1NL6A

Crystal structure of the cysteine protease human cathepsin k in complex with a covalent azepanone inhibitor
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cathepsin K
publication title Azepanone-based inhibitors of human and rat cathepsin K
pubmed doi rcsb
source organism Homo sapiens
total genus 54
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2003-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1nl6A00
4YYSA 2FUDA 1AU4A 3BPMA 1CVZA 2DC9A 2G6DA 4KLBA 3CBJA 3HHAA 1AU2A 1FH0A 1HUCB 3I06A 4QH6A 4W5CA 2AVWA 1CQDA 2AUZA 1EWMA 2DCBA 2R9CA 4BS5A 2B1NA 1DEUA 5CVMA 1KHPA 4MZOA 2B1MA 5J94A 3P5VA 5PADA 4QBBA 2BDLA 1XKGA 3KWZA 1PBHA 3IUTA 1MIRA 1NQCA 1GCBA 4QRVA 2VHFA 5EF4A 3ERVA 4X6IA 1M6DA 3HHIA 4YYUA 2NQGA 2DC8A 4BQVA 1KFXL 3MORA 9PAPA 3IEJA 1VSNA 3K9MA 2O6XA 4YVAA 1KXRA 1CSBB 3WXFA 2DJFB 1NB5A 1MDWA 4OEMA 2DZZA 3OVXA 1CV8A 1TLOA 2NQDB 4BPVA 1EWLA 3H89A 2Y6EA 1F2AA 2E02A 3BWKA 4I04A 5CVNB 1YK8A 1EWOA 1SP4B 1ZIVA 1NPZA 2E00A 4QRXA 1KHQA 1NL6A 2YJBA 1AYUA 1O0EA 1ATKA 1CJLA 4MSXA 3S3QA 1NB3A 2PADA 1PPPA 1MS6A 3AI8A 4I05A 5JH3A 1BQIA 3KFQA 4PADA 1IWDA 1Y08A 1MEMA 3CBKA 4P6EA 2IBIA 3MHHA 1ME4A 3U8EA 1NLJA 1PXVA 4AXLA 1CS8A 3H8CA 1PPDA 1Y4HA 2AIMA 3N4CA 2DC6A 4WA6A 2CIOA 1VJVA 2XU5A 3P5XA 2E03A 2R9NA 3C9EA 2NQIA 3DF0A 4BSQA 3H8BA 3KWBX 3S3RA 2DCCA 2FRAA 4CDEB 3K8UA 1F29A 4P6GA 4I07A 2Y5BA 3F75A 2DCAA 1PE6A 4AXMA 6PADA 1PADA 1THEA 3ZUAA 1YK7A 2JQGR 5CHTA 1GLOA 3KSEA 5CVOB 2DC7A 1MEGA 3KW9A 2P86A 1U9XA 1CTEA 3NHEA 2BDZA 2P0RA 1A6RA 3IHPA 2G7YA 1U9VA 2CB5A 4N8WA 4XR7A 5FPWA 3N3GA 4ZUXU 3TNXA 4PI3A 2OP3A 1Q6KA 4XUIA 3RVWA 3PDFA 5EGWA 4RY2A 1YT7A 1AYVA 1AIMA 2ACTA 5F02A 4DMXA 3MTNA 2XU3A 4W4UA 3HD3A 2PNSA 1U9WA 1ZCMA 1X9YA 2AS8A 2FYEA 2GFOA 1CPJA 3PBHA 4FIPA 1TL9A 1ME3A 5JA7A 2FT2A 1TU6A 4FK5A 2E01A 1EWPA 4YYQA 1KFUL 4CDDB 2PBHA 1BP4A 1ICFA 1STFE 1AYWA 3F5VA 3MHSA 3LXSA 2FQ9A 8PCHA 3O1GA 3USVA 4G54A 1PCIA 1GMYA 1S4VA 3H6SA 1U5IA 3D6SA 3BPFA 1CB5A 4YYRA 3K24A 2F7DA 4YV8A 2G8EA 2P7UA 2JQFR 2YJCA 2OULA 2HH5A 3CH3X 3P5WA 2NQAA 4FJCA 3P5UA 2AYOA 1DF0A 3KKUA 4K7CA 1AECA 2OZ2A 2R6NA 4Q8HA 1F2BA 2YJ8A 2AUXA 3M99A 3OVZA 2ARYA 2H7JA 4BS6A 3RVVA 1U9QX 3OISA 1QOLA 2FTDA 3BCNA 4PP1A 4CDFB 4DMYA 3CH2X 2YJ2A 1AU0A 1AU3A 2DZYA 3OF8A 3PW3A 1GECE 4QRGA 2HXZA 4CDCB 1SNKA 2FO5A 4W5BA 2XU4A 1JQPA 1QXPA 2WBFX 3WXEA 1EF7A 4N79A 1YALA 2R9MA 2DCDA 3E1ZB 2HHNA 3BC3A 3V6CA 4YYWA 3RVXA 1PPNA 2HD5A 2AU1A 3LFYA 4HWYA 4N4ZA 2ATOA 1BGOA 3V6EA 2VHSA 2C0YA 4Q8GA 1YVBA 1K3BB 1MHWA 3QJ3A 3IMAA 4CZWA 1QDQA 2F1GA 3I3TA 3WXGA 7PCKA 1BY8A 2R9FA 3N3KA 1ITOA 3QT4A 5A24A 4PP2E 1F2CA 1QMYA 4X6JA 4OELA 2FRQA 3IOQA 3KX1A 2G8JA 1PPOA 2XU1A 2GHUA 2AYNA 1POPA 2IPPB 3GCBA 2DJGB 3PNRA 2R9OA 3BOWA 5K16A 3B79A 5CHVA 1PIPA 3O0UA 4MZSA 2YJ9A 4X6HA 3OF9A 3H7DA 3IV2A 4YYVA 2PREA 3QSDA 3HWNA
