1NL6A

Crystal structure of the cysteine protease human cathepsin k in complex with a covalent azepanone inhibitor
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Azepanone-based inhibitors of human and rat cathepsin K
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Cathepsin K
total genus 54
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2003-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1nl6A00
2XU4A 4YYUA 3MHSA 1BQIA 2DJGB 4AXLA 5CVOB 1AECA 2IBIA 1GCBA 1SNKA 4N4ZA 2PREA 2FRAA 4I05A 5JH3A 3OVXA 4CDDB 1BP4A 1AU2A 5EF4A 2YJBA 3CH3X 1CB5A 3IOQA 3RVVA 2AU1A 1A6RA 3KSEA 1Y4HA 2R9MA 2FT2A 1CS8A 1MIRA 4BSQA 4Q8GA 4CDCB 4AXMA 3WXEA 1CPJA 1ITOA 3F5VA 3PDFA 3MTNA 2DCBA 2OULA 3ERVA 1AU4A 2YJ9A 3B79A 2R6NA 2FRQA 1GMYA 2AYNA 3H89A 3KWBX 2P7UA 3F75A 4YYRA 1K3BB 2E02A 4QRVA 2CIOA 1AIMA 2GHUA 1NPZA 3CH2X 3E1ZB 3H7DA 1M6DA 4QBBA 4PADA 2NQIA 4DMYA 3D6SA 1CJLA 5JA7A 4BS6A 3KKUA 4YYVA 2R9CA 3PW3A 2YJCA 3AI8A 2XU3A 1AYVA 2HHNA 4BPVA 1Y08A 4XR7A 3P5UA 4N79A 4FK5A 4CDEB 1YALA 1MS6A 2ATOA 2AYOA 4HWYA 3USVA 1YK8A 4MZSA 1X9YA 2XU5A 5CVNB 1PXVA 2FYEA 1EWLA 5J94A 1TL9A 2PBHA 1VSNA 3BWKA 2DCDA 1EWOA 5A24A 1PPOA 4PP2E 2G8EA 2WBFX 3MHHA 1F2AA 1PPPA 6PADA 1TU6A 2IPPB 1BY8A 1MHWA 5CHVA 1ATKA 1ICFA 1CV8A 2FO5A 1POPA 1CQDA 3P5VA 3H8CA 3TNXA 1NB5A 1QOLA 2B1MA 1KFUL 2OP3A 4YV8A 3PNRA 4FIPA 1U9VA 3KX1A 2DC9A 3BPFA 2PNSA 4FJCA 1DEUA 3IEJA 3P5WA 4BS5A 4P6EA 1ZIVA 2G7YA 1AYWA 1AYUA 3N4CA 3PBHA 1U9WA 1U9XA 1U9QX 4QH6A 3IMAA 1PIPA 1ME3A 2HD5A 9PAPA 1DF0A 3S3RA 1AU0A 4W5BA 2DC6A 2R9NA 1F2BA 2AIMA 3S3QA 3BPMA 4X6HA 3HHAA 3ZUAA 1KFXL 3OVZA 1GECE 1S4VA 3H8BA 7PCKA 4QRGA 2PADA 3IV2A 1O0EA 3HWNA 3RVWA 1TLOA 2FUDA 3QJ3A 3MORA 2DZZA 4ZUXU 2F7DA 1NB3A 1PE6A 1IWDA 3NHEA 4MZOA 2HXZA 1GLOA 2AUZA 4X6JA 2NQAA 3N3GA 5EGWA 3N3KA 5CHTA 2HH5A 2CB5A 4OELA 1U5IA 4YVAA 2VHSA 4P6GA 2BDLA 2YJ2A 3IHPA 4N8WA 1YT7A 3CBJA 1SP4B 4XUIA 1CSBB 1CVZA 5PADA 1EWMA 2DJFB 2R9OA 4DMXA 3IUTA 3GCBA 3K24A 2NQGA 4BQVA 3I06A 3P5XA 3KWZA 1PPDA 2P0RA 2YJ8A 3KFQA 4QRXA 2NQDB 1NQCA 2DCCA 1F29A 1Q6KA 2VHFA 1PCIA 1EF7A 3V6CA 3I3TA 4PP1A 3QSDA 3BOWA 4CDFB 3C9EA 1KXRA 2DC8A 5CVMA 4K7CA 1KHQA 1JQPA 1CTEA 1QXPA 4X6IA 2FQ9A 3H6SA 5F02A 3LXSA 1MDWA 1QDQA 1YVBA 3RVXA 3OISA 3K8UA 3V6EA 5FPWA 4CZWA 2G6DA 3M99A 1BGOA 2C0YA 1F2CA 2DZYA 4YYQA 3QT4A 5K16A 2R9FA 1AU3A 2XU1A 2E01A 4OEMA 3LFYA 1QMYA 3KW9A 1ME4A 2DCAA 1MEMA 4KLBA 4I04A 3CBKA 1HUCB 3HD3A 1MEGA 2B1NA 1EWPA 2F1GA 3BC3A 2BDZA 2GFOA 2AUXA 3BCNA 1NLJA 3DF0A 2OZ2A 2P86A 1KHPA 4YYSA 1PADA 2AS8A 4WA6A 4G54A 3K9MA 1PBHA 4RY2A 4W5CA 4I07A 4MSXA 2E03A 3OF9A 2DC7A 2E00A 2FTDA 4Q8HA 1PPNA 4YYWA 2H7JA 3WXFA 2JQGR 2JQFR 3OF8A 2O6XA 2ACTA 3HHIA 8PCHA 1STFE 1VJVA 1XKGA 3O1GA 2ARYA 2G8JA 1THEA 4PI3A 1YK7A 2AVWA 1ZCMA 4W4UA 3U8EA 1FH0A 2Y6EA 2Y5BA 1NL6A 3O0UA 3WXGA
