3S3RA

Structure of cathepsin b1 from schistosoma mansoni in complex with k11777 inhibitor
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
254
structure length
254
Chain Sequence
VEIPSSFDSRKKWPRCKSIATIRDQSRCGSCWAFGAVEAMSDRSCIQSGGKQNVELSAVDLLSCCESCGLGCEGGILGPAWDYWVKEGIVTGSSKENHAGCEPYPFPKCEHHTKGKYPPCGSKIYKTPRCKQTCQKKYKTPYTQDKHRGKSSYNVKNDEKAIQKEIMKYGPVEAGFTVYEDFLNYKSGIYKHITGETLGGHAIRIIGWGVENKAPYWLIANSWNEDWGENGYFRIVRGRDECSIESEVTAGRIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cathepsin B-like peptidase (C01 family)
publication title Structural Basis for Inhibition of Cathepsin B Drug Target from the Human Blood Fluke, Schistosoma mansoni.
pubmed doi rcsb
source organism Schistosoma mansoni
total genus 79
structure length 254
sequence length 254
chains with identical sequence B, C
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3s3rA00
1QDQA 1ZIVA 2DCAA 2VHSA 2FTDA 4W5CA 1CS8A 1NLJA 2R6NA 8PCHA 4MSXA 2HHNA 1CPJA 1F2CA 4PADA 3WXFA 3O0UA 2NQAA 2FT2A 2GHUA 2G6DA 1MDWA 2CIOA 2ATOA 4PI3A 1YVBA 1A6RA 5FPWA 2R9FA 3HD3A 5JA7A 5J94A 2CB5A 4N79A 1JQPA 1AYVA 2AVWA 1U9QX 2F1GA 6PADA 1YK8A 1EWOA 1CJLA 3S3QA 1VSNA 3H8CA 3QJ3A 1U5IA 2P7UA 1DEUA 1EWPA 1ITOA 1MIRA 2DC9A 5CHTA 2G8JA 2FQ9A 1GLOA 4KLBA 4BQVA 3WXGA 4P6EA 2AS8A 2E00A 3LXSA 1AIMA 3U8EA 3C9EA 2YJ9A 4BS5A 3CH3X 2XU1A 1ZCMA 3DF0A 4QRGA 4YYWA 3M99A 4X6HA 2FRQA 5EGWA 3V6CA 4X6IA 4I07A 4YYUA 4P6GA 5JH3A 3RVXA 1NPZA 1ME4A 2FYEA 1GCBA 4CZWA 5K16A 3MHHA 9PAPA 2ARYA 4BSQA 3KWZA 4YYQA 1PE6A 3IEJA 3BWKA 3KX1A 1BY8A 2G7YA 2DC7A 1ICFA 2WBFX 1AYWA 3PBHA 1AU0A 2NQDB 2HXZA 1PPOA 4CDFB 2DCDA 3IOQA 3N3GA 2Y6EA 2XU3A 3N3KA 2O6XA 4DMYA 3BPFA 4ZUXU 5CVMA 1DF0A 1VJVA 3I06A 1PPDA 2VHFA 1U9WA 2G8EA 2JQFR 3F5VA 5CHVA 2R9OA 3P5WA 5CVNB 1THEA 4K7CA 3GCBA 1X9YA 2AIMA 4X6JA 1YK7A 3K24A 1PXVA 2B1MA 2YJBA 2DCBA 2BDLA 1SP4B 1POPA 2PREA 1KHPA 1YALA 1PADA 1TL9A 4CDDB 1AU4A 1BQIA 3IHPA 3S3RA 1EWMA 4Q8HA 2P0RA 2XU4A 3KSEA 2AUZA 1PCIA 5A24A 1MEMA 2XU5A 4CDCB 1CVZA 1PPNA 4XR7A 3WXEA 3N4CA 3OF9A 