chains in the Genus database with same CATH superfamily
4YYSA 2FUDA 1AU4A 3BPMA 1CVZA 2DC9A 4RF0A 2BTWA 2G6DA 4KLBA 3CBJA 4IP3A 3HHAA 1AU2A 1FH0A 4BOSA 1HUCB 3I06A 4QH6A 4W5CA 2AVWA 4BOUA 1CQDA 2AUZA 1EWMA 2DCBA 2R9CA 4BS5A 2B1NA 1DEUA 5CVMA 1KHPA 1DKIA 4MZOA 3IFUA 2B1MA 3MTVA 3BB7A 5J94A 3P5VA 5PADA 3E9SA 4QBBA 4WURA 2BDLA 1XKGA 4HXDB 4RNAA 3KWZA 1PBHA 3IUTA 1MIRA 1NQCA 1GCBA 3BBAA 4QRVA 2VHFA 5EF4A 3ERVA 4X6IA 1M6DA 3HHIA 4YYUA 2NQGA 2DC8A 4BQVA 1KFXL 3MORA 9PAPA 4BOQA 4D8EA 3IEJA 1VSNA 3K9MA 2O6XA 4YVAA 1KXRA 1CSBB 3WXFA 2DJFB 1NB5A 1MDWA 4OEMA 2DZZA 3OVXA 4OW0A 1CV8A 1TLOA 2NQDB 4BPVA 1EWLA 3H89A 2Y6EA 1F2AA 2DOSA 2E02A 3BWKA 4I04A 5CVNB 1YK8A 1EWOA 1SP4B 1ZIVA 1NPZA 2E00A 4QRXA 3TMPA 1KHQA 1NL6A 2YJBA 1AYUA 1O0EA 1ATKA 1CJLA 4MSXA 3S3QA 1NB3A 2PADA 4RKXA 1PPPA 1MS6A 4D8IA 3AI8A 4XZXA 4I05A 5JH3A 1BQIA 3KFQA 4P16A 4PADA 1IWDA 1Y08A 4M0WA 1MEMA 3CBKA 4P6EA 2IBIA 3PSEA 3MHHA 1ME4A 3U8EA 5JZEA 1NLJA 1PXVA 4AXLA 2AGAA 1CS8A 3H8CA 1PPDA 4R3DA 2HWKA 1Y4HA 2AIMA 4A5UA 3N4CA 2DC6A 4WA6A 2CIOA 1VJVA 2XU5A 3P5XA 2E03A 2R9NA 4RF1A 3C9EA 2NQIA 3DF0A 4BSQA 3H8BA 3KWBX 5KO3A 3S3RA 2DCCA 2FRAA 3PT2A 4CDEB 3K8UA 1F29A 4P6GA 4I07A 2Y5BA 2BTWB 2DCAA 3F75A 1PE6A 4AXMA 3O65A 6PADA 1PADA 1THEA 3ZUAA 1YK7A 2JQGR 5CHTA 3W30A 3W31A 1GLOA 3C0RA 3KSEA 5CVOB 2DC7A 1MEGA 3KW9A 2P86A 1U9XA 1CTEA 3NHEA 2BDZA 2P0RA 1A6RA 3IHPA 2G7YA 1U9VA 3BY4A 2CB5A 4N8WA 4XR7A 1PVJA 3PHXA 5FPWA 3N3GA 4ZUXU 3TNXA 2OP3A 4PI3A 1Q6KA 2JRIA 4XUIA 2FE8A 3RVWA 3PDFA 5EGWA 3PHWA 4RY2A 1YT7A 1AYVA 3PRMA 1AIMA 4GUAA 2ACTA 5F02A 4DMXA 3MTNA 2XU3A 4W4UA 4MI7A 3HD3A 2PNSA 1U9WA 1ZCMA 1X9YA 2AS8A 2FYEA 2GFOA 1CPJA 3PBHA 1UKFA 4FIPA 2JTCA 1TL9A 1ME3A 5JA7A 2FT2A 1TU6A 4FK5A 2E01A 1EWPA 4YYQA 1KFUL 4CDDB 2PBHA 1BP4A 1ICFA 4OVZA 1STFE 1AYWA 3F5VA 3MHSA 3LXSA 2FQ9A 8PCHA 3O1GA 3USVA 5EZSA 4G54A 4BOZA 1PCIA 3MP2A 1GMYA 1S4VA 3H6SA 1U5IA 3D6SA 3BPFA 1CB5A 4YYRA 3K24A 4IUMA 4ZTBA 2F7DA 4YV8A 2G8EA 2P7UA 2JQFR 2YJCA 2OULA 2HH5A 3CH3X 3P5WA 2NQAA 4FJCA 3P5UA 2AYOA 1DF0A 3KKUA 4K7CA 1AECA 2OZ2A 2R6NA 4Q8HA 1F2BA 2YJ8A 2AUXA 3M99A 3OVZA 2ARYA 2H7JA 4BS6A 3RVVA 3MJ5A 1U9QX 3OISA 1QOLA 2FTDA 3BCNA 4PP1A 4CDFB 