3S3RA

Structure of cathepsin b1 from schistosoma mansoni in complex with k11777 inhibitor
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
254
structure length
254
Chain Sequence
VEIPSSFDSRKKWPRCKSIATIRDQSRCGSCWAFGAVEAMSDRSCIQSGGKQNVELSAVDLLSCCESCGLGCEGGILGPAWDYWVKEGIVTGSSKENHAGCEPYPFPKCEHHTKGKYPPCGSKIYKTPRCKQTCQKKYKTPYTQDKHRGKSSYNVKNDEKAIQKEIMKYGPVEAGFTVYEDFLNYKSGIYKHITGETLGGHAIRIIGWGVENKAPYWLIANSWNEDWGENGYFRIVRGRDECSIESEVTAGRIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Inhibition of Cathepsin B Drug Target from the Human Blood Fluke, Schistosoma mansoni.
pubmed doi rcsb
source organism Schistosoma mansoni
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cathepsin B-like peptidase (C01 family)
total genus 79
structure length 254
sequence length 254
chains with identical sequence B, C
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3s3rA00
3N3GA 1AU4A 1CSBB 3QT4A 2OZ2A 1BY8A 4XR7A 3OISA 4CDEB 5JH3A 3V6CA 1QDQA 2DJFB 3S3QA 5CVNB 1X9YA 2ARYA 1CV8A 1AU2A 3OVXA 2E03A 2G8JA 4N4ZA 2NQIA 3D6SA 1ITOA 4FIPA 3USVA 3OF8A 2FUDA 1KFXL 2DCAA 2O6XA 1YT7A 1JQPA 2VHSA 2YJ8A 3RVXA 9PAPA 2R9CA 4BQVA 3E1ZB 3F75A 4BPVA 1AECA 1AU0A 3IHPA 4MZSA 1NB5A 1AYUA 3BCNA 2G8EA 4N8WA 1YALA 3H8CA 1GMYA 3LXSA 2R6NA 4I07A 1Y08A 1EWOA 2Y5BA 3H8BA 7PCKA 2DCBA 2DC7A 1CPJA 3IUTA 2NQGA 1ATKA 4WA6A 4FJCA 2FRAA 1EWLA 2YJCA 1KFUL 3KWBX 3N3KA 3WXFA 1MDWA 2YJBA 3KKUA 1CTEA 4YYRA 3B79A 5EGWA 2HHNA 3DF0A 4QRVA 1EF7A 1MS6A 2G6DA 2FT2A 3PNRA 3H6SA 3CBKA 4QRGA 1CB5A 2CB5A 4MSXA 4CDCB 4G54A 5JA7A 1ME4A 3QSDA 2G7YA 4DMXA 3HD3A 2XU5A 1IWDA 4KLBA 3IV2A 2DC6A 3P5UA 1ZCMA 2YJ2A 1MHWA 3BOWA 1U9VA 2AUXA 4HWYA 1NPZA 4QRXA 4W4UA 2C0YA 3CBJA 1A6RA 1PPDA 1PXVA 3K8UA 2XU4A 2FO5A 3IMAA 2R9MA 2F7DA 2CIOA 3TNXA 5K16A 3OF9A 2H7JA 2DC9A 1DEUA 1CS8A 2R9FA 5PADA 1AYVA 3I06A 2FQ9A 4QH6A 2R9NA 4YYWA 3AI8A 1QMYA 1Y4HA 2E02A 2OP3A 4PI3A 3RVVA 3M99A 3WXGA 2ACTA 2FRQA 5CVMA 2AYNA 2NQAA 1AYWA 1GCBA 3PW3A 3RVWA 4K7CA 1CJLA 2Y6EA 2HH5A 2HD5A 4CZWA 2AYOA 3LFYA 2PBHA 2XU3A 1YK8A 3OVZA 5FPWA 1TU6A 3QJ3A 2BDLA 1KXRA 3ZUAA 2WBFX 2FYEA 4W5CA 3H7DA 3MTNA 2P0RA 1NL6A 1PADA 3PDFA 3P5WA 2E01A 1EWPA 4QBBA 2DC8A 2OULA 4P6EA 4Q8GA 4AXMA 1EWMA 1FH0A 4YVAA 2DCCA 3I3TA 4CDDB 1QOLA 2IBIA 3H89A 2B1NA 1S4VA 2AUZA 1MEMA 4PADA 4I05A 1ZIVA 3GCBA 2P86A 1F29A 1BP4A 2VHFA 1XKGA 1PBHA 4Q8HA 3HWNA 2ATOA 1F2CA 4I04A 2PNSA 4W5BA 3K24A 3P5XA 1PE6A 4PP2E 5F02A 3MORA 1PIPA 1PPOA 1U9QX 4YV8A 4DMYA 1MEGA 3C9EA 3HHIA 1SP4B 2JQFR 1VSNA 3PBHA 4MZOA 8PCHA 3N4CA 2PADA 2YJ9A 3HHAA 5J94A 