;  1AU2 A;  4QH6 A;  1AYW A;  1NPZ A;  4YV8 A;  1VSN A;  4YYR A;  1F2A A;  1PPN A;  1KXR A;  3F75 A;  3OIS A;  1W4T A;  4NV7 A;  2NQI A;  4AXM A;  3IOQ A;  1QMY A;  1PCI A;  2DCA A;  1CVZ A;  2PAD A;  1SP4 B;  2JQG R;  3KW9 A;  1MIR A;  3U8E A;  2VHS A;  4FK5 A;  4X6J A;  3OF8 A;  4X6I A;  4X6H A;  4MZO A;  5K16 A;  4G54 A;  3OVX A;  4AXL A;  1U9X A;  2PBH A;  1Y08 A;  2FT2 A;  2DZZ A;  2AYN A;  2AU1 A;  2HXZ A;  1GLO A;  2Y6E A;  4CDC B;  2P0R A;  2DCC A;  3H8C A;  3V6C A;  1BY8 A;  1CV8 A;  4PP2 E;  3CH3 X;  1SNK A;  1U9V A;  2E01 A;  3PNR A;  4B55 A;  1PXV A;  3KWB X;  3OF9 A;  4Q8G A;  1X9Y A;  4I07 A;  2GFO A;  3QJ3 A;  3AI8 A;  3KSE A;  4W4U A;  4BQV A;  2PNS A;  4OEL A;  1YT7 A;  3P5V A;  1GMY A;  4W5B A;  4YYS A;  4QBB A;  1NL6 A;  1PAD A;  2PRE A;  2FRQ A;  1CB5 A;  4P6E A;  3LTW A;  3BC3 A;  3F5V A;  2NQG A;  2DCB A;  2IBI A;  1EWM A;  5JA7 A;  4CDE B;  4K7C A;  4MZS A;  2G6D A;  4PP1 A;  5EF4 A;  3S3R A;  2P7U A;  1QXP A;  2BDL A;  1M6D A;  1GEC E;  5CVO B;  4I04 A;  3BCN A;  1PPO A;  4CZW A;  2WBF X;  3P5U A;  2F7D A;  2AUZ A;  1ICF A;  1ME3 A;  1NB3 A;  3P5W A;  2BSZ A;  3K24 A;  1TL9 A;  3CBJ A;  5A24 A;  2AIM A;  1DEU A;  2R9O A;  2ATO A;  2FUD A;  1NLJ A;  2VFB A;  2G8J A;  2AYO A;  5FPW A;  3K8U A;  3PDF A;  1F29 A;  1DF0 A;  1Q6K A;  3BWK A;  1GX3 A;  1U9W A;  2E02 A;  3BPF A;  3QT4 A;  2B1M A;  3QSD A;  3MHS A;  1AIM A;  1HUC B;  9PAP A;  4YYU A;  1IWD A;  1GCB A;  1JQP A;  1ZIV A;  3HHI A;  4N8W A;  1NQC A;  1MDW A;  3B79 A;  2OZ2 A;  1E2T A;  1TLO A;  1F2B A;  2R9M A;  3PBH A;  1EF7 A;  4BSQ A;  3N4C A;  1BQI A;  2O6X A;  2CB5 A;  2DC8 A;  4I05 A;  2YJ2 A;  3O1G A;  3WXG A;  2JQF R;  2HH5 A;  1AU0 A;  1PPP A;  1KFU L;  2G7Y A;  3ERV A;  2OUL A;  4GUZ A;  3IV2 A;  4N4Z A;  3KWZ A;  4CDD B;  4YYW A;  4QRG A;  3V6E A;  1A6R A;  1BGO A;  1XKG A;  2YJ8 A;  3WXE A;  2AUX A;  1KHQ A;  4BS6 A;  1EWL A;  3N3G A;  4OEM A;  4XUI A;  3E1Z B;  1PIP A;  4NV8 A;  2NQA A;  1THE A;  3ZUA A;  2R9N A;  4KLB A;  4XR7 A;  2R9C A;  4CDF B;  2DZY A;  1ZCM A;  3RVV A;  1AEC A;  3D6S A;  1YK8 A;  4ZUX U;  3N3K A;  5CVM A;  3CBK A;  2YJC A;  4RY2 A;  1MHW A;  3IEJ A;  3I3T A;  5F02 A;  3NHE A;  1STF E;  1EWP A;  2G8E A;  3KX1 A;  1AU4 A;  1CTE A;  3MHH A;  1YAL A;  1YVB A;  2AS8 A;  2GHU A;  1POP A;  2HD5 A;  2P86 A;  1NB5 A;  3MOR A;  1Y4H A;  3KFQ A;  3DF0 A;  3PW3 A;  2H7J A;  1K3B B;  2NQD B;  3TNX A;  1S4V A;  5CHT A;  1KHP A;  4YVA A;  2YJB A;  4W5C A;  1O0E A;  5CHV A;  2C0Y A;  5EGW A;  4WA6 A;  2YJ9 A;  2XU1 A;  1QDQ A;  3BOW A;  2FRA A;  1CJL A;  2DC6 A;  3P5X A;  3LXS A;  1F2C A;  4DMX A;  3MTN A;  2R9F A;  5PAD A;  1CQD A;  3M99 A;  4Q8H A;  1W6F A;  2FTD A;  3RVW A;  5CVN B;  3KKU A;  1FH0 A;  1U9Q X;  3HWN A;  5JH3 A;  1ATK A;  3CH2 X;  1U5I A;  3K9M A;  1ITO A;  2OP3 A;  2HHN A;  3O0U A;  4YYV A;  1MS6 A;  2DC7 A;  2F1G A;  2R6N A;  2CIO A;  1W5R A;  3C9E A;  2VFC A;  3USV A;  4YYQ A;  3S3Q A;  3H89 A;  2AVW A;  2ACT A;  1CS8 A;  4QRX A;  7PCK A;  2XU5 A;  1QOL A;  3H8B A;  2FYE A;  4BPV A;  1PE6 A;  3LFY A;  3GCB A;  4FJC A;  1EWO A;  1AYV A;  3H7D A;  4N79 A;  1YK7 A;  5J94 A;  2DJG B;  3IHP A;  2XU4 A;  3IMA A;  1MEM A;  2VHF A;  1CSB B;  2B1N A;  2DJF B;  2XU3 A;  3HHA A;  2DCD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...