4DMYA 3CH2X 1YZBA 2YJ2A 1AU0A 1AU3A 2DZYA 2BU3A 3OF8A 1GECE 3PW3A 3ZNHA 4QRGA 2HXZA 4CDCB 1SNKA 2J7QA 2FO5A 3OQCA 4W5BA 2XU4A 1JQPA 1QXPA 2WBFX 3WXEA 1EF7A 5EZQA 4N79A 1YALA 3TRKA 2R9MA 3B21A 2DCDA 3E1ZB 2HHNA 2Z84A 3BC3A 3V6CA 4YYWA 3RVXA 3PHUA 1PPNA 2HD5A 2AU1A 3LFYA 4HWYA 4BOPA 4N4ZA 2ATOA 1BGOA 3V6EA 2VHSA 5E6JA 2C0YA 4Q8GA 1YVBA 1K3BB 1MHWA 3QJ3A 3IMAA 4CZWA 4D8BA 3PRPA 1QDQA 4PT5A 2F1GA 3I3TA 3WXGA 7PCKA 1BY8A 2R9FA 3N3KA 1ITOA 2UZJA 3QT4A 5A24A 4PP2E 1F2CA 1QMYA 4X6JA 4OELA 2FRQA 3IOQA 3KX1A 2J7QC 2G8JA 1PPOA 2XU1A 4MM3B 2GHUA 2AYNA 1POPA 2IPPB 3GCBA 2DJGB 3PNRA 2R9OA 3BOWA 5K16A 3B79A 5CHVA 1PIPA 3O0UA 4MZSA 3RNVA 2YJ9A 4REZA 4X6HA 3OF9A 3H7DA 3IV2A 4YYVA 4OVZB 2PREA 3QSDA 3HWNA
chains in the Genus database with same CATH topology
4YYSA 2FUDA 1AU4A 3BPMA 1CVZA 2DC9A 2G6DA 4KLBA 3CBJA 3HHAA 1AU2A 1FH0A 1HUCB 3I06A 4QH6A 4W5CA 2AVWA 1CQDA 2AUZA 1EWMA 2DCBA 2R9CA 4BS5A 2B1NA 1DEUA 5CVMA 1KHPA 4MZOA 2B1MA 5J94A 3P5VA 5PADA 4QBBA 2BDLA 1XKGA 3KWZA 1PBHA 3IUTA 1MIRA 1NQCA 1GCBA 4QRVA 2VHFA 5EF4A 3ERVA 4X6IA 1M6DA 3HHIA 4YYUA 2NQGA 2DC8A 4BQVA 1KFXL 3LTWA 3MORA 9PAPA 3IEJA 1VSNA 3K9MA 2O6XA 4YVAA 1KXRA 1CSBB 3WXFA 2DJFB 1NB5A 1MDWA 4OEMA 2DZZA 3OVXA 3D9WA 1CV8A 1TLOA 2NQDB 4BGFA 4BPVA 1EWLA 3H89A 2Y6EA 1F2AA 4NV7A 2E02A 3BWKA 4I04A 5CVNB 1YK8A 1EWOA 1SP4B 1ZIVA 1NPZA 2E00A 4QRXA 1KHQA 1NL6A 2YJBA 1AYUA 1O0EA 1ATKA 1CJLA 1W4TA 4MSXA 3S3QA 1NB3A 2PADA 1PPPA 1MS6A 3AI8A 4NV8A 4I05A 5JH3A 1BQIA 3KFQA 4GUZA 4PADA 1IWDA 1Y08A 1MEMA 3CBKA 4B55A 4P6EA 2IBIA 3MHHA 1ME4A 3U8EA 1NLJA 1E2TA 1PXVA 4AXLA 1CS8A 3H8CA 1PPDA 1Y4HA 2AIMA 3N4CA 2DC6A 4WA6A 2CIOA 1VJVA 1W5RA 2XU5A 3P5XA 2E03A 2R9NA 3C9EA 2NQIA 3DF0A 4BSQA 3H8BA 3KWBX 2BSZA 3S3RA 2DCCA 2FRAA 4CDEB 3K8UA 1F29A 4P6GA 4I07A 2Y5BA 3F75A 2DCAA 1PE6A 4AXMA 6PADA 1PADA 1THEA 3ZUAA 1YK7A 2JQGR 5CHTA 1GLOA 3KSEA 5CVOB 2DC7A 1MEGA 3KW9A 2P86A 1U9XA 1CTEA 3NHEA 2BDZA 2P0RA 1A6RA 4C5PA 3IHPA 2G7YA 1U9VA 2CB5A 4N8WA 4XR7A 1GX3A 5FPWA 3N3GA 4ZUXU 3TNXA 2OP3A 4PI3A 1Q6KA 4XUIA 3RVWA 3PDFA 5EGWA 4RY2A 1YT7A 1AYVA 1AIMA 2ACTA 5F02A 4DMXA 3MTNA 2XU3A 4W4UA 3HD3A 2PNSA 1U9WA 1ZCMA 1X9YA 2AS8A 2FYEA 2GFOA 1CPJA 3PBHA 4FIPA 1TL9A 1ME3A 5JA7A 2FT2A 1TU6A 4FK5A 2E01A 1EWPA 4YYQA 1KFUL 4CDDB 2PBHA 1BP4A 1ICFA 1STFE 1AYWA 1W6FA 3F5VA 3MHSA 3LXSA 2FQ9A 8PCHA 3O1GA 3USVA 4G54A 1PCIA 1GMYA 1S4VA 3H6SA 1U5IA 3D6SA 3BPFA 1CB5A 4YYRA 3K24A 2F7DA 4YV8A 2G8EA 2P7UA 2JQFR 2YJCA 2OULA 2HH5A 3CH3X 3P5WA 2NQAA 4FJCA 3P5UA 2AYOA 