1VJVA 3MHHA 2F1GA 4BSQA 6PADA 2IPPB 3KX1A 1PPPA 4YYUA 1U9WA 2E00A 3P5VA 1TL9A 2AVWA 3KSEA 2AS8A 2HXZA 1NLJA 1M6DA 4N79A 5CHVA 1SNKA 1PCIA 2DZZA 1CQDA 2NQDB 3MHSA 1NQCA 1THEA 5CHTA 2DCDA 2GFOA 3IOQA 2BDZA 4OEMA 1DF0A 3KWZA 1GECE 1YK7A 1NB3A 3CH2X 1AU3A 1F2AA 1O0EA 3ERVA 2PREA 3U8EA 3O1GA 3BPMA 4X6HA 4FK5A 2R9OA 2P7UA 1STFE 1POPA 1BQIA 3BC3A 3F5VA 1KHQA 4YYVA 2DJGB 4BS6A 3S3RA 4AXLA 2FTDA 2B1MA 3BPFA 4XUIA 4RY2A 1GLOA 4YYSA 1U9XA 1KHPA 4BS5A 3KW9A 4X6JA 2JQGR 1TLOA 2GHUA 1Q6KA 4P6GA 1HUCB 3KFQA 3V6EA 1QXPA 3CH3X 3K9MA 1U5IA 4X6IA 5EF4A 3WXEA 1K3BB 3BWKA 2AU1A 3NHEA 4ZUXU 4YYQA 5A24A 1YVBA 2AIMA 1AIMA 1F2BA 1ME3A 1BGOA 1CVZA 4PP1A 2DZYA 4CDFB 4OELA 1ICFA 3IEJA 3O0UA 1PPNA 5CVOB 2XU1A 1MIRA
chains in the Genus database with same CATH superfamily
3N3GA 1AU4A 1CSBB 3QT4A 2OZ2A 1BY8A 4XR7A 4BOSA 3OISA 4CDEB 5JH3A 3V6CA 1QDQA 2DJFB 3S3QA 5CVNB 1X9YA 2ARYA 1CV8A 3W31A 1AU2A 3OVXA 2E03A 2G8JA 2Z84A 4N4ZA 2NQIA 3D6SA 1DKIA 1ITOA 4FIPA 3USVA 3OF8A 2FUDA 1KFXL 2DCAA 2O6XA 1YT7A 1JQPA 2VHSA 2YJ8A 3RVXA 9PAPA 2R9CA 4BQVA 3E1ZB 3F75A 4BPVA 1AECA 1AU0A 3IHPA 3PRPA 4MZSA 3PSEA 1NB5A 1AYUA 3BCNA 2G8EA 2J7QC 4OVZA 4BOQA 4N8WA 1YALA 3H8CA 1GMYA 3LXSA 2R6NA 4I07A 1Y08A 1EWOA 2Y5BA 3H8BA 7PCKA 2DCBA 2DC7A 1CPJA 3IUTA 2NQGA 1ATKA 4D8BA 4WA6A 4IUMA 4FJCA 2FRAA 1EWLA 2YJCA 3BY4A 1KFUL 4R3DA 3BBAA 3KWBX 3N3KA 3WXFA 1MDWA 2YJBA 3KKUA 1CTEA 3W30A 4YYRA 3TMPA 3B79A 5EGWA 2HHNA 3DF0A 4QRVA 3BB7A 1EF7A 1MS6A 2UZJA 5E6JA 2G6DA 5EZSA 2FT2A 3PNRA 3H6SA 4BOPA 3CBKA 4QRGA 1CB5A 2CB5A 4MSXA 4CDCB 4G54A 5JA7A 1ME4A 3QSDA 2G7YA 4DMXA 3HD3A 2XU5A 1IWDA 4KLBA 3IV2A 2DC6A 3P5UA 4WURA 1ZCMA 2YJ2A 1MHWA 3BOWA 1U9VA 2AUXA 4HWYA 1NPZA 4QRXA 4W4UA 2C0YA 1YZBA 3CBJA 1A6RA 1PPDA 1PXVA 3K8UA 2XU4A 4MI7A 2FO5A 3IMAA 2R9MA 2F7DA 2CIOA 3TNXA 5K16A 3OF9A 2H7JA 2BU3A 2DC9A 1DEUA 1CS8A 2R9FA 5PADA 1AYVA 3I06A 2FQ9A 4QH6A 4BOUA 2R9NA 4YYWA 3AI8A 1QMYA 1Y4HA 2E02A 2OP3A 4PI3A 3RVVA 4RF1A 3M99A 3PHWA 3WXGA 2ACTA 2FRQA 5CVMA 2AYNA 2NQAA 1AYWA 1GCBA 3PW3A 4OW0A 3RVWA 4K7CA 1CJLA 2Y6EA 2HH5A 2HD5A 4CZWA 2AYOA 3LFYA 2PBHA 2XU3A 1YK8A 3OVZA 5FPWA 1TU6A 3QJ3A 2BDLA 4P16A 1KXRA 3ZUAA 2WBFX 3PRMA 2FYEA 4W5CA 3H7DA 3MTNA 2P0RA 1UKFA 1NL6A 2BTWA 1PADA 3PDFA 3P5WA 2E01A 4IP3A 1EWPA 4QBBA 2DC8A 2OULA 4RKXA 4P6EA 4Q8GA 4AXMA 1EWMA 1FH0A 4YVAA 2DCCA 3I3TA 4CDDB 4HXDB 1QOLA 4REZA 2IBIA 3H89A 2B1NA 1S4VA 2AUZA 1MEMA 4PADA 4MM3B 4I05A 1ZIVA 3GCBA 3MJ5A 2P86A 1F29A 1BP4A 2VHFA 5JZEA 1XKGA 1PBHA 4Q8HA 3HWNA 2ATOA 1F2CA 4I04A 3B21A 2PNSA 4D8IA 3O65A 4W5BA 3K24A 3P5XA 1PE6A 4PP2E 