chains in the Genus database with same CATH superfamily
2XU4A 4YYUA 3MHSA 4BOUA 2DOSA 1BQIA 2DJGB 4AXLA 5CVOB 5JZEA 1AECA 2IBIA 3BY4A 1GCBA 1SNKA 4N4ZA 2PREA 3IFUA 2FRAA 4I05A 5JH3A 2AGAA 3OVXA 4CDDB 1BP4A 1AU2A 5EF4A 2YJBA 3CH3X 1CB5A 3IOQA 3RVVA 2AU1A 2JRIA 1A6RA 3KSEA 1Y4HA 4BOSA 2R9MA 2FT2A 1CS8A 1MIRA 4OW0A 4BSQA 4Q8GA 4CDCB 3PT2A 4AXMA 3WXEA 1CPJA 1ITOA 3F5VA 3PDFA 3MTNA 4A5UA 2DCBA 2OULA 3ERVA 1AU4A 2YJ9A 3B79A 2R6NA 2FRQA 4D8IA 1GMYA 2AYNA 3H89A 3KWBX 2P7UA 3F75A 4YYRA 1K3BB 2E02A 4QRVA 4GUAA 2CIOA 1AIMA 2GHUA 1NPZA 3CH2X 3E1ZB 3H7DA 4M0WA 1M6DA 4QBBA 4PADA 2NQIA 4DMYA 3D6SA 3PHUA 1CJLA 5JA7A 4BS6A 1DKIA 3KKUA 4YYVA 2R9CA 3PW3A 2YJCA 3AI8A 2XU3A 1AYVA 2HHNA 4BPVA 1Y08A 4XR7A 4HXDB 3P5UA 4N79A 4FK5A 4CDEB 1YALA 1MS6A 2ATOA 2AYOA 4HWYA 3USVA 1YK8A 4MZSA 1YZBA 1X9YA 3TMPA 2XU5A 5CVNB 1PXVA 2FYEA 1EWLA 3C0RA 5J94A 1TL9A 3MP2A 2PBHA 1VSNA 3BWKA 2DCDA 1EWOA 5A24A 1PPOA 4PP2E 4D8BA 2G8EA 2WBFX 1PVJA 3MHHA 1F2AA 1PPPA 6PADA 1TU6A 2IPPB 1BY8A 1MHWA 5CHVA 1ATKA 1ICFA 4RKXA 1CV8A 2FO5A 1POPA 4PT5A 1CQDA 3P5VA 3H8CA 3TNXA 1NB5A 1QOLA 2B1MA 1KFUL 2OP3A 3RNVA 4YV8A 3PNRA 4FIPA 4OVZB 1U9VA 3KX1A 2DC9A 3BPFA 2PNSA 4FJCA 1DEUA 3IEJA 3E9SA 3P5WA 4BS5A 4P6EA 1ZIVA 2G7YA 1AYWA 1AYUA 3N4CA 3PBHA 1U9WA 2BU3A 1U9XA 3TRKA 1U9QX 4QH6A 2BTWB 3IMAA 1PIPA 1ME3A 2HD5A 9PAPA 1DF0A 3S3RA 2HWKA 1AU0A 4W5BA 2DC6A 2R9NA 1F2BA 2AIMA 4RNAA 3S3QA 3BPMA 4X6HA 3PHXA 3HHAA 3ZUAA 1KFXL 3OVZA 1GECE 1S4VA 3H8BA 7PCKA 4QRGA 3OQCA 2PADA 3IV2A 1O0EA 3HWNA 3RVWA 1TLOA 2FUDA 3PSEA 3QJ3A 3MORA 2DZZA 4ZUXU 5EZQA 2F7DA 1NB3A 4WURA 2Z84A 1PE6A 1IWDA 3NHEA 4MZOA 2HXZA 1GLOA 2AUZA 5EZSA 4X6JA 2NQAA 3N3GA 2J7QA 3N3KA 5EGWA 5CHTA 2HH5A 2CB5A 4OELA 1U5IA 5KO3A 4YVAA 2VHSA 3BB7A 4P6GA 2BDLA 2YJ2A 3IHPA 4N8WA 1YT7A 4BOPA 4RF0A 3CBJA 1SP4B 4XUIA 1CSBB 1CVZA 5PADA 1EWMA 2DJFB 2R9OA 4DMXA 3ZNHA 3IUTA 3GCBA 3K24A 4MI7A 2NQGA 3PHWA 2UZJA 4BQVA 3I06A 3P5XA 3KWZA 1PPDA 2P0RA 3B21A 2YJ8A 3KFQA 4QRXA 2NQDB 2J7QC 1NQCA 2DCCA 1F29A 1Q6KA 2VHFA 4BOQA 1PCIA 1EF7A 3V6CA 3I3TA 4PP1A 3QSDA 3BOWA 3MTVA 4REZA 4CDFB 3C9EA 1KXRA 2DC8A 5CVMA 4K7CA 1KHQA 1JQPA 1CTEA 1QXPA 4X6IA 2FQ9A 3H6SA 5F02A 3LXSA 1MDWA 5E6JA 1QDQA 