1DF0A 3KKUA 4K7CA 1AECA 2OZ2A 2R6NA 4Q8HA 1F2BA 2YJ8A 2AUXA 3M99A 3OVZA 2ARYA 2H7JA 4BS6A 3RVVA 1U9QX 3OISA 2VFCA 1QOLA 2FTDA 3BCNA 4PP1A 4CDFB 4DMYA 2VFBA 3CH2X 2YJ2A 1AU0A 1AU3A 2DZYA 3OF8A 3PW3A 1GECE 4QRGA 2HXZA 4CDCB 1SNKA 2FO5A 4W5BA 2XU4A 1JQPA 1QXPA 2WBFX 3WXEA 1EF7A 4N79A 1YALA 2R9MA 2DCDA 3E1ZB 2HHNA 3BC3A 3V6CA 4YYWA 3RVXA 1PPNA 2HD5A 2AU1A 3LFYA 4HWYA 4N4ZA 2ATOA 1BGOA 3V6EA 2VHSA 2C0YA 4Q8GA 1YVBA 1K3BB 1MHWA 3QJ3A 3IMAA 4CZWA 1QDQA 2F1GA 3I3TA 3WXGA 7PCKA 1BY8A 2R9FA 3N3KA 1ITOA 3QT4A 5A24A 4PP2E 1F2CA 1QMYA 4X6JA 4OELA 2FRQA 3IOQA 3KX1A 2G8JA 1PPOA 2XU1A 2GHUA 2AYNA 1POPA 2IPPB 3GCBA 2DJGB 3PNRA 2R9OA 3BOWA 5K16A 3B79A 5CHVA 1PIPA 3O0UA 4MZSA 2YJ9A 4X6HA 3OF9A 3H7DA 3IV2A 4YYVA 2PREA 3QSDA 3HWNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YYS A;  2FUD A;  1AU4 A;  3BPM A;  1CVZ A;  2DC9 A;  2G6D A;  4KLB A;  3CBJ A;  3HHA A;  1AU2 A;  1FH0 A;  1HUC B;  3I06 A;  4QH6 A;  4W5C A;  2AVW A;  1CQD A;  2AUZ A;  1EWM A;  2DCB A;  2R9C A;  4BS5 A;  2B1N A;  1DEU A;  5CVM A;  1KHP A;  4MZO A;  2B1M A;  5J94 A;  3P5V A;  5PAD A;  4QBB A;  2BDL A;  1XKG A;  3KWZ A;  1PBH A;  3IUT A;  1MIR A;  1NQC A;  1GCB A;  4QRV A;  2VHF A;  5EF4 A;  3ERV A;  4X6I A;  1M6D A;  3HHI A;  4YYU A;  2NQG A;  2DC8 A;  4BQV A;  1KFX L;  3MOR A;  9PAP A;  3IEJ A;  1VSN A;  3K9M A;  2O6X A;  4YVA A;  1KXR A;  1CSB B;  3WXF A;  2DJF B;  1NB5 A;  1MDW A;  4OEM A;  2DZZ A;  3OVX A;  1CV8 A;  1TLO A;  2NQD B;  4BPV A;  1EWL A;  3H89 A;  2Y6E A;  1F2A A;  2E02 A;  3BWK A;  4I04 A;  5CVN B;  1YK8 A;  1EWO A;  1SP4 B;  1ZIV A;  1NPZ A;  2E00 A;  4QRX A;  1KHQ A;  1NL6 A;  2YJB A;  1AYU A;  1O0E A;  1ATK A;  1CJL A;  4MSX A;  3S3Q A;  1NB3 A;  2PAD A;  1PPP A;  1MS6 A;  3AI8 A;  4I05 A;  5JH3 A;  1BQI A;  3KFQ A;  4PAD A;  1IWD A;  1Y08 A;  1MEM A;  3CBK A;  4P6E A;  2IBI A;  3MHH A;  1ME4 A;  3U8E A;  1NLJ A;  1PXV A;  4AXL A;  1CS8 A;  3H8C A;  1PPD A;  1Y4H A;  2AIM A;  3N4C A;  2DC6 A;  4WA6 A;  2CIO A;  1VJV A;  2XU5 A;  3P5X A;  2E03 A;  2R9N A;  3C9E A;  2NQI A;  3DF0 A;  4BSQ A;  3H8B A;  3KWB X;  3S3R A;  2DCC A;  2FRA A;  4CDE B;  3K8U A;  1F29 A;  4P6G A;  4I07 A;  2Y5B A;  3F75 A;  2DCA A;  1PE6 A;  4AXM A;  6PAD A;  1PAD A;  1THE A;  3ZUA A;  1YK7 A;  2JQG R;  5CHT A;  1GLO A;  3KSE A;  5CVO B;  2DC7 A;  1MEG A;  3KW9 A;  2P86 A;  1U9X A;  1CTE A;  3NHE A;  2BDZ A;  2P0R A;  1A6R A;  3IHP A;  2G7Y A;  1U9V A;  2CB5 A;  4N8W A;  4XR7 A;  5FPW A;  3N3G