1QMYA 1HUCB 3OVZA 3HHIA 2PNSA 2Y5BA 1BP4A 2HH5A 2R9CA 4PP1A 3KFQA 1PIPA 1KFXL 4N4ZA 2DCCA 3H8BA 4RY2A 4BPVA 2AYOA 4YVAA 3ERVA 3BPMA 1KHQA 2H7JA 1TLOA 2C0YA 2AYNA 4FIPA 4YV8A 1NB3A 3HHAA 4W4UA 4FK5A 1MHWA 2DJFB 4YYRA 3PW3A 4AXMA 1Y08A 2AUXA 2E01A 3ZUAA 1FH0A 2PBHA 3P5XA 3BC3A 3CBKA 4OEMA 1MEGA 1ATKA 3MTNA 1M6DA 2AU1A 2F7DA 5CVOB 4FJCA 3OISA 1AU3A 3P5VA 3V6EA 4N8WA 3CBJA 2DZZA 1XKGA 1NB5A 2ACTA 3OVXA 4YYVA 1PPPA 3USVA 1QXPA 1Y4HA 3K9MA 1CV8A 1ME3A 3MHSA 2IPPB 4MZSA 1PBHA 4I05A 2BDZA 1YT7A 3O1GA 2PADA 3LFYA 3IMAA 4Q8GA 1CSBB 3IUTA 3NHEA 1NL6A 1O0EA 1AYUA 1CB5A 3HWNA 1KFUL 2E03A 1AECA 1F2AA 2OP3A 3P5UA 4AXLA 1KXRA 1IWDA 2E02A 4QRVA 4BS6A 4QH6A 2YJ8A 7PCKA 3IV2A 4MZOA 1K3BB 4XUIA 4OELA 4QRXA 1CTEA 2B1NA 1STFE 2JQGR 1MS6A 3KKUA 2NQGA 4W5BA 2OULA 3AI8A 3CH2X 1BGOA 2YJ2A 3RVVA 3B79A 3F75A 2DJGB 3I3TA 1U9VA 3D6SA 1GMYA 3H6SA 3KWBX 5EF4A 2IBIA 1AU2A 2OZ2A 4WA6A 1NQCA 5PADA 4HWYA 3K8UA 1S4VA 3PNRA 4QBBA 1F2BA 3E1ZB 2R9MA 2FRAA 1Q6KA 3QT4A 3H7DA 1TU6A 3MORA 3PDFA 2R9NA 4CDEB 1U9XA 1CQDA 2DZYA 2GFOA 4PP2E 2YJCA 3KW9A 2FUDA 3RVWA 3TNXA 3QSDA 1GECE 2FO5A 4YYSA 1QOLA 2HD5A 2P86A 4G54A 1EWLA 2NQIA 3OF8A 4I04A 5F02A 2DC6A 4DMXA 3BOWA 1EF7A 3H89A 1F29A 2DC8A 3BCNA 1SNKA
chains in the Genus database with same CATH superfamily
1QDQA 1ZIVA 2DCAA 2VHSA 4REZA 2FTDA 4W5CA 1CS8A 4RKXA 1NLJA 2R6NA 8PCHA 4MSXA 2HHNA 1CPJA 4XZXA 3MJ5A 1F2CA 4PADA 3WXFA 4R3DA 3O0UA 2NQAA 2FT2A 2GHUA 2G6DA 1MDWA 2CIOA 2ATOA 4PI3A 3PSEA 3MTVA 1YVBA 1A6RA 3BB7A 5FPWA 2R9FA 3HD3A 5JA7A 5J94A 2CB5A 4N79A 1JQPA 1AYVA 2AVWA 1U9QX 2F1GA 6PADA 1YK8A 1EWOA 1CJLA 3S3QA 1VSNA 3H8CA 3QJ3A 1U5IA 2P7UA 1DEUA 1EWPA 1ITOA 1MIRA 4GUAA 1YZBA 2DC9A 5CHTA 4D8EA 2G8JA 2FQ9A 4A5UA 1GLOA 4KLBA 4BQVA 3WXGA 4P6EA 2AS8A 2E00A 3LXSA 1AIMA 3U8EA 3BY4A 3C9EA 2YJ9A 4BS5A 2BTWA 3CH3X 2XU1A 1ZCMA 3DF0A 4QRGA 4YYWA 3M99A 4X6HA 1PVJA 2FRQA 5EGWA 3V6CA 4X6IA 4I07A 4YYUA 2J7QC 4P6GA 5JH3A 3RVXA 1NPZA 1ME4A 4IUMA 2FYEA 1GCBA 3IFUA 1UKFA 4CZWA 5K16A 3MHHA 9PAPA 2ARYA 4BSQA 3KWZA 4YYQA 4BOQA 1PE6A 3IEJA 