1UKFA 1YVBA 3RVXA 3OISA 3K8UA 2FE8A 3V6EA 5FPWA 4CZWA 2G6DA 3PRMA 3PRPA 3M99A 2JTCA 4IUMA 1BGOA 2C0YA 1F2CA 2DZYA 4YYQA 3QT4A 5K16A 2R9FA 1AU3A 2XU1A 2E01A 4OEMA 3LFYA 1QMYA 3KW9A 1ME4A 2DCAA 1MEMA 4KLBA 4BOZA 4I04A 4P16A 3CBKA 1HUCB 3HD3A 1MEGA 2B1NA 1EWPA 3BC3A 2F1GA 2BDZA 4RF1A 2GFOA 2AUXA 3BCNA 1NLJA 4XZXA 3DF0A 2OZ2A 2P86A 1KHPA 4YYSA 3W31A 1PADA 4D8EA 4OVZA 2AS8A 4WA6A 4G54A 3K9MA 4I07A 4MSXA 1PBHA 4RY2A 4W5CA 2E03A 3OF9A 2DC7A 2E00A 2FTDA 3BBAA 4Q8HA 1PPNA 4YYWA 2H7JA 2BTWA 3WXFA 2JQGR 2JQFR 3OF8A 3O65A 2O6XA 2ACTA 3MJ5A 3HHIA 8PCHA 1STFE 1VJVA 1XKGA 4R3DA 4IP3A 3W30A 3O1GA 2ARYA 2G8JA 1THEA 4MM3B 4ZTBA 4PI3A 1YK7A 2AVWA 1ZCMA 4W4UA 3U8EA 1FH0A 2Y6EA 2Y5BA 1NL6A 3O0UA 3WXGA
chains in the Genus database with same CATH topology
2XU4A 4YYUA 3MHSA 1BQIA 2DJGB 2VFCA 5CVOB 4AXLA 1AECA 2IBIA 1GCBA 1SNKA 4N4ZA 2BSZA 2PREA 2FRAA 4I05A 5JH3A 3OVXA 4CDDB 1BP4A 1W4TA 1AU2A 5EF4A 2YJBA 3CH3X 1CB5A 3IOQA 3RVVA 2AU1A 1A6RA 3KSEA 1Y4HA 2R9MA 2FT2A 1CS8A 1MIRA 4BSQA 4Q8GA 4CDCB 4AXMA 3WXEA 1CPJA 1ITOA 3F5VA 3PDFA 3MTNA 2DCBA 2OULA 3ERVA 1AU4A 2YJ9A 3B79A 2R6NA 2FRQA 1GMYA 2AYNA 3H89A 3KWBX 2P7UA 3D9WA 3F75A 4YYRA 1K3BB 2E02A 1GX3A 4QRVA 2CIOA 1AIMA 2GHUA 1NPZA 3CH2X 3E1ZB 3H7DA 4NV7A 1M6DA 4QBBA 4PADA 2NQIA 4GUZA 4DMYA 3D6SA 1CJLA 5JA7A 4BS6A 3KKUA 4YYVA 2R9CA 3PW3A 2YJCA 3AI8A 2XU3A 1AYVA 2HHNA 4BPVA 1Y08A 4XR7A 3P5UA 4N79A 4FK5A 4CDEB 1YALA 1E2TA 1MS6A 2ATOA 2AYOA 4HWYA 3USVA 1YK8A 4MZSA 1X9YA 2XU5A 5CVNB 1PXVA 2FYEA 1EWLA 5J94A 1TL9A 2PBHA 1VSNA 3BWKA 2DCDA 1EWOA 5A24A 1PPOA 4PP2E 1W6FA 2G8EA 2WBFX 3MHHA 1F2AA 1PPPA 6PADA 1TU6A 2IPPB 1BY8A 1MHWA 5CHVA 1ATKA 1ICFA 1CV8A 2FO5A 1POPA 1CQDA 3P5VA 1W5RA 3H8CA 3TNXA 1NB5A 1QOLA 2B1MA 1KFUL 2OP3A 4YV8A 3PNRA 4FIPA 1U9VA 3KX1A 2DC9A 3BPFA 2PNSA 4FJCA 1DEUA 3IEJA 3P5WA 4BS5A 4P6EA 1ZIVA 2G7YA 1AYWA 1AYUA 3N4CA 3PBHA 1U9WA 1U9XA 1U9QX 4QH6A 3IMAA 1PIPA 1ME3A 2HD5A 9PAPA 1DF0A 3S3RA 1AU0A 4W5BA 2DC6A 2R9NA 1F2BA 2AIMA 3S3QA 3BPMA 4X6HA 3HHAA 4B55A 3ZUAA 1KFXL 3OVZA 1GECE 1S4VA 3H8BA 7PCKA 4QRGA 2PADA 3IV2A 1O0EA 3HWNA 3RVWA 1TLOA 2FUDA 3QJ3A 3MORA 2DZZA 4ZUXU 2F7DA 1NB3A 1PE6A 1IWDA 3NHEA 4MZOA 2HXZA 1GLOA 2AUZA 4X6JA 2NQAA 3N3GA 5EGWA 3N3KA 5CHTA 2HH5A 2CB5A 4OELA 1U5IA 4YVAA 2VHSA 4P6GA 2BDLA 2YJ2A 3IHPA 4N8WA 1YT7A 3CBJA 1SP4B 4XUIA 1CSBB 1CVZA 5PADA 1EWMA 2DJFB 2R9OA 4DMXA 3IUTA 3GCBA 3K24A 2NQGA 4BGFA 4BQVA 3I06A 3P5XA 3KWZA 1PPDA 2P0RA 2YJ8A 3KFQA 4QRXA 2NQDB 1NQCA 2DCCA 1F29A 1Q6KA 2VHFA 1PCIA 1EF7A 