A;  4ZUX U;  3TNX A;  4PI3 A;  2OP3 A;  1Q6K A;  4XUI A;  3RVW A;  3PDF A;  5EGW A;  4RY2 A;  1YT7 A;  1AYV A;  1AIM A;  2ACT A;  5F02 A;  4DMX A;  3MTN A;  2XU3 A;  4W4U A;  3HD3 A;  2PNS A;  1U9W A;  1ZCM A;  1X9Y A;  2AS8 A;  2FYE A;  2GFO A;  1CPJ A;  3PBH A;  4FIP A;  1TL9 A;  1ME3 A;  5JA7 A;  2FT2 A;  1TU6 A;  4FK5 A;  2E01 A;  1EWP A;  4YYQ A;  1KFU L;  4CDD B;  2PBH A;  1BP4 A;  1ICF A;  1STF E;  1AYW A;  3F5V A;  3MHS A;  3LXS A;  2FQ9 A;  8PCH A;  3O1G A;  3USV A;  4G54 A;  1PCI A;  1GMY A;  1S4V A;  3H6S A;  1U5I A;  3D6S A;  3BPF A;  1CB5 A;  4YYR A;  3K24 A;  2F7D A;  4YV8 A;  2G8E A;  2P7U A;  2JQF R;  2YJC A;  2OUL A;  2HH5 A;  3CH3 X;  3P5W A;  2NQA A;  4FJC A;  3P5U A;  2AYO A;  1DF0 A;  3KKU A;  4K7C A;  1AEC A;  2OZ2 A;  2R6N A;  4Q8H A;  1F2B A;  2YJ8 A;  2AUX A;  3M99 A;  3OVZ A;  2ARY A;  2H7J A;  4BS6 A;  3RVV A;  1U9Q X;  3OIS A;  1QOL A;  2FTD A;  3BCN A;  4PP1 A;  4CDF B;  4DMY A;  3CH2 X;  2YJ2 A;  1AU0 A;  1AU3 A;  2DZY A;  3OF8 A;  3PW3 A;  1GEC E;  4QRG A;  2HXZ A;  4CDC B;  1SNK A;  2FO5 A;  4W5B A;  2XU4 A;  1JQP A;  1QXP A;  2WBF X;  3WXE A;  1EF7 A;  4N79 A;  1YAL A;  2R9M A;  2DCD A;  3E1Z B;  2HHN A;  3BC3 A;  3V6C A;  4YYW A;  3RVX A;  1PPN A;  2HD5 A;  2AU1 A;  3LFY A;  4HWY A;  4N4Z A;  2ATO A;  1BGO A;  3V6E A;  2VHS A;  2C0Y A;  4Q8G A;  1YVB A;  1K3B B;  1MHW A;  3QJ3 A;  3IMA A;  4CZW A;  1QDQ A;  2F1G A;  3I3T A;  3WXG A;  7PCK A;  1BY8 A;  2R9F A;  3N3K A;  1ITO A;  3QT4 A;  5A24 A;  4PP2 E;  1F2C A;  1QMY A;  4X6J A;  4OEL A;  2FRQ A;  3IOQ A;  3KX1 A;  2G8J A;  1PPO A;  2XU1 A;  2GHU A;  2AYN A;  1POP A;  2IPP B;  3GCB A;  2DJG B;  3PNR A;  2R9O A;  3BOW A;  5K16 A;  3B79 A;  5CHV A;  1PIP A;  3O0U A;  4MZS A;  2YJ9 A;  4X6H A;  3OF9 A;  3H7D A;  3IV2 A;  4YYV A;  2PRE A;  3QSD A;  3HWN A; 
#chains in the Genus database with same CATH topology
 4YYS A;  2FUD A;  1AU4 A;  3BPM A;  1CVZ A;  2DC9 A;  4RF0 A;  2BTW A;  2G6D A;  4KLB A;  3CBJ A;  4IP3 A;  3HHA A;  1AU2 A;  1FH0 A;  4BOS A;  1HUC B;  3I06 A;  4QH6 A;  4W5C A;  2AVW A;  4BOU A;  1CQD A;  2AUZ A;  1EWM A;  2DCB A;  2R9C A;  4BS5 A;  2B1N A;  1DEU A;  5CVM A;  1KHP A;  1DKI A;  4MZO A;  3IFU A;  2B1M A;  3MTV A;  3BB7 A;  5J94 A;  3P5V A;  5PAD A;  3E9S A;  4QBB A;  4WUR A;  2BDL A;  1XKG A;  4HXD B;  4RNA A;  3KWZ A;  1PBH A;  3IUT A;  1MIR A;  1NQC A;  1GCB A;  3BBA A;  4QRV A;  2VHF A;  5EF4 A;  3ERV A;  4X6I A;  1M6D A;  3HHI A;  