3BWKA 3KX1A 4RNAA 1BY8A 2G7YA 3PRPA 2DC7A 1ICFA 2WBFX 1AYWA 4P16A 3PBHA 1AU0A 2NQDB 2HXZA 2BTWB 1PPOA 4CDFB 3RNVA 2DCDA 3IOQA 3N3GA 2Y6EA 4RF0A 2FE8A 2XU3A 3N3KA 5EZSA 2O6XA 4DMYA 3BPFA 4ZUXU 5CVMA 1DF0A 1VJVA 2UZJA 3I06A 1PPDA 2VHFA 1U9WA 2G8EA 2JQFR 3F5VA 5EZQA 2BU3A 4MM3B 4M0WA 5CHVA 2R9OA 3P5WA 5CVNB 4ZTBA 1THEA 4K7CA 3GCBA 1X9YA 2AIMA 4X6JA 1YK7A 3K24A 1PXVA 2B1MA 2YJBA 4MI7A 2DCBA 2BDLA 3B21A 5E6JA 1SP4B 1POPA 2PREA 3PHUA 1KHPA 1YALA 1PADA 1TL9A 4CDDB 1AU4A 1BQIA 2J7QA 3IHPA 4BOUA 4IP3A 1EWMA 3S3RA 4Q8HA 2P0RA 3O65A 2XU4A 3KSEA 2AUZA 1PCIA 5A24A 1MEMA 2XU5A 4CDCB 1CVZA 1PPNA 4XR7A 3WXEA 3N4CA 1DKIA 3OF9A 5JZEA 1QMYA 1HUCB 3OVZA 3HHIA 2PNSA 2Y5BA 1BP4A 2HH5A 2R9CA 4PP1A 3PHWA 3KFQA 1PIPA 3MP2A 1KFXL 4N4ZA 2DCCA 3H8BA 3TMPA 4RY2A 4BPVA 2AYOA 4YVAA 3ERVA 3BPMA 1KHQA 2H7JA 1TLOA 2C0YA 2AYNA 4FIPA 4YV8A 1NB3A 3HHAA 4W4UA 4FK5A 4BOSA 1MHWA 2DJFB 4YYRA 3PW3A 4AXMA 1Y08A 2AUXA 2E01A 3ZUAA 1FH0A 2PBHA 3P5XA 3BC3A 3CBKA 4OEMA 1MEGA 3E9SA 1ATKA 3MTNA 1M6DA 2AU1A 2F7DA 5CVOB 4FJCA 3OISA 1AU3A 3P5VA 4OVZA 3V6EA 4N8WA 3CBJA 2DZZA 4D8IA 1XKGA 1NB5A 2ACTA 3OVXA 4YYVA 4HXDB 1PPPA 3USVA 4OW0A 1QXPA 2JRIA 1Y4HA 3K9MA 1CV8A 1ME3A 3MHSA 2IPPB 4MZSA 1PBHA 4I05A 2BDZA 1YT7A 3O1GA 2PADA 3LFYA 3IMAA 4Q8GA 3PHXA 1CSBB 3IUTA 3NHEA 1NL6A 1O0EA 1AYUA 1CB5A 3HWNA 1KFUL 2E03A 4WURA 2JTCA 1AECA 1F2AA 2OP3A 3P5UA 4AXLA 1KXRA 1IWDA 2E02A 4QRVA 4BS6A 3W31A 4QH6A 2YJ8A 7PCKA 3IV2A 3ZNHA 4BOPA 4MZOA 1K3BB 4D8BA 4XUIA 4OVZB 4OELA 3PRMA 4QRXA 1CTEA 2B1NA 1STFE 2JQGR 1MS6A 3KKUA 3TRKA 2DOSA 2NQGA 4W5BA 2OULA 3AI8A 3CH2X 1BGOA 2YJ2A 4RF1A 3RVVA 3B79A 3F75A 2DJGB 3I3TA 1U9VA 3D6SA 1GMYA 3H6SA 3KWBX 5EF4A 2IBIA 1AU2A 2OZ2A 4WA6A 1NQCA 5PADA 4HWYA 3K8UA 1S4VA 3C0RA 3PNRA 4PT5A 4QBBA 1F2BA 3E1ZB 2R9MA 2FRAA 1Q6KA 3QT4A 3H7DA 1TU6A 5KO3A 3OQCA 3MORA 3PDFA 2R9NA 4CDEB 1U9XA 1CQDA 2DZYA 2GFOA 3BBAA 4PP2E 3PT2A 2YJCA 2HWKA 3KW9A 2Z84A 3W30A 2FUDA 3RVWA 3TNXA 3QSDA 1GECE 2FO5A 4YYSA 4BOZA 1QOLA 2HD5A 2P86A 4G54A 1EWLA 2NQIA 3OF8A 4I04A 5F02A 2DC6A 4DMXA 3BOWA 1EF7A 3H89A 1F29A 2DC8A 2AGAA 3BCNA 1SNKA