5F02A 3MORA 1PIPA 1PPOA 1U9QX 4YV8A 4DMYA 2HWKA 1MEGA 3C9EA 3HHIA 3TRKA 1SP4B 3E9SA 2JQFR 2DOSA 1VSNA 3PBHA 4MZOA 8PCHA 3N4CA 2PADA 2YJ9A 3HHAA 5J94A 1VJVA 3MHHA 2F1GA 4BSQA 6PADA 4GUAA 2IPPB 3KX1A 1PPPA 4YYUA 1U9WA 2E00A 3P5VA 4D8EA 1TL9A 2AVWA 3KSEA 2AS8A 2HXZA 1NLJA 1M6DA 5KO3A 4N79A 5CHVA 1SNKA 4XZXA 1PCIA 2DZZA 1CQDA 2NQDB 3MHSA 3C0RA 1NQCA 1THEA 5CHTA 2DCDA 2GFOA 2BTWB 3IOQA 3PHUA 2BDZA 4OEMA 1DF0A 4A5UA 3KWZA 1GECE 1YK7A 1NB3A 3CH2X 1AU3A 1F2AA 1O0EA 2JTCA 3ERVA 4RF0A 2PREA 3U8EA 3O1GA 3BPMA 4X6HA 4FK5A 2R9OA 2P7UA 4ZTBA 1STFE 1POPA 1BQIA 3PHXA 3BC3A 3F5VA 4RNAA 1KHQA 4YYVA 2DJGB 4BS6A 3S3RA 3RNVA 1PVJA 4AXLA 2FTDA 2B1MA 3BPFA 4XUIA 4RY2A 1GLOA 4YYSA 5EZQA 1U9XA 3MTVA 1KHPA 2J7QA 3MP2A 4BS5A 2JRIA 3OQCA 3KW9A 4X6JA 2JQGR 4OVZB 1TLOA 2GHUA 1Q6KA 4P6GA 1HUCB 3KFQA 3V6EA 1QXPA 3CH3X 3K9MA 1U5IA 4M0WA 4X6IA 5EF4A 3WXEA 1K3BB 3BWKA 2FE8A 2AU1A 3PT2A 3NHEA 4ZUXU 4YYQA 3ZNHA 5A24A 1YVBA 4BOZA 2AIMA 1AIMA 1F2BA 1ME3A 4PT5A 1BGOA 1CVZA 2AGAA 4PP1A 2DZYA 4CDFB 4OELA 1ICFA 3IEJA 3IFUA 3O0UA 1PPNA 5CVOB 2XU1A 1MIRA
chains in the Genus database with same CATH topology
3N3GA 1GX3A 1AU4A 1CSBB 3QT4A 2OZ2A 1BY8A 4XR7A 3OISA 4CDEB 5JH3A 3V6CA 1QDQA 2DJFB 1E2TA 3S3QA 5CVNB 1X9YA 2ARYA 1CV8A 1AU2A 3OVXA 2E03A 2G8JA 4N4ZA 2NQIA 3D6SA 1ITOA 4FIPA 3USVA 3OF8A 2FUDA 1KFXL 2DCAA 2O6XA 1YT7A 1JQPA 2VHSA 2YJ8A 3RVXA 9PAPA 2R9CA 4BQVA 3E1ZB 3F75A 4BPVA 1AECA 1AU0A 3IHPA 4MZSA 1NB5A 4BGFA 1AYUA 3BCNA 2G8EA 4C5PA 4N8WA 1YALA 3H8CA 1GMYA 3LXSA 2R6NA 4I07A 1Y08A 1EWOA 2Y5BA 3H8BA 7PCKA 2DCBA 2DC7A 1CPJA 3IUTA 2NQGA 1ATKA 4WA6A 4FJCA 2FRAA 1EWLA 2YJCA 1KFUL 3KWBX 3N3KA 3WXFA 1MDWA 2YJBA 3KKUA 1CTEA 4YYRA 3B79A 5EGWA 2HHNA 3DF0A 4QRVA 1EF7A 1MS6A 2G6DA 2FT2A 3PNRA 3H6SA 3CBKA 4QRGA 1CB5A 2CB5A 4MSXA 4CDCB 4G54A 5JA7A 1ME4A 3QSDA 4GUZA 2G7YA 4DMXA 3HD3A 2XU5A 1IWDA 4KLBA 3IV2A 2DC6A 3P5UA 1ZCMA 2YJ2A 1MHWA 3BOWA 1U9VA 2AUXA 1W5RA 4HWYA 1NPZA 4QRXA 4W4UA 2VFCA 2C0YA 3CBJA 2VFBA 1A6RA 1PPDA 1PXVA 3K8UA 2XU4A 2FO5A 3IMAA 2R9MA 2F7DA 2CIOA 4B55A 3TNXA 5K16A 3OF9A 2BSZA 2H7JA 2DC9A 1DEUA 1CS8A 2R9FA 4NV7A 5PADA 1AYVA 3I06A 2FQ9A 4QH6A 2R9NA 4YYWA 3AI8A 1QMYA 1Y4HA 2E02A 2OP3A 4PI3A 3RVVA 3M99A 3WXGA 2ACTA 2FRQA 5CVMA 2AYNA 2NQAA 1AYWA 1GCBA 3PW3A 3RVWA 4K7CA 1CJLA 2Y6EA 2HH5A 2HD5A 4CZWA 2AYOA 3LFYA 2PBHA 2XU3A 1YK8A 3OVZA 5FPWA 1TU6A 3QJ3A 2BDLA 1KXRA 3ZUAA 2WBFX 2FYEA 4W5CA 3H7DA 3MTNA 2P0RA 1NL6A 1PADA 3PDFA 3P5WA 2E01A 1EWPA 4QBBA 2DC8A 2OULA 4P6EA 4Q8GA 4AXMA 1EWMA 1FH0A 4YVAA 2DCCA 3I3TA 4CDDB 1QOLA 2IBIA 3H89A 2B1NA 1S4VA 2AUZA 1MEMA 4PADA 4I05A 1ZIVA 3GCBA 2P86A 1F29A 1BP4A 2VHFA 1XKGA 1PBHA 4Q8HA 3HWNA 2ATOA 1F2CA 4I04A 2PNSA 4W5BA 3K24A 3P5XA 1PE6A 4PP2E 5F02A 3MORA 1PIPA 1PPOA 1U9QX 4YV8A 4DMYA 1MEGA 3C9EA 4NV8A 3HHIA 1SP4B 2JQFR 1VSNA 3PBHA 4MZOA 8PCHA 1W6FA 3N4CA 2PADA 2YJ9A 3HHAA 5J94A 1VJVA 3MHHA 2F1GA 4BSQA 6PADA 2IPPB 3KX1A 1PPPA 4YYUA 1U9WA 2E00A 3D9WA 3P5VA 1TL9A 2AVWA 3KSEA 2AS8A 2HXZA 1NLJA 1M6DA 4N79A 5CHVA 1SNKA 1PCIA 2DZZA 1CQDA 2NQDB 3MHSA 1NQCA 1THEA 5CHTA 2DCDA 2GFOA 3IOQA 2BDZA 4OEMA 1DF0A 3KWZA 1GECE 1YK7A 1NB3A 3CH2X 1AU3A 1F2AA 1O0EA 3ERVA 2PREA 3U8EA 3O1GA 3BPMA 4X6HA 4FK5A 2R9OA 2P7UA 1W4TA 1STFE 1POPA 1BQIA 3BC3A 3LTWA 3F5VA 1KHQA 4YYVA 2DJGB 4BS6A 3S3RA 4AXLA 2FTDA 2B1MA 3BPFA 4XUIA 4RY2A 1GLOA 4YYSA 1U9XA 1KHPA 4BS5A 3KW9A 4X6JA 2JQGR 1TLOA 2GHUA 1Q6KA 4P6GA 1HUCB 3KFQA 3V6EA 1QXPA 3CH3X 3K9MA 1U5IA 4X6IA 5EF4A 3WXEA 1K3BB 3BWKA 2AU1A 3NHEA 4ZUXU 4YYQA 5A24A 1YVBA 2AIMA 1AIMA 1F2BA 1ME3A 1BGOA 1CVZA 4PP1A 2DZYA 4CDFB 4OELA 1ICFA 3IEJA 3O0UA 1PPNA 5CVOB 2XU1A 1MIRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N3G A;  1AU4 A;  1CSB B;  3QT4 A;  2OZ2 A;  1BY8 A;  4XR7 A;  3OIS A;  4CDE B;  5JH3 A;  3V6C A;  1QDQ A;  2DJF B;  3S3Q A;  5CVN B;  1X9Y A;  2ARY A;  1CV8 A;  1AU2 A;  3OVX A;  2E03 A;  2G8J A;  4N4Z A;  2NQI A;  3D6S A;  1ITO A;  4FIP A;  3USV A;  3OF8 A;  2FUD A;  1KFX L;  2DCA A;  2O6X A;  1YT7 A;  1JQP A;  2VHS A;  2YJ8 A;  3RVX A;  9PAP A;  2R9C A;  4BQV A;  3E1Z B;  3F75 A;  4BPV A;  1AEC A;  1AU0 A;  3IHP A;  4MZS A;  1NB5 A;  1AYU A;  3BCN A;  2G8E A;  4N8W A;  1YAL A;  3H8C A;  1GMY A;  3LXS A;  2R6N A;  4I07 A;  1Y08 A;  1EWO A;  2Y5B A;  3H8B A;  7PCK A;  2DCB A;  2DC7 A;  1CPJ A;  3IUT A;  2NQG A;  1ATK A;  4WA6 A;  4FJC A;  2FRA A;  1EWL A;  2YJC A;  1KFU L;  3KWB X;  3N3K A;  3WXF A;  1MDW A;  2YJB A;  3KKU A;  1CTE A;  4YYR A;  3B79 A;  5EGW A;  2HHN A;  3DF0 A;  4QRV A;  1EF7 A;  1MS6 A;  2G6D A;  2FT2 A;  3PNR A;  3H6S A;  3CBK A;  4QRG A;  1CB5 A;  2CB5 A;  4MSX A;  4CDC B;  4G54 A;  5JA7 A;  1ME4 A;  3QSD A;  2G7Y A;  4DMX A;  3HD3 A;  2XU5 A;  1IWD A;  4KLB A;  3IV2 A;  2DC6 A;  3P5U A;  1ZCM A;  2YJ2 A;  1MHW A;  3BOW A;  1U9V A;  2AUX A;  4HWY A;  1NPZ A;  4QRX A;  4W4U A;  2C0Y A;  3CBJ A;  1A6R A;  1PPD A;  1PXV A;  3K8U A;  2XU4 A;  2FO5 A;  3IMA A;  2R9M A;  2F7D A;  2CIO A;  3TNX A;  5K16 A;  3OF9 A;  2H7J A;  2DC9 A;  1DEU A;  1CS8 A;  2R9F A;  5PAD A;  1AYV A;  3I06 A;  2FQ9 A;  4QH6 A;  2R9N A;  4YYW A;  3AI8 A;  1QMY A;  1Y4H A;  2E02 A;  