4YYU A;  2NQG A;  2DC8 A;  4BQV A;  1KFX L;  3MOR A;  9PAP A;  4BOQ A;  4D8E A;  3IEJ A;  1VSN A;  3K9M A;  2O6X A;  4YVA A;  1KXR A;  1CSB B;  3WXF A;  2DJF B;  1NB5 A;  1MDW A;  4OEM A;  2DZZ A;  3OVX A;  4OW0 A;  1CV8 A;  1TLO A;  2NQD B;  4BPV A;  1EWL A;  3H89 A;  2Y6E A;  1F2A A;  2DOS A;  2E02 A;  3BWK A;  4I04 A;  5CVN B;  1YK8 A;  1EWO A;  1SP4 B;  1ZIV A;  1NPZ A;  2E00 A;  4QRX A;  3TMP A;  1KHQ A;  1NL6 A;  2YJB A;  1AYU A;  1O0E A;  1ATK A;  1CJL A;  4MSX A;  3S3Q A;  1NB3 A;  2PAD A;  4RKX A;  1PPP A;  1MS6 A;  4D8I A;  3AI8 A;  4XZX A;  4I05 A;  5JH3 A;  1BQI A;  3KFQ A;  4P16 A;  4PAD A;  1IWD A;  1Y08 A;  4M0W A;  1MEM A;  3CBK A;  4P6E A;  2IBI A;  3PSE A;  3MHH A;  1ME4 A;  3U8E A;  5JZE A;  1NLJ A;  1PXV A;  4AXL A;  2AGA A;  1CS8 A;  3H8C A;  1PPD A;  4R3D A;  2HWK A;  1Y4H A;  2AIM A;  4A5U A;  3N4C A;  2DC6 A;  4WA6 A;  2CIO A;  1VJV A;  2XU5 A;  3P5X A;  2E03 A;  2R9N A;  4RF1 A;  3C9E A;  2NQI A;  3DF0 A;  4BSQ A;  3H8B A;  3KWB X;  5KO3 A;  3S3R A;  2DCC A;  2FRA A;  3PT2 A;  4CDE B;  3K8U A;  1F29 A;  4P6G A;  4I07 A;  2Y5B A;  2BTW B;  2DCA A;  3F75 A;  1PE6 A;  4AXM A;  3O65 A;  6PAD A;  1PAD A;  1THE A;  3ZUA A;  1YK7 A;  2JQG R;  5CHT A;  3W30 A;  3W31 A;  1GLO A;  3C0R A;  3KSE A;  5CVO B;  2DC7 A;  1MEG A;  3KW9 A;  2P86 A;  1U9X A;  1CTE A;  3NHE A;  2BDZ A;  2P0R A;  1A6R A;  3IHP A;  2G7Y A;  1U9V A;  3BY4 A;  2CB5 A;  4N8W A;  4XR7 A;  1PVJ A;  3PHX A;  5FPW A;  3N3G A;  4ZUX U;  3TNX A;  2OP3 A;  4PI3 A;  1Q6K A;  2JRI A;  4XUI A;  2FE8 A;  3RVW A;  3PDF A;  5EGW A;  3PHW A;  4RY2 A;  1YT7 A;  1AYV A;  3PRM A;  1AIM A;  4GUA A;  2ACT A;  5F02 A;  4DMX A;  3MTN A;  2XU3 A;  4W4U A;  4MI7 A;  3HD3 A;  2PNS A;  1U9W A;  1ZCM A;  1X9Y A;  2AS8 A;  2FYE A;  2GFO A;  1CPJ A;  3PBH A;  1UKF A;  4FIP A;  2JTC A;  1TL9 A;  1ME3 A;  5JA7 A;  2FT2 A;  1TU6 A;  4FK5 A;  2E01 A;  1EWP A;  4YYQ A;  1KFU L;  4CDD B;  2PBH A;  1BP4 A;  1ICF A;  4OVZ A;  1STF E;  1AYW A;  3F5V A;  3MHS A;  3LXS A;  2FQ9 A;  8PCH A;  3O1G A;  3USV A;  5EZS A;  4G54 A;  4BOZ A;  1PCI A;  3MP2 A;  1GMY A;  1S4V A;  3H6S A;  1U5I A;  3D6S A;  3BPF A;  1CB5 A;  4YYR A;  3K24 A;  4IUM A;  4ZTB A;  2F7D A;  4YV8 A;  2G8E A;  2P7U A;  2JQF R;  2YJC A;  2OUL A;  2HH5 A;  3CH3 X;  3P5W A;  2NQA A;  4FJC A;  3P5U A;  2AYO A;  1DF0 A;  3KKU A;  4K7C A;  1AEC A;  2OZ2 A;  2R6N A;  4Q8H A;  1F2B A;  2YJ8 A;  2AUX A;  3M99 A;  3OVZ A;  2ARY A;  2H7J A;  