chains in the Genus database with same CATH topology
1QDQA 1ZIVA 2DCAA 2VHSA 2FTDA 4W5CA 1CS8A 1NLJA 2R6NA 8PCHA 4MSXA 2HHNA 1CPJA 1F2CA 4PADA 3WXFA 3O0UA 2NQAA 2FT2A 2GHUA 2G6DA 1MDWA 2CIOA 2ATOA 4PI3A 1YVBA 1A6RA 5FPWA 2R9FA 3HD3A 5JA7A 5J94A 2CB5A 4N79A 4C5PA 1JQPA 1AYVA 2AVWA 1U9QX 2F1GA 6PADA 1YK8A 1EWOA 1CJLA 3S3QA 1VSNA 3H8CA 3QJ3A 1U5IA 2P7UA 1DEUA 1EWPA 1ITOA 1MIRA 2DC9A 5CHTA 2G8JA 2FQ9A 4NV7A 1GLOA 4KLBA 4BQVA 3WXGA 4P6EA 2AS8A 2E00A 3LXSA 1AIMA 3U8EA 3C9EA 2YJ9A 4BS5A 3CH3X 2XU1A 1ZCMA 3DF0A 4QRGA 4YYWA 3M99A 4X6HA 2FRQA 5EGWA 3V6CA 4X6IA 4I07A 4YYUA 4P6GA 5JH3A 3RVXA 1NPZA 1ME4A 2FYEA 1GCBA 4CZWA 5K16A 3MHHA 9PAPA 2VFBA 2ARYA 4BSQA 3KWZA 4YYQA 1PE6A 3IEJA 3BWKA 3KX1A 3LTWA 1BY8A 2G7YA 2DC7A 1ICFA 2WBFX 1E2TA 1AYWA 3PBHA 1AU0A 2NQDB 2HXZA 1PPOA 4CDFB 2DCDA 3IOQA 3N3GA 2Y6EA 1W4TA 2XU3A 3N3KA 2O6XA 4DMYA 3BPFA 4ZUXU 5CVMA 1DF0A 1VJVA 3I06A 1PPDA 2VHFA 1U9WA 2G8EA 2JQFR 3F5VA 5CHVA 2R9OA 3P5WA 5CVNB 1THEA 4K7CA 3GCBA 1X9YA 2AIMA 4X6JA 1YK7A 3K24A 1PXVA 2B1MA 2YJBA 2DCBA 2BDLA 1SP4B 1POPA 2PREA 1KHPA 1YALA 1PADA 1TL9A 4CDDB 1AU4A 1BQIA 3IHPA 3S3RA 1EWMA 4Q8HA 2P0RA 2XU4A 3KSEA 2AUZA 1PCIA 5A24A 1MEMA 2XU5A 4CDCB 1CVZA 1PPNA 4XR7A 3WXEA 3N4CA 3OF9A 1QMYA 1HUCB 3OVZA 3HHIA 2PNSA 2Y5BA 1BP4A 2HH5A 2R9CA 2VFCA 4PP1A 3KFQA 1PIPA 1KFXL 4N4ZA 2DCCA 3H8BA 3D9WA 4RY2A 4BPVA 4B55A 2AYOA 4YVAA 3ERVA 3BPMA 1KHQA 2H7JA 1TLOA 2C0YA 2AYNA 4FIPA 4YV8A 1W5RA 1NB3A 3HHAA 4W4UA 4FK5A 1MHWA 4NV8A 2DJFB 4YYRA 3PW3A 4AXMA 1Y08A 2AUXA 2E01A 3ZUAA 1FH0A 2PBHA 3P5XA 3BC3A 3CBKA 4OEMA 1MEGA 1ATKA 3MTNA 1M6DA 2AU1A 2F7DA 5CVOB 4FJCA 3OISA 1AU3A 3P5VA 3V6EA 4N8WA 3CBJA 2DZZA 1XKGA 1NB5A 2ACTA 3OVXA 4YYVA 1PPPA 3USVA 1QXPA 2BSZA 1Y4HA 3K9MA 1CV8A 1ME3A 3MHSA 2IPPB 4MZSA 1PBHA 4I05A 2BDZA 1YT7A 3O1GA 2PADA 3LFYA 3IMAA 4Q8GA 1CSBB 3IUTA 3NHEA 1NL6A 1O0EA 1AYUA 1CB5A 3HWNA 1KFUL 2E03A 1AECA 1F2AA 2OP3A 3P5UA 4AXLA 1KXRA 1IWDA 2E02A 4QRVA 4BGFA 4BS6A 4QH6A 2YJ8A 7PCKA 3IV2A 4MZOA 1K3BB 4XUIA 