3V6CA 3I3TA 4PP1A 3QSDA 3BOWA 4CDFB 3C9EA 1KXRA 2DC8A 5CVMA 4K7CA 1KHQA 1JQPA 1CTEA 1QXPA 4X6IA 2FQ9A 3H6SA 5F02A 3LXSA 1MDWA 1QDQA 1YVBA 3RVXA 3OISA 3K8UA 3V6EA 5FPWA 4NV8A 4CZWA 2G6DA 3M99A 1BGOA 2C0YA 1F2CA 2DZYA 4YYQA 3QT4A 5K16A 2R9FA 1AU3A 2XU1A 2E01A 4OEMA 3LFYA 1QMYA 3KW9A 1ME4A 2DCAA 1MEMA 4KLBA 4I04A 3CBKA 1HUCB 3HD3A 1MEGA 2B1NA 1EWPA 3BC3A 2F1GA 2BDZA 2VFBA 2GFOA 2AUXA 3BCNA 1NLJA 3DF0A 2OZ2A 2P86A 3LTWA 1KHPA 4YYSA 1PADA 2AS8A 4C5PA 4WA6A 4G54A 3K9MA 1PBHA 4RY2A 4W5CA 4I07A 4MSXA 2E03A 3OF9A 2DC7A 2E00A 2FTDA 4Q8HA 1PPNA 4YYWA 2H7JA 3WXFA 2JQGR 2JQFR 3OF8A 2O6XA 2ACTA 3HHIA 8PCHA 1STFE 1VJVA 1XKGA 3O1GA 2ARYA 2G8JA 1THEA 4PI3A 1YK7A 2AVWA 1ZCMA 4W4UA 3U8EA 1FH0A 2Y6EA 2Y5BA 1NL6A 3O0UA 3WXGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XU4 A;  4YYU A;  3MHS A;  1BQI A;  2DJG B;  4AXL A;  5CVO B;  1AEC A;  2IBI A;  1GCB A;  1SNK A;  4N4Z A;  2PRE A;  2FRA A;  4I05 A;  5JH3 A;  3OVX A;  4CDD B;  1BP4 A;  1AU2 A;  5EF4 A;  2YJB A;  3CH3 X;  1CB5 A;  3IOQ A;  3RVV A;  2AU1 A;  1A6R A;  3KSE A;  1Y4H A;  2R9M A;  2FT2 A;  1CS8 A;  1MIR A;  4BSQ A;  4Q8G A;  4CDC B;  4AXM A;  3WXE A;  1CPJ A;  1ITO A;  3F5V A;  3PDF A;  3MTN A;  2DCB A;  2OUL A;  3ERV A;  1AU4 A;  2YJ9 A;  3B79 A;  2R6N A;  2FRQ A;  1GMY A;  2AYN A;  3H89 A;  3KWB X;  2P7U A;  3F75 A;  4YYR A;  1K3B B;  2E02 A;  4QRV A;  2CIO A;  1AIM A;  2GHU A;  1NPZ A;  3CH2 X;  3E1Z B;  3H7D A;  1M6D A;  4QBB A;  4PAD A;  2NQI A;  4DMY A;  3D6S A;  1CJL A;  5JA7 A;  4BS6 A;  3KKU A;  4YYV A;  2R9C A;  3PW3 A;  2YJC A;  3AI8 A;  2XU3 A;  1AYV A;  2HHN A;  4BPV A;  1Y08 A;  4XR7 A;  3P5U A;  4N79 A;  4FK5 A;  4CDE B;  1YAL A;  1MS6 A;  2ATO A;  2AYO A;  4HWY A;  3USV A;  1YK8 A;  4MZS A;  1X9Y A;  2XU5 A;  5CVN B;  1PXV A;  2FYE A;  1EWL A;  5J94 A;  1TL9 A;  2PBH A;  1VSN A;  3BWK A;  2DCD A;  1EWO A;  5A24 A;  1PPO A;  4PP2 E;  2G8E A;  2WBF X;  3MHH A;  1F2A A;  1PPP A;  6PAD A;  1TU6 A;  2IPP B;  1BY8 A;  1MHW A;  5CHV A;  1ATK A;  1ICF A;  1CV8 A;  2FO5 A;  1POP A;  1CQD A;  3P5V A;  3H8C A;  3TNX A;  1NB5 A;  1QOL A;  2B1M A;  1KFU L;  2OP3 A;  4YV8 A;  3PNR A;  4FIP A;  1U9V A;  3KX1 A;  2DC9 A;  3BPF A;  2PNS A;  4FJC A;  1DEU A;  3IEJ A;  3P5W A;  4BS5 A;  4P6E A;  1ZIV A;  2G7Y A;  1AYW A;  1AYU A;  3N4C A;  3PBH A;  1U9W A;  1U9X A;  1U9Q X;  4QH6 A;  3IMA A;  1PIP A;  1ME3 A;  2HD5 A;  9PAP A;  1DF0 A;  3S3R A;  1AU0 A;  4W5B A;  2DC6 A;  2R9N A;  1F2B A;  2AIM A;  