4BS6 A;  3RVV A;  3MJ5 A;  1U9Q X;  3OIS A;  1QOL A;  2FTD A;  3BCN A;  4PP1 A;  4CDF B;  4DMY A;  3CH2 X;  1YZB A;  2YJ2 A;  1AU0 A;  1AU3 A;  2DZY A;  2BU3 A;  3OF8 A;  1GEC E;  3PW3 A;  3ZNH A;  4QRG A;  2HXZ A;  4CDC B;  1SNK A;  2J7Q A;  2FO5 A;  3OQC A;  4W5B A;  2XU4 A;  1JQP A;  1QXP A;  2WBF X;  3WXE A;  1EF7 A;  5EZQ A;  4N79 A;  1YAL A;  3TRK A;  2R9M A;  3B21 A;  2DCD A;  3E1Z B;  2HHN A;  2Z84 A;  3BC3 A;  3V6C A;  4YYW A;  3RVX A;  3PHU A;  1PPN A;  2HD5 A;  2AU1 A;  3LFY A;  4HWY A;  4BOP A;  4N4Z A;  2ATO A;  1BGO A;  3V6E A;  2VHS A;  5E6J A;  2C0Y A;  4Q8G A;  1YVB A;  1K3B B;  1MHW A;  3QJ3 A;  3IMA A;  4CZW A;  4D8B A;  3PRP A;  1QDQ A;  4PT5 A;  2F1G A;  3I3T A;  3WXG A;  7PCK A;  1BY8 A;  2R9F A;  3N3K A;  1ITO A;  2UZJ A;  3QT4 A;  5A24 A;  4PP2 E;  1F2C A;  1QMY A;  4X6J A;  4OEL A;  2FRQ A;  3IOQ A;  3KX1 A;  2J7Q C;  2G8J A;  1PPO A;  2XU1 A;  4MM3 B;  2GHU A;  2AYN A;  1POP A;  2IPP B;  3GCB A;  2DJG B;  3PNR A;  2R9O A;  3BOW A;  5K16 A;  3B79 A;  5CHV A;  1PIP A;  3O0U A;  4MZS A;  3RNV A;  2YJ9 A;  4REZ A;  4X6H A;  3OF9 A;  3H7D A;  3IV2 A;  4YYV A;  4OVZ B;  2PRE A;  3QSD A;  3HWN A; 
#chains in the Genus database with same CATH homology
 4YYS A;  2FUD A;  1AU4 A;  3BPM A;  1CVZ A;  2DC9 A;  2G6D A;  4KLB A;  3CBJ A;  3HHA A;  1AU2 A;  1FH0 A;  1HUC B;  3I06 A;  4QH6 A;  4W5C A;  2AVW A;  1CQD A;  2AUZ A;  1EWM A;  2DCB A;  2R9C A;  4BS5 A;  2B1N A;  1DEU A;  5CVM A;  1KHP A;  4MZO A;  2B1M A;  5J94 A;  3P5V A;  5PAD A;  4QBB A;  2BDL A;  1XKG A;  3KWZ A;  1PBH A;  3IUT A;  1MIR A;  1NQC A;  1GCB A;  4QRV A;  2VHF A;  5EF4 A;  3ERV A;  4X6I A;  1M6D A;  3HHI A;  4YYU A;  2NQG A;  2DC8 A;  4BQV A;  1KFX L;  3LTW A;  3MOR A;  9PAP A;  3IEJ A;  1VSN A;  3K9M A;  2O6X A;  4YVA A;  1KXR A;  1CSB B;  3WXF A;  2DJF B;  1NB5 A;  1MDW A;  4OEM A;  2DZZ A;  3OVX A;  3D9W A;  1CV8 A;  1TLO A;  2NQD B;  4BGF A;  4BPV A;  1EWL A;  3H89 A;  2Y6E A;  1F2A A;  4NV7 A;  2E02 A;  3BWK A;  4I04 A;  5CVN B;  1YK8 A;  1EWO A;  1SP4 B;  1ZIV A;  1NPZ A;  2E00 A;  4QRX A;  1KHQ A;  1NL6 A;  2YJB A;  1AYU A;  1O0E A;  1ATK A;  1CJL A;  1W4T A;  4MSX A;  3S3Q A;  1NB3 A;  2PAD A;  1PPP A;  1MS6 A;  3AI8 A;  4NV8 A;  4I05 A;  5JH3 A;  1BQI A;  3KFQ A;  4GUZ A;  4PAD A;  1IWD A;  1Y08 A;  1MEM A;  3CBK A;  4B55 A;  4P6E A;  2IBI A;  3MHH A;  1ME4 A;  3U8E A;  1NLJ A;  1E2T A;  1PXV A;  4AXL A;  1CS8 A;  3H8C A;  1PPD A;  1Y4H A;  2AIM A;  