4OELA 4QRXA 1CTEA 2B1NA 1STFE 2JQGR 1MS6A 3KKUA 1GX3A 2NQGA 4W5BA 2OULA 3AI8A 3CH2X 1BGOA 2YJ2A 3RVVA 3B79A 3F75A 2DJGB 3I3TA 1U9VA 3D6SA 1GMYA 3H6SA 3KWBX 5EF4A 2IBIA 1AU2A 2OZ2A 4GUZA 4WA6A 1W6FA 1NQCA 5PADA 4HWYA 3K8UA 1S4VA 3PNRA 4QBBA 1F2BA 3E1ZB 2R9MA 2FRAA 1Q6KA 3QT4A 3H7DA 1TU6A 3MORA 3PDFA 2R9NA 4CDEB 1U9XA 1CQDA 2DZYA 2GFOA 4PP2E 2YJCA 3KW9A 2FUDA 3RVWA 3TNXA 3QSDA 1GECE 2FO5A 4YYSA 1QOLA 2HD5A 2P86A 4G54A 1EWLA 2NQIA 3OF8A 4I04A 5F02A 2DC6A 4DMXA 3BOWA 1EF7A 3H89A 1F29A 2DC8A 3BCNA 1SNKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QDQ A;  1ZIV A;  2DCA A;  2VHS A;  2FTD A;  4W5C A;  1CS8 A;  1NLJ A;  2R6N A;  8PCH A;  4MSX A;  2HHN A;  1CPJ A;  1F2C A;  4PAD A;  3WXF A;  3O0U A;  2NQA A;  2FT2 A;  2GHU A;  2G6D A;  1MDW A;  2CIO A;  2ATO A;  4PI3 A;  1YVB A;  1A6R A;  5FPW A;  2R9F A;  3HD3 A;  5JA7 A;  5J94 A;  2CB5 A;  4N79 A;  1JQP A;  1AYV A;  2AVW A;  1U9Q X;  2F1G A;  6PAD A;  1YK8 A;  1EWO A;  1CJL A;  3S3Q A;  1VSN A;  3H8C A;  3QJ3 A;  1U5I A;  2P7U A;  1DEU A;  1EWP A;  1ITO A;  1MIR A;  2DC9 A;  5CHT A;  2G8J A;  2FQ9 A;  1GLO A;  4KLB A;  4BQV A;  3WXG A;  4P6E A;  2AS8 A;  2E00 A;  3LXS A;  1AIM A;  3U8E A;  3C9E A;  2YJ9 A;  4BS5 A;  3CH3 X;  2XU1 A;  1ZCM A;  3DF0 A;  4QRG A;  4YYW A;  3M99 A;  4X6H A;  2FRQ A;  5EGW A;  3V6C A;  4X6I A;  4I07 A;  4YYU A;  4P6G A;  5JH3 A;  3RVX A;  1NPZ A;  1ME4 A;  2FYE A;  1GCB A;  4CZW A;  5K16 A;  3MHH A;  9PAP A;  2ARY A;  4BSQ A;  3KWZ A;  4YYQ A;  1PE6 A;  3IEJ A;  3BWK A;  3KX1 A;  1BY8 A;  2G7Y A;  2DC7 A;  1ICF A;  2WBF X;  1AYW A;  3PBH A;  1AU0 A;  2NQD B;  2HXZ A;  1PPO A;  4CDF B;  2DCD A;  3IOQ A;  3N3G A;  2Y6E A;  2XU3 A;  3N3K A;  2O6X A;  4DMY A;  3BPF A;  4ZUX U;  5CVM A;  1DF0 A;  1VJV A;  3I06 A;  1PPD A;  2VHF A;  1U9W A;  2G8E A;  2JQF R;  3F5V A;  5CHV A;  2R9O A;  3P5W A;  5CVN B;  1THE A;  4K7C A;  3GCB A;  1X9Y A;  2AIM A;  4X6J A;  1YK7 A;  3K24 A;  1PXV A;  2B1M A;  2YJB A;  2DCB A;  2BDL A;  1SP4 B;  1POP A;  2PRE A;  