3S3Q A;  3BPM A;  4X6H A;  3HHA A;  3ZUA A;  1KFX L;  3OVZ A;  1GEC E;  1S4V A;  3H8B A;  7PCK A;  4QRG A;  2PAD A;  3IV2 A;  1O0E A;  3HWN A;  3RVW A;  1TLO A;  2FUD A;  3QJ3 A;  3MOR A;  2DZZ A;  4ZUX U;  2F7D A;  1NB3 A;  1PE6 A;  1IWD A;  3NHE A;  4MZO A;  2HXZ A;  1GLO A;  2AUZ A;  4X6J A;  2NQA A;  3N3G A;  5EGW A;  3N3K A;  5CHT A;  2HH5 A;  2CB5 A;  4OEL A;  1U5I A;  4YVA A;  2VHS A;  4P6G A;  2BDL A;  2YJ2 A;  3IHP A;  4N8W A;  1YT7 A;  3CBJ A;  1SP4 B;  4XUI A;  1CSB B;  1CVZ A;  5PAD A;  1EWM A;  2DJF B;  2R9O A;  4DMX A;  3IUT A;  3GCB A;  3K24 A;  2NQG A;  4BQV A;  3I06 A;  3P5X A;  3KWZ A;  1PPD A;  2P0R A;  2YJ8 A;  3KFQ A;  4QRX A;  2NQD B;  1NQC A;  2DCC A;  1F29 A;  1Q6K A;  2VHF A;  1PCI A;  1EF7 A;  3V6C A;  3I3T A;  4PP1 A;  3QSD A;  3BOW A;  4CDF B;  3C9E A;  1KXR A;  2DC8 A;  5CVM A;  4K7C A;  1KHQ A;  1JQP A;  1CTE A;  1QXP A;  4X6I A;  2FQ9 A;  3H6S A;  5F02 A;  3LXS A;  1MDW A;  1QDQ A;  1YVB A;  3RVX A;  3OIS A;  3K8U A;  3V6E A;  5FPW A;  4CZW A;  2G6D A;  3M99 A;  1BGO A;  2C0Y A;  1F2C A;  2DZY A;  4YYQ A;  3QT4 A;  5K16 A;  2R9F A;  1AU3 A;  2XU1 A;  2E01 A;  4OEM A;  3LFY A;  1QMY A;  3KW9 A;  1ME4 A;  2DCA A;  1MEM A;  4KLB A;  4I04 A;  3CBK A;  1HUC B;  3HD3 A;  1MEG A;  2B1N A;  1EWP A;  2F1G A;  3BC3 A;  2BDZ A;  2GFO A;  2AUX A;  3BCN A;  1NLJ A;  3DF0 A;  2OZ2 A;  2P86 A;  1KHP A;  4YYS A;  1PAD A;  2AS8 A;  4WA6 A;  4G54 A;  3K9M A;  1PBH A;  4RY2 A;  4W5C A;  4I07 A;  4MSX A;  2E03 A;  3OF9 A;  2DC7 A;  2E00 A;  2FTD A;  4Q8H A;  1PPN A;  4YYW A;  2H7J A;  3WXF A;  2JQG R;  2JQF R;  3OF8 A;  2O6X A;  2ACT A;  3HHI A;  8PCH A;  1STF E;  1VJV A;  1XKG A;  3O1G A;  2ARY A;  2G8J A;  1THE A;  4PI3 A;  1YK7 A;  2AVW A;  1ZCM A;  4W4U A;  3U8E A;  1FH0 A;  2Y6E A;  2Y5B A;  1NL6 A;  3O0U A;  3WXG A; 
#chains in the Genus database with same CATH topology
 2XU4 A;  4YYU A;  3MHS A;  4BOU A;  2DOS A;  1BQI A;  2DJG B;  4AXL A;  5CVO B;  5JZE A;  1AEC A;  2IBI A;  3BY4 A;  1GCB A;  1SNK A;  4N4Z A;  2PRE A;  3IFU A;  2FRA A;  4I05 A;  5JH3 A;  2AGA A;  3OVX A;  4CDD B;  1BP4 A;  1AU2 A;  5EF4 A;  2YJB A;  3CH3 X;  1CB5 A;  3IOQ A;  3RVV A;  2AU1 A;  2JRI A;  1A6R A;  3KSE A;  1Y4H A;  4BOS A;  2R9M A;  2FT2 A;  1CS8 A;  1MIR A;  4OW0 A;  4BSQ A;  4Q8G A;  4CDC B;  3PT2 A;  4AXM A;  3WXE A;  1CPJ A;  1ITO A;  3F5V A;  3PDF A;  3MTN A;  4A5U A;  2DCB A;  2OUL A;  3ERV A;  1AU4 A;  2YJ9 A;  3B79 A;  2R6N A;  2FRQ A;  4D8I A;  1GMY A;  2AYN A;  3H89 A;  3KWB X;  2P7U A;  3F75 A;  4YYR A;  1K3B B;  2E02 A;  4QRV A;  4GUA A;  2CIO A;  1AIM A;  2GHU A;  1NPZ A;  3CH2 X;  3E1Z B;  3H7D A;  4M0W A;  1M6D A;  4QBB A;  4PAD A;  2NQI A;  4DMY A;  3D6S A;  3PHU A;  1CJL A;  5JA7 A;  4BS6 A;  1DKI A;  3KKU A;  4YYV A;  2R9C A;  3PW3 A;  2YJC A;  3AI8 A;  2XU3 A;  1AYV A;  2HHN A;  4BPV A;  1Y08 A;  4XR7 A;  4HXD B;  3P5U A;  4N79 A;  4FK5 A;  4CDE B;  1YAL A;  1MS6 A;  2ATO A;  2AYO A;  4HWY A;  3USV A;  1YK8 A;  4MZS A;  1YZB A;  1X9Y A;  3TMP A;  2XU5 A;  5CVN B;  1PXV A;  2FYE A;  1EWL A;  3C0R A;  5J94 A;  1TL9 A;  3MP2 A;  2PBH A;  1VSN A;  3BWK A;  2DCD A;  1EWO A;  5A24 A;  1PPO A;  4PP2 E;  4D8B A;  2G8E A;  2WBF X;  1PVJ A;  3MHH A;  1F2A A;  1PPP A;  6PAD A;  1TU6 A;  2IPP B;  1BY8 A;  1MHW A;  5CHV A;  1ATK A;  1ICF A;  4RKX A;  1CV8 A;  2FO5 A;  1POP A;  4PT5 A;  1CQD A;  3P5V A;  3H8C A;  3TNX A;  1NB5 A;  1QOL A;  2B1M A;  1KFU L;  2OP3 A;  3RNV A;  4YV8 A;  3PNR A;  4FIP A;  4OVZ B;  1U9V A;  3KX1 A;  2DC9 A;  3BPF A;  2PNS A;  4FJC A;  1DEU A;  3IEJ A;  3E9S A;  3P5W A;  4BS5 A;  4P6E A;  1ZIV A;  2G7Y A;  1AYW A;  1AYU A;  3N4C A;  3PBH A;  1U9W A;  2BU3 A;  1U9X A;  3TRK A;  1U9Q X;  4QH6 A;  2BTW B;  3IMA A;  1PIP A;  1ME3 A;  2HD5 A;  9PAP A;  1DF0 A;  3S3R A;  2HWK A;  1AU0 A;  4W5B A;  2DC6 A;  2R9N A;  1F2B A;  2AIM A;  4RNA A;  3S3Q A;  3BPM A;  4X6H A;  3PHX A;  3HHA A;  3ZUA A;  1KFX L;  3OVZ A;  1GEC E;  1S4V A;  3H8B A;  7PCK A;  4QRG A;  3OQC A;  2PAD A;  3IV2 A;  1O0E A;  3HWN A;  3RVW A;  1TLO A;  2FUD A;  3PSE A;  3QJ3 A;  3MOR A;  2DZZ A;  4ZUX U;  5EZQ A;  2F7D A;  1NB3 A;  4WUR A;  2Z84 A;  1PE6 A;  1IWD A;  3NHE A;  4MZO A;  2HXZ A;  1GLO A;  2AUZ A;  5EZS A;  4X6J A;  2NQA A;  3N3G A;  2J7Q A;  3N3K A;  5EGW A;  5CHT A;  2HH5 A;  2CB5 A;  4OEL A;  1U5I A;  5KO3 A;  4YVA A;  2VHS A;  3BB7 A;  4P6G A;  2BDL A;  2YJ2 A;  3IHP A;  4N8W A;  1YT7 A;  4BOP A;  4RF0 A;  3CBJ A;  1SP4 B;  4XUI A;  1CSB B;  1CVZ A;  5PAD A;  1EWM A;  2DJF B;  2R9O A;  4DMX A;  3ZNH A;  3IUT A;  3GCB A;  3K24 A;  4MI7 A;  2NQG A;  3PHW A;  2UZJ A;  4BQV A;  3I06 A;  3P5X A;  3KWZ A;  1PPD A;  2P0R A;  3B21 A;  2YJ8 A;  3KFQ A;  4QRX A;  2NQD B;  2J7Q C;  1NQC A;  2DCC A;  1F29 A;  1Q6K A;  2VHF A;  4BOQ A;  1PCI A;  1EF7 A;  3V6C A;  3I3T A;  4PP1 A;  3QSD A;  3BOW A;  3MTV A;  4REZ A;  4CDF B;  3C9E A;  1KXR A;  2DC8 A;  5CVM A;  4K7C A;  1KHQ A;  1JQP