2OP3 A;  4PI3 A;  3RVV A;  3M99 A;  3WXG A;  2ACT A;  2FRQ A;  5CVM A;  2AYN A;  2NQA A;  1AYW A;  1GCB A;  3PW3 A;  3RVW A;  4K7C A;  1CJL A;  2Y6E A;  2HH5 A;  2HD5 A;  4CZW A;  2AYO A;  3LFY A;  2PBH A;  2XU3 A;  1YK8 A;  3OVZ A;  5FPW A;  1TU6 A;  3QJ3 A;  2BDL A;  1KXR A;  3ZUA A;  2WBF X;  2FYE A;  4W5C A;  3H7D A;  3MTN A;  2P0R A;  1NL6 A;  1PAD A;  3PDF A;  3P5W A;  2E01 A;  1EWP A;  4QBB A;  2DC8 A;  2OUL A;  4P6E A;  4Q8G A;  4AXM A;  1EWM A;  1FH0 A;  4YVA A;  2DCC A;  3I3T A;  4CDD B;  1QOL A;  2IBI A;  3H89 A;  2B1N A;  1S4V A;  2AUZ A;  1MEM A;  4PAD A;  4I05 A;  1ZIV A;  3GCB A;  2P86 A;  1F29 A;  1BP4 A;  2VHF A;  1XKG A;  1PBH A;  4Q8H A;  3HWN A;  2ATO A;  1F2C A;  4I04 A;  2PNS A;  4W5B A;  3K24 A;  3P5X A;  1PE6 A;  4PP2 E;  5F02 A;  3MOR A;  1PIP A;  1PPO A;  1U9Q X;  4YV8 A;  4DMY A;  1MEG A;  3C9E A;  3HHI A;  1SP4 B;  2JQF R;  1VSN A;  3PBH A;  4MZO A;  8PCH A;  3N4C A;  2PAD A;  2YJ9 A;  3HHA A;  5J94 A;  1VJV A;  3MHH A;  2F1G A;  4BSQ A;  6PAD A;  2IPP B;  3KX1 A;  1PPP A;  4YYU A;  1U9W A;  2E00 A;  3P5V A;  1TL9 A;  2AVW A;  3KSE A;  2AS8 A;  2HXZ A;  1NLJ A;  1M6D A;  4N79 A;  5CHV A;  1SNK A;  1PCI A;  2DZZ A;  1CQD A;  2NQD B;  3MHS A;  1NQC A;  1THE A;  5CHT A;  2DCD A;  2GFO A;  3IOQ A;  2BDZ A;  4OEM A;  1DF0 A;  3KWZ A;  1GEC E;  1YK7 A;  1NB3 A;  3CH2 X;  1AU3 A;  1F2A A;  1O0E A;  3ERV A;  2PRE A;  3U8E A;  3O1G A;  3BPM A;  4X6H A;  4FK5 A;  2R9O A;  2P7U A;  1STF E;  1POP A;  1BQI A;  3BC3 A;  3F5V A;  1KHQ A;  4YYV A;  2DJG B;  4BS6 A;  3S3R A;  4AXL A;  2FTD A;  2B1M A;  3BPF A;  4XUI A;  4RY2 A;  1GLO A;  4YYS A;  1U9X A;  1KHP A;  4BS5 A;  3KW9 A;  4X6J A;  2JQG R;  1TLO A;  2GHU A;  1Q6K A;  4P6G A;  1HUC B;  3KFQ A;  3V6E A;  1QXP A;  3CH3 X;  3K9M A;  1U5I A;  4X6I A;  5EF4 A;  3WXE A;  1K3B B;  3BWK A;  2AU1 A;  3NHE A;  4ZUX U;  4YYQ A;  5A24 A;  1YVB A;  2AIM A;  1AIM A;  1F2B A;  1ME3 A;  1BGO A;  1CVZ A;  4PP1 A;  2DZY A;  4CDF B;  4OEL A;  1ICF A;  3IEJ A;  3O0U A;  1PPN A;  5CVO B;  2XU1 A;  1MIR A; 
#chains in the Genus database with same CATH topology
 3N3G A;  1AU4 A;  1CSB B;  3QT4 A;  2OZ2 A;  1BY8 A;  4XR7 A;  4BOS A;  3OIS A;  4CDE B;  5JH3 A;  3V6C A;  1QDQ A;  2DJF B;  3S3Q A;  5CVN B;  1X9Y A;  2ARY A;  1CV8 A;  3W31 A;  1AU2 A;  3OVX A;  2E03 A;  2G8J A;  2Z84 A;  4N4Z A;  2NQI A;  3D6S A;  1DKI A;  1ITO A;  4FIP A;  3USV A;  3OF8 A;  2FUD A;  1KFX L;  2DCA A;  2O6X A;  1YT7 A;  1JQP A;  2VHS A;  2YJ8 A;  3RVX A;  9PAP A;  2R9C A;  