1KHP A;  1YAL A;  1PAD A;  1TL9 A;  4CDD B;  1AU4 A;  1BQI A;  3IHP A;  3S3R A;  1EWM A;  4Q8H A;  2P0R A;  2XU4 A;  3KSE A;  2AUZ A;  1PCI A;  5A24 A;  1MEM A;  2XU5 A;  4CDC B;  1CVZ A;  1PPN A;  4XR7 A;  3WXE A;  3N4C A;  3OF9 A;  1QMY A;  1HUC B;  3OVZ A;  3HHI A;  2PNS A;  2Y5B A;  1BP4 A;  2HH5 A;  2R9C A;  4PP1 A;  3KFQ A;  1PIP A;  1KFX L;  4N4Z A;  2DCC A;  3H8B A;  4RY2 A;  4BPV A;  2AYO A;  4YVA A;  3ERV A;  3BPM A;  1KHQ A;  2H7J A;  1TLO A;  2C0Y A;  2AYN A;  4FIP A;  4YV8 A;  1NB3 A;  3HHA A;  4W4U A;  4FK5 A;  1MHW A;  2DJF B;  4YYR A;  3PW3 A;  4AXM A;  1Y08 A;  2AUX A;  2E01 A;  3ZUA A;  1FH0 A;  2PBH A;  3P5X A;  3BC3 A;  3CBK A;  4OEM A;  1MEG A;  1ATK A;  3MTN A;  1M6D A;  2AU1 A;  2F7D A;  5CVO B;  4FJC A;  3OIS A;  1AU3 A;  3P5V A;  3V6E A;  4N8W A;  3CBJ A;  2DZZ A;  1XKG A;  1NB5 A;  2ACT A;  3OVX A;  4YYV A;  1PPP A;  3USV A;  1QXP A;  1Y4H A;  3K9M A;  1CV8 A;  1ME3 A;  3MHS A;  2IPP B;  4MZS A;  1PBH A;  4I05 A;  2BDZ A;  1YT7 A;  3O1G A;  2PAD A;  3LFY A;  3IMA A;  4Q8G A;  1CSB B;  3IUT A;  3NHE A;  1NL6 A;  1O0E A;  1AYU A;  1CB5 A;  3HWN A;  1KFU L;  2E03 A;  1AEC A;  1F2A A;  2OP3 A;  3P5U A;  4AXL A;  1KXR A;  1IWD A;  2E02 A;  4QRV A;  4BS6 A;  4QH6 A;  2YJ8 A;  7PCK A;  3IV2 A;  4MZO A;  1K3B B;  4XUI A;  4OEL A;  4QRX A;  1CTE A;  2B1N A;  1STF E;  2JQG R;  1MS6 A;  3KKU A;  2NQG A;  4W5B A;  2OUL A;  3AI8 A;  3CH2 X;  1BGO A;  2YJ2 A;  3RVV A;  3B79 A;  3F75 A;  2DJG B;  3I3T A;  1U9V A;  3D6S A;  1GMY A;  3H6S A;  3KWB X;  5EF4 A;  2IBI A;  1AU2 A;  2OZ2 A;  4WA6 A;  1NQC A;  5PAD A;  4HWY A;  3K8U A;  1S4V A;  3PNR A;  4QBB A;  1F2B A;  3E1Z B;  2R9M A;  2FRA A;  1Q6K A;  3QT4 A;  3H7D A;  1TU6 A;  3MOR A;  3PDF A;  2R9N A;  4CDE B;  1U9X A;  1CQD A;  2DZY A;  2GFO A;  4PP2 E;  2YJC A;  3KW9 A;  2FUD A;  3RVW A;  3TNX A;  3QSD A;  1GEC E;  2FO5 A;  4YYS A;  1QOL A;  2HD5 A;  2P86 A;  4G54 A;  1EWL A;  2NQI A;  3OF8 A;  4I04 A;  5F02 A;  2DC6 A;  4DMX A;  3BOW A;  1EF7 A;  3H89 A;  1F29 A;  2DC8 A;  3BCN A;  1SNK A; 