A;  1CTE A;  1QXP A;  4X6I A;  2FQ9 A;  3H6S A;  5F02 A;  3LXS A;  1MDW A;  5E6J A;  1QDQ A;  1UKF A;  1YVB A;  3RVX A;  3OIS A;  3K8U A;  2FE8 A;  3V6E A;  5FPW A;  4CZW A;  2G6D A;  3PRM A;  3PRP A;  3M99 A;  2JTC A;  4IUM A;  1BGO A;  2C0Y A;  1F2C A;  2DZY A;  4YYQ A;  3QT4 A;  5K16 A;  2R9F A;  1AU3 A;  2XU1 A;  2E01 A;  4OEM A;  3LFY A;  1QMY A;  3KW9 A;  1ME4 A;  2DCA A;  1MEM A;  4KLB A;  4BOZ A;  4I04 A;  4P16 A;  3CBK A;  1HUC B;  3HD3 A;  1MEG A;  2B1N A;  1EWP A;  3BC3 A;  2F1G A;  2BDZ A;  4RF1 A;  2GFO A;  2AUX A;  3BCN A;  1NLJ A;  4XZX A;  3DF0 A;  2OZ2 A;  2P86 A;  1KHP A;  4YYS A;  3W31 A;  1PAD A;  4D8E A;  4OVZ A;  2AS8 A;  4WA6 A;  4G54 A;  3K9M A;  4I07 A;  4MSX A;  1PBH A;  4RY2 A;  4W5C A;  2E03 A;  3OF9 A;  2DC7 A;  2E00 A;  2FTD A;  3BBA A;  4Q8H A;  1PPN A;  4YYW A;  2H7J A;  2BTW A;  3WXF A;  2JQG R;  2JQF R;  3OF8 A;  3O65 A;  2O6X A;  2ACT A;  3MJ5 A;  3HHI A;  8PCH A;  1STF E;  1VJV A;  1XKG A;  4R3D A;  4IP3 A;  3W30 A;  3O1G A;  2ARY A;  2G8J A;  1THE A;  4MM3 B;  4ZTB A;  4PI3 A;  1YK7 A;  2AVW A;  1ZCM A;  4W4U A;  3U8E A;  1FH0 A;  2Y6E A;  2Y5B A;  1NL6 A;  3O0U A;  3WXG A; 
#chains in the Genus database with same CATH homology
 2XU4 A;  4YYU A;  3MHS A;  1BQI A;  2DJG B;  2VFC A;  5CVO B;  4AXL A;  1AEC A;  2IBI A;  1GCB A;  1SNK A;  4N4Z A;  2BSZ A;  2PRE A;  2FRA A;  4I05 A;  5JH3 A;  3OVX A;  4CDD B;  1BP4 A;  1W4T A;  1AU2 A;  5EF4 A;  2YJB A;  3CH3 X;  1CB5 A;  3IOQ A;  3RVV A;  2AU1 A;  1A6R A;  3KSE A;  1Y4H A;  2R9M A;  2FT2 A;  1CS8 A;  1MIR A;  4BSQ A;  4Q8G A;  4CDC B;  4AXM A;  3WXE A;  1CPJ A;  1ITO A;  3F5V A;  3PDF A;  3MTN A;  2DCB A;  2OUL A;  3ERV A;  1AU4 A;  2YJ9 A;  3B79 A;  2R6N A;  2FRQ A;  1GMY A;  2AYN A;  3H89 A;  3KWB X;  2P7U A;  3D9W A;  3F75 A;  4YYR A;  1K3B B;  2E02 A;  1GX3 A;  4QRV A;  2CIO A;  1AIM A;  2GHU A;  1NPZ A;  3CH2 X;  3E1Z B;  3H7D A;  4NV7 A;  1M6D A;  4QBB A;  4PAD A;  2NQI A;  4GUZ A;  4DMY A;  3D6S A;  1CJL A;  5JA7 A;  4BS6 A;  3KKU A;  4YYV A;  2R9C A;  3PW3 A;  2YJC A;  3AI8 A;  2XU3 A;  1AYV A;  2HHN A;  4BPV A;  1Y08 A;  4XR7 A;  3P5U A;  4N79 A;  4FK5 A;  4CDE B;  1YAL A;  1E2T A;  1MS6 A;  2ATO A;  2AYO A;  4HWY A;  3USV A;  1YK8 A;  4MZS A;  1X9Y A;  2XU5 A;  5CVN B;  1PXV A;  2FYE A;  1EWL A;  5J94 A;  1TL9 A;  2PBH A;  1VSN A;  3BWK A;  2DCD A;  1EWO A;  5A24 A;  1PPO A;  4PP2 E;  1W6F A;  2G8E A;  2WBF X;  3MHH A;  1F2A A;  1PPP A;  6PAD A;  