4BQV A;  3E1Z B;  3F75 A;  4BPV A;  1AEC A;  1AU0 A;  3IHP A;  3PRP A;  4MZS A;  3PSE A;  1NB5 A;  1AYU A;  3BCN A;  2G8E A;  2J7Q C;  4OVZ A;  4BOQ A;  4N8W A;  1YAL A;  3H8C A;  1GMY A;  3LXS A;  2R6N A;  4I07 A;  1Y08 A;  1EWO A;  2Y5B A;  3H8B A;  7PCK A;  2DCB A;  2DC7 A;  1CPJ A;  3IUT A;  2NQG A;  1ATK A;  4D8B A;  4WA6 A;  4IUM A;  4FJC A;  2FRA A;  1EWL A;  2YJC A;  3BY4 A;  1KFU L;  4R3D A;  3BBA A;  3KWB X;  3N3K A;  3WXF A;  1MDW A;  2YJB A;  3KKU A;  1CTE A;  3W30 A;  4YYR A;  3TMP A;  3B79 A;  5EGW A;  2HHN A;  3DF0 A;  4QRV A;  3BB7 A;  1EF7 A;  1MS6 A;  2UZJ A;  5E6J A;  2G6D A;  5EZS A;  2FT2 A;  3PNR A;  3H6S A;  4BOP A;  3CBK A;  4QRG A;  1CB5 A;  2CB5 A;  4MSX A;  4CDC B;  4G54 A;  5JA7 A;  1ME4 A;  3QSD A;  2G7Y A;  4DMX A;  3HD3 A;  2XU5 A;  1IWD A;  4KLB A;  3IV2 A;  2DC6 A;  3P5U A;  4WUR A;  1ZCM A;  2YJ2 A;  1MHW A;  3BOW A;  1U9V A;  2AUX A;  4HWY A;  1NPZ A;  4QRX A;  4W4U A;  2C0Y A;  1YZB A;  3CBJ A;  1A6R A;  1PPD A;  1PXV A;  3K8U A;  2XU4 A;  4MI7 A;  2FO5 A;  3IMA A;  2R9M A;  2F7D A;  2CIO A;  3TNX A;  5K16 A;  3OF9 A;  2H7J A;  2BU3 A;  2DC9 A;  1DEU A;  1CS8 A;  2R9F A;  5PAD A;  1AYV A;  3I06 A;  2FQ9 A;  4QH6 A;  4BOU A;  2R9N A;  4YYW A;  3AI8 A;  1QMY A;  1Y4H A;  2E02 A;  2OP3 A;  4PI3 A;  3RVV A;  4RF1 A;  3M99 A;  3PHW A;  3WXG A;  2ACT A;  2FRQ A;  5CVM A;  2AYN A;  2NQA A;  1AYW A;  1GCB A;  3PW3 A;  4OW0 A;  3RVW A;  4K7C A;  1CJL A;  2Y6E A;  2HH5 A;  2HD5 A;  4CZW A;  2AYO A;  3LFY A;  2PBH A;  2XU3 A;  1YK8 A;  3OVZ A;  5FPW A;  1TU6 A;  3QJ3 A;  2BDL A;  4P16 A;  1KXR A;  3ZUA A;  2WBF X;  3PRM A;  2FYE A;  4W5C A;  3H7D A;  3MTN A;  2P0R A;  1UKF A;  1NL6 A;  2BTW A;  1PAD A;  3PDF A;  3P5W A;  2E01 A;  4IP3 A;  1EWP A;  4QBB A;  2DC8 A;  2OUL A;  4RKX A;  4P6E A;  4Q8G A;  4AXM A;  1EWM A;  1FH0 A;  4YVA A;  2DCC A;  3I3T A;  4CDD B;  4HXD B;  1QOL A;  4REZ A;  2IBI A;  3H89 A;  2B1N A;  1S4V A;  2AUZ A;  1MEM A;  4PAD A;  4MM3 B;  4I05 A;  1ZIV A;  3GCB A;  3MJ5 A;  2P86 A;  1F29 A;  1BP4 A;  2VHF A;  5JZE A;  1XKG A;  1PBH A;  4Q8H A;  3HWN A;  2ATO A;  1F2C A;  4I04 A;  3B21 A;  2PNS A;  4D8I A;  3O65 A;  4W5B A;  3K24 A;  3P5X A;  1PE6 A;  4PP2 E;  5F02 A;  3MOR A;  1PIP A;  1PPO A;  1U9Q X;  4YV8 A;  4DMY A;  2HWK A;  1MEG A;  3C9E A;  3HHI A;  3TRK A;  1SP4 B;  3E9S A;  2JQF R;  2DOS A;  1VSN A;  3PBH A;  4MZO A;  8PCH A;  3N4C A;  2PAD A;  2YJ9 A;  3HHA A;  5J94 A;  1VJV A;  3MHH A;  2F1G A;  4BSQ A;  6PAD A;  4GUA A;  2IPP B;  3KX1 A;  