#chains in the Genus database with same CATH topology
 1QDQ A;  1ZIV A;  2DCA A;  2VHS A;  4REZ A;  2FTD A;  4W5C A;  1CS8 A;  4RKX A;  1NLJ A;  2R6N A;  8PCH A;  4MSX A;  2HHN A;  1CPJ A;  4XZX A;  3MJ5 A;  1F2C A;  4PAD A;  3WXF A;  4R3D A;  3O0U A;  2NQA A;  2FT2 A;  2GHU A;  2G6D A;  1MDW A;  2CIO A;  2ATO A;  4PI3 A;  3PSE A;  3MTV A;  1YVB A;  1A6R A;  3BB7 A;  5FPW A;  2R9F A;  3HD3 A;  5JA7 A;  5J94 A;  2CB5 A;  4N79 A;  1JQP A;  1AYV A;  2AVW A;  1U9Q X;  2F1G A;  6PAD A;  1YK8 A;  1EWO A;  1CJL A;  3S3Q A;  1VSN A;  3H8C A;  3QJ3 A;  1U5I A;  2P7U A;  1DEU A;  1EWP A;  1ITO A;  1MIR A;  4GUA A;  1YZB A;  2DC9 A;  5CHT A;  4D8E A;  2G8J A;  2FQ9 A;  4A5U A;  1GLO A;  4KLB A;  4BQV A;  3WXG A;  4P6E A;  2AS8 A;  2E00 A;  3LXS A;  1AIM A;  3U8E A;  3BY4 A;  3C9E A;  2YJ9 A;  4BS5 A;  2BTW A;  3CH3 X;  2XU1 A;  1ZCM A;  3DF0 A;  4QRG A;  4YYW A;  3M99 A;  4X6H A;  1PVJ A;  2FRQ A;  5EGW A;  3V6C A;  4X6I A;  4I07 A;  4YYU A;  2J7Q C;  4P6G A;  5JH3 A;  3RVX A;  1NPZ A;  1ME4 A;  4IUM A;  2FYE A;  1GCB A;  3IFU A;  1UKF A;  4CZW A;  5K16 A;  3MHH A;  9PAP A;  2ARY A;  4BSQ A;  3KWZ A;  4YYQ A;  4BOQ A;  1PE6 A;  3IEJ A;  3BWK A;  3KX1 A;  4RNA A;  1BY8 A;  2G7Y A;  3PRP A;  2DC7 A;  1ICF A;  2WBF X;  1AYW A;  4P16 A;  3PBH A;  1AU0 A;  2NQD B;  2HXZ A;  2BTW B;  1PPO A;  4CDF B;  3RNV A;  2DCD A;  3IOQ A;  3N3G A;  2Y6E A;  4RF0 A;  2FE8 A;  2XU3 A;  3N3K A;  5EZS A;  2O6X A;  4DMY A;  3BPF A;  4ZUX U;  5CVM A;  1DF0 A;  1VJV A;  2UZJ A;  3I06 A;  1PPD A;  2VHF A;  1U9W A;  2G8E A;  2JQF R;  3F5V A;  5EZQ A;  2BU3 A;  4MM3 B;  4M0W A;  5CHV A;  2R9O A;  3P5W A;  5CVN B;  4ZTB A;  1THE A;  4K7C A;  3GCB A;  1X9Y A;  2AIM A;  4X6J A;  1YK7 A;  3K24 A;  1PXV A;  2B1M A;  2YJB A;  4MI7 A;  2DCB A;  2BDL A;  3B21 A;  5E6J A;  1SP4 B;  1POP A;  2PRE A;  3PHU A;  1KHP A;  1YAL A;  1PAD A;  1TL9 A;  4CDD B;  1AU4 A;  1BQI A;  2J7Q A;  3IHP A;  4BOU A;  4IP3 A;  1EWM A;  3S3R A;  