3N4C A;  2DC6 A;  4WA6 A;  2CIO A;  1VJV A;  1W5R A;  2XU5 A;  3P5X A;  2E03 A;  2R9N A;  3C9E A;  2NQI A;  3DF0 A;  4BSQ A;  3H8B A;  3KWB X;  2BSZ A;  3S3R A;  2DCC A;  2FRA A;  4CDE B;  3K8U A;  1F29 A;  4P6G A;  4I07 A;  2Y5B A;  3F75 A;  2DCA A;  1PE6 A;  4AXM A;  6PAD A;  1PAD A;  1THE A;  3ZUA A;  1YK7 A;  2JQG R;  5CHT A;  1GLO A;  3KSE A;  5CVO B;  2DC7 A;  1MEG A;  3KW9 A;  2P86 A;  1U9X A;  1CTE A;  3NHE A;  2BDZ A;  2P0R A;  1A6R A;  4C5P A;  3IHP A;  2G7Y A;  1U9V A;  2CB5 A;  4N8W A;  4XR7 A;  1GX3 A;  5FPW A;  3N3G A;  4ZUX U;  3TNX A;  2OP3 A;  4PI3 A;  1Q6K A;  4XUI A;  3RVW A;  3PDF A;  5EGW A;  4RY2 A;  1YT7 A;  1AYV A;  1AIM A;  2ACT A;  5F02 A;  4DMX A;  3MTN A;  2XU3 A;  4W4U A;  3HD3 A;  2PNS A;  1U9W A;  1ZCM A;  1X9Y A;  2AS8 A;  2FYE A;  2GFO A;  1CPJ A;  3PBH A;  4FIP A;  1TL9 A;  1ME3 A;  5JA7 A;  2FT2 A;  1TU6 A;  4FK5 A;  2E01 A;  1EWP A;  4YYQ A;  1KFU L;  4CDD B;  2PBH A;  1BP4 A;  1ICF A;  1STF E;  1AYW A;  1W6F A;  3F5V A;  3MHS A;  3LXS A;  2FQ9 A;  8PCH A;  3O1G A;  3USV A;  4G54 A;  1PCI A;  1GMY A;  1S4V A;  3H6S A;  1U5I A;  3D6S A;  3BPF A;  1CB5 A;  4YYR A;  3K24 A;  2F7D A;  4YV8 A;  2G8E A;  2P7U A;  2JQF R;  2YJC A;  2OUL A;  2HH5 A;  3CH3 X;  3P5W A;  2NQA A;  4FJC A;  3P5U A;  2AYO A;  1DF0 A;  3KKU A;  4K7C A;  1AEC A;  2OZ2 A;  2R6N A;  4Q8H A;  1F2B A;  2YJ8 A;  2AUX A;  3M99 A;  3OVZ A;  2ARY A;  2H7J A;  4BS6 A;  3RVV A;  1U9Q X;  3OIS A;  2VFC A;  1QOL A;  2FTD A;  3BCN A;  4PP1 A;  4CDF B;  4DMY A;  2VFB A;  3CH2 X;  2YJ2 A;  1AU0 A;  1AU3 A;  2DZY A;  3OF8 A;  3PW3 A;  1GEC E;  4QRG A;  2HXZ A;  4CDC B;  1SNK A;  2FO5 A;  4W5B A;  2XU4 A;  1JQP A;  1QXP A;  2WBF X;  3WXE A;  1EF7 A;  4N79 A;  1YAL A;  2R9M A;  2DCD A;  3E1Z B;  2HHN A;  3BC3 A;  3V6C A;  4YYW A;  3RVX A;  1PPN A;  2HD5 A;  2AU1 A;  3LFY A;  4HWY A;  4N4Z A;  2ATO A;  1BGO A;  3V6E A;  2VHS A;  2C0Y A;  4Q8G A;  1YVB A;  1K3B B;  1MHW A;  3QJ3 A;  3IMA A;  4CZW A;  1QDQ A;  2F1G A;  3I3T A;  3WXG A;  7PCK A;  1BY8 A;  2R9F A;  3N3K A;  1ITO A;  3QT4 A;  5A24 A;  4PP2 E;  1F2C A;  1QMY A;  4X6J A;  4OEL A;  2FRQ A;  3IOQ A;  3KX1 A;  2G8J A;  1PPO A;  2XU1 A;  2GHU A;  2AYN A;  1POP A;  2IPP B;  3GCB A;  2DJG B;  3PNR A;  2R9O A;  3BOW A;  5K16 A;  3B79 A;  5CHV A;  1PIP A;  3O0U A;  4MZS A;  2YJ9 A;  4X6H A;  3OF9 A;  3H7D A;  3IV2 A;  4YYV A;  2PRE A;  3QSD A;  3HWN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...