1PPP A;  4YYU A;  1U9W A;  2E00 A;  3P5V A;  4D8E A;  1TL9 A;  2AVW A;  3KSE A;  2AS8 A;  2HXZ A;  1NLJ A;  1M6D A;  5KO3 A;  4N79 A;  5CHV A;  1SNK A;  4XZX A;  1PCI A;  2DZZ A;  1CQD A;  2NQD B;  3MHS A;  3C0R A;  1NQC A;  1THE A;  5CHT A;  2DCD A;  2GFO A;  2BTW B;  3IOQ A;  3PHU A;  2BDZ A;  4OEM A;  1DF0 A;  4A5U A;  3KWZ A;  1GEC E;  1YK7 A;  1NB3 A;  3CH2 X;  1AU3 A;  1F2A A;  1O0E A;  2JTC A;  3ERV A;  4RF0 A;  2PRE A;  3U8E A;  3O1G A;  3BPM A;  4X6H A;  4FK5 A;  2R9O A;  2P7U A;  4ZTB A;  1STF E;  1POP A;  1BQI A;  3PHX A;  3BC3 A;  3F5V A;  4RNA A;  1KHQ A;  4YYV A;  2DJG B;  4BS6 A;  3S3R A;  3RNV A;  1PVJ A;  4AXL A;  2FTD A;  2B1M A;  3BPF A;  4XUI A;  4RY2 A;  1GLO A;  4YYS A;  5EZQ A;  1U9X A;  3MTV A;  1KHP A;  2J7Q A;  3MP2 A;  4BS5 A;  2JRI A;  3OQC A;  3KW9 A;  4X6J A;  2JQG R;  4OVZ B;  1TLO A;  2GHU A;  1Q6K A;  4P6G A;  1HUC B;  3KFQ A;  3V6E A;  1QXP A;  3CH3 X;  3K9M A;  1U5I A;  4M0W A;  4X6I A;  5EF4 A;  3WXE A;  1K3B B;  3BWK A;  2FE8 A;  2AU1 A;  3PT2 A;  3NHE A;  4ZUX U;  4YYQ A;  3ZNH A;  5A24 A;  1YVB A;  4BOZ A;  2AIM A;  1AIM A;  1F2B A;  1ME3 A;  4PT5 A;  1BGO A;  1CVZ A;  2AGA A;  4PP1 A;  2DZY A;  4CDF B;  4OEL A;  1ICF A;  3IEJ A;  3IFU A;  3O0U A;  1PPN A;  5CVO B;  2XU1 A;  1MIR A; 
#chains in the Genus database with same CATH homology
 3N3G A;  1GX3 A;  1AU4 A;  1CSB B;  3QT4 A;  2OZ2 A;  1BY8 A;  4XR7 A;  3OIS A;  4CDE B;  5JH3 A;  3V6C A;  1QDQ A;  2DJF B;  1E2T A;  3S3Q A;  5CVN B;  1X9Y A;  2ARY A;  1CV8 A;  1AU2 A;  3OVX A;  2E03 A;  2G8J A;  4N4Z A;  2NQI A;  3D6S A;  1ITO A;  4FIP A;  3USV A;  3OF8 A;  2FUD A;  1KFX L;  2DCA A;  2O6X A;  1YT7 A;  1JQP A;  2VHS A;  2YJ8 A;  3RVX A;  9PAP A;  2R9C A;  4BQV A;  3E1Z B;  3F75 A;  4BPV A;  1AEC A;  1AU0 A;  3IHP A;  4MZS A;  1NB5 A;  4BGF A;  1AYU A;  3BCN A;  2G8E A;  4C5P A;  4N8W A;  1YAL A;  3H8C A;  1GMY A;  3LXS A;  2R6N A;  4I07 A;  1Y08 A;  1EWO A;  2Y5B A;  3H8B A;  7PCK A;  2DCB A;  2DC7 A;  1CPJ A;  3IUT A;  2NQG A;  1ATK A;  4WA6 A;  4FJC A;  2FRA A;  1EWL A;  2YJC A;  1KFU L;  3KWB X;  3N3K A;  3WXF A;  1MDW A;  2YJB A;  3KKU A;  1CTE A;  4YYR A;  3B79 A;  5EGW A;  2HHN A;  3DF0 A;  4QRV A;  1EF7 A;  1MS6 A;  2G6D A;  2FT2 A;  3PNR A;  3H6S A;  3CBK A;  4QRG A;  1CB5 A;  2CB5 A;  4MSX A;  4CDC B;  4G54 A;  5JA7 A;  1ME4 A;  3QSD A;  4GUZ A;  2G7Y A;  4DMX A;  3HD3 A;  2XU5 A;  1IWD A;  4KLB A;  3IV2 A;  2DC6 A;  3P5U A;  1ZCM A;  2YJ2 A;  1MHW A;  3BOW A;  1U9V A;  2AUX A;  1W5R A;  4HWY