1TU6 A;  2IPP B;  1BY8 A;  1MHW A;  5CHV A;  1ATK A;  1ICF A;  1CV8 A;  2FO5 A;  1POP A;  1CQD A;  3P5V A;  1W5R A;  3H8C A;  3TNX A;  1NB5 A;  1QOL A;  2B1M A;  1KFU L;  2OP3 A;  4YV8 A;  3PNR A;  4FIP A;  1U9V A;  3KX1 A;  2DC9 A;  3BPF A;  2PNS A;  4FJC A;  1DEU A;  3IEJ A;  3P5W A;  4BS5 A;  4P6E A;  1ZIV A;  2G7Y A;  1AYW A;  1AYU A;  3N4C A;  3PBH A;  1U9W A;  1U9X A;  1U9Q X;  4QH6 A;  3IMA A;  1PIP A;  1ME3 A;  2HD5 A;  9PAP A;  1DF0 A;  3S3R A;  1AU0 A;  4W5B A;  2DC6 A;  2R9N A;  1F2B A;  2AIM A;  3S3Q A;  3BPM A;  4X6H A;  3HHA A;  4B55 A;  3ZUA A;  1KFX L;  3OVZ A;  1GEC E;  1S4V A;  3H8B A;  7PCK A;  4QRG A;  2PAD A;  3IV2 A;  1O0E A;  3HWN A;  3RVW A;  1TLO A;  2FUD A;  3QJ3 A;  3MOR A;  2DZZ A;  4ZUX U;  2F7D A;  1NB3 A;  1PE6 A;  1IWD A;  3NHE A;  4MZO A;  2HXZ A;  1GLO A;  2AUZ A;  4X6J A;  2NQA A;  3N3G A;  5EGW A;  3N3K A;  5CHT A;  2HH5 A;  2CB5 A;  4OEL A;  1U5I A;  4YVA A;  2VHS A;  4P6G A;  2BDL A;  2YJ2 A;  3IHP A;  4N8W A;  1YT7 A;  3CBJ A;  1SP4 B;  4XUI A;  1CSB B;  1CVZ A;  5PAD A;  1EWM A;  2DJF B;  2R9O A;  4DMX A;  3IUT A;  3GCB A;  3K24 A;  2NQG A;  4BGF A;  4BQV A;  3I06 A;  3P5X A;  3KWZ A;  1PPD A;  2P0R A;  2YJ8 A;  3KFQ A;  4QRX A;  2NQD B;  1NQC A;  2DCC A;  1F29 A;  1Q6K A;  2VHF A;  1PCI A;  1EF7 A;  3V6C A;  3I3T A;  4PP1 A;  3QSD A;  3BOW A;  4CDF B;  3C9E A;  1KXR A;  2DC8 A;  5CVM A;  4K7C A;  1KHQ A;  1JQP A;  1CTE A;  1QXP A;  4X6I A;  2FQ9 A;  3H6S A;  5F02 A;  3LXS A;  1MDW A;  1QDQ A;  1YVB A;  3RVX A;  3OIS A;  3K8U A;  3V6E A;  5FPW A;  4NV8 A;  4CZW A;  2G6D A;  3M99 A;  1BGO A;  2C0Y A;  1F2C A;  2DZY A;  4YYQ A;  3QT4 A;  5K16 A;  2R9F A;  1AU3 A;  2XU1 A;  2E01 A;  4OEM A;  3LFY A;  1QMY A;  3KW9 A;  1ME4 A;  2DCA A;  1MEM A;  4KLB A;  4I04 A;  3CBK A;  1HUC B;  3HD3 A;  1MEG A;  2B1N A;  1EWP A;  3BC3 A;  2F1G A;  2BDZ A;  2VFB A;  2GFO A;  2AUX A;  3BCN A;  1NLJ A;  3DF0 A;  2OZ2 A;  2P86 A;  3LTW A;  1KHP A;  4YYS A;  1PAD A;  2AS8 A;  4C5P A;  4WA6 A;  4G54 A;  3K9M A;  1PBH A;  4RY2 A;  4W5C A;  4I07 A;  4MSX A;  2E03 A;  3OF9 A;  2DC7 A;  2E00 A;  2FTD A;  4Q8H A;  1PPN A;  4YYW A;  2H7J A;  3WXF A;  2JQG R;  2JQF R;  3OF8 A;  2O6X A;  2ACT A;  3HHI A;  8PCH A;  1STF E;  1VJV A;  1XKG A;  3O1G A;  2ARY A;  2G8J A;  1THE A;  4PI3 A;  1YK7 A;  2AVW A;  1ZCM A;  4W4U A;  3U8E A;  1FH0 A;  2Y6E A;  2Y5B A;  1NL6 A;  3O0U A;  3WXG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...