A;  1NPZ A;  4QRX A;  4W4U A;  2VFC A;  2C0Y A;  3CBJ A;  2VFB A;  1A6R A;  1PPD A;  1PXV A;  3K8U A;  2XU4 A;  2FO5 A;  3IMA A;  2R9M A;  2F7D A;  2CIO A;  4B55 A;  3TNX A;  5K16 A;  3OF9 A;  2BSZ A;  2H7J A;  2DC9 A;  1DEU A;  1CS8 A;  2R9F A;  4NV7 A;  5PAD A;  1AYV A;  3I06 A;  2FQ9 A;  4QH6 A;  2R9N A;  4YYW A;  3AI8 A;  1QMY A;  1Y4H A;  2E02 A;  2OP3 A;  4PI3 A;  3RVV A;  3M99 A;  3WXG A;  2ACT A;  2FRQ A;  5CVM A;  2AYN A;  2NQA A;  1AYW A;  1GCB A;  3PW3 A;  3RVW A;  4K7C A;  1CJL A;  2Y6E A;  2HH5 A;  2HD5 A;  4CZW A;  2AYO A;  3LFY A;  2PBH A;  2XU3 A;  1YK8 A;  3OVZ A;  5FPW A;  1TU6 A;  3QJ3 A;  2BDL A;  1KXR A;  3ZUA A;  2WBF X;  2FYE A;  4W5C A;  3H7D A;  3MTN A;  2P0R A;  1NL6 A;  1PAD A;  3PDF A;  3P5W A;  2E01 A;  1EWP A;  4QBB A;  2DC8 A;  2OUL A;  4P6E A;  4Q8G A;  4AXM A;  1EWM A;  1FH0 A;  4YVA A;  2DCC A;  3I3T A;  4CDD B;  1QOL A;  2IBI A;  3H89 A;  2B1N A;  1S4V A;  2AUZ A;  1MEM A;  4PAD A;  4I05 A;  1ZIV A;  3GCB A;  2P86 A;  1F29 A;  1BP4 A;  2VHF A;  1XKG A;  1PBH A;  4Q8H A;  3HWN A;  2ATO A;  1F2C A;  4I04 A;  2PNS A;  4W5B A;  3K24 A;  3P5X A;  1PE6 A;  4PP2 E;  5F02 A;  3MOR A;  1PIP A;  1PPO A;  1U9Q X;  4YV8 A;  4DMY A;  1MEG A;  3C9E A;  4NV8 A;  3HHI A;  1SP4 B;  2JQF R;  1VSN A;  3PBH A;  4MZO A;  8PCH A;  1W6F A;  3N4C A;  2PAD A;  2YJ9 A;  3HHA A;  5J94 A;  1VJV A;  3MHH A;  2F1G A;  4BSQ A;  6PAD A;  2IPP B;  3KX1 A;  1PPP A;  4YYU A;  1U9W A;  2E00 A;  3D9W A;  3P5V A;  1TL9 A;  2AVW A;  3KSE A;  2AS8 A;  2HXZ A;  1NLJ A;  1M6D A;  4N79 A;  5CHV A;  1SNK A;  1PCI A;  2DZZ A;  1CQD A;  2NQD B;  3MHS A;  1NQC A;  1THE A;  5CHT A;  2DCD A;  2GFO A;  3IOQ A;  2BDZ A;  4OEM A;  1DF0 A;  3KWZ A;  1GEC E;  1YK7 A;  1NB3 A;  3CH2 X;  1AU3 A;  1F2A A;  1O0E A;  3ERV A;  2PRE A;  3U8E A;  3O1G A;  3BPM A;  4X6H A;  4FK5 A;  2R9O A;  2P7U A;  1W4T A;  1STF E;  1POP A;  1BQI A;  3BC3 A;  3LTW A;  3F5V A;  1KHQ A;  4YYV A;  2DJG B;  4BS6 A;  3S3R A;  4AXL A;  2FTD A;  2B1M A;  3BPF A;  4XUI A;  4RY2 A;  1GLO A;  4YYS A;  1U9X A;  1KHP A;  4BS5 A;  3KW9 A;  4X6J A;  2JQG R;  1TLO A;  2GHU A;  1Q6K A;  4P6G A;  1HUC B;  3KFQ A;  3V6E A;  1QXP A;  3CH3 X;  3K9M A;  1U5I A;  4X6I A;  5EF4 A;  3WXE A;  1K3B B;  3BWK A;  2AU1 A;  3NHE A;  4ZUX U;  4YYQ A;  5A24 A;  1YVB A;  2AIM A;  1AIM A;  1F2B A;  1ME3 A;  1BGO A;  1CVZ A;  4PP1 A;  2DZY A;  4CDF B;  4OEL A;  1ICF A;  3IEJ A;  3O0U A;  1PPN A;  5CVO B;  2XU1 A;  1MIR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...