4Q8H A;  2P0R A;  3O65 A;  2XU4 A;  3KSE A;  2AUZ A;  1PCI A;  5A24 A;  1MEM A;  2XU5 A;  4CDC B;  1CVZ A;  1PPN A;  4XR7 A;  3WXE A;  3N4C A;  1DKI A;  3OF9 A;  5JZE A;  1QMY A;  1HUC B;  3OVZ A;  3HHI A;  2PNS A;  2Y5B A;  1BP4 A;  2HH5 A;  2R9C A;  4PP1 A;  3PHW A;  3KFQ A;  1PIP A;  3MP2 A;  1KFX L;  4N4Z A;  2DCC A;  3H8B A;  3TMP A;  4RY2 A;  4BPV A;  2AYO A;  4YVA A;  3ERV A;  3BPM A;  1KHQ A;  2H7J A;  1TLO A;  2C0Y A;  2AYN A;  4FIP A;  4YV8 A;  1NB3 A;  3HHA A;  4W4U A;  4FK5 A;  4BOS A;  1MHW A;  2DJF B;  4YYR A;  3PW3 A;  4AXM A;  1Y08 A;  2AUX A;  2E01 A;  3ZUA A;  1FH0 A;  2PBH A;  3P5X A;  3BC3 A;  3CBK A;  4OEM A;  1MEG A;  3E9S A;  1ATK A;  3MTN A;  1M6D A;  2AU1 A;  2F7D A;  5CVO B;  4FJC A;  3OIS A;  1AU3 A;  3P5V A;  4OVZ A;  3V6E A;  4N8W A;  3CBJ A;  2DZZ A;  4D8I A;  1XKG A;  1NB5 A;  2ACT A;  3OVX A;  4YYV A;  4HXD B;  1PPP A;  3USV A;  4OW0 A;  1QXP A;  2JRI A;  1Y4H A;  3K9M A;  1CV8 A;  1ME3 A;  3MHS A;  2IPP B;  4MZS A;  1PBH A;  4I05 A;  2BDZ A;  1YT7 A;  3O1G A;  2PAD A;  3LFY A;  3IMA A;  4Q8G A;  3PHX A;  1CSB B;  3IUT A;  3NHE A;  1NL6 A;  1O0E A;  1AYU A;  1CB5 A;  3HWN A;  1KFU L;  2E03 A;  4WUR A;  2JTC A;  1AEC A;  1F2A A;  2OP3 A;  3P5U A;  4AXL A;  1KXR A;  1IWD A;  2E02 A;  4QRV A;  4BS6 A;  3W31 A;  4QH6 A;  2YJ8 A;  7PCK A;  3IV2 A;  3ZNH A;  4BOP A;  4MZO A;  1K3B B;  4D8B A;  4XUI A;  4OVZ B;  4OEL A;  3PRM A;  4QRX A;  1CTE A;  2B1N A;  1STF E;  2JQG R;  1MS6 A;  3KKU A;  3TRK A;  2DOS A;  2NQG A;  4W5B A;  2OUL A;  3AI8 A;  3CH2 X;  1BGO A;  2YJ2 A;  4RF1 A;  3RVV A;  3B79 A;  3F75 A;  2DJG B;  3I3T A;  1U9V A;  3D6S A;  1GMY A;  3H6S A;  3KWB X;  5EF4 A;  2IBI A;  1AU2 A;  2OZ2 A;  4WA6 A;  1NQC A;  5PAD A;  4HWY A;  3K8U A;  1S4V A;  3C0R A;  3PNR A;  4PT5 A;  4QBB A;  1F2B A;  3E1Z B;  2R9M A;  2FRA A;  1Q6K A;  3QT4 A;  3H7D A;  1TU6 A;  5KO3 A;  3OQC A;  3MOR A;  3PDF A;  2R9N A;  4CDE B;  1U9X A;  1CQD A;  2DZY A;  2GFO A;  3BBA A;  4PP2 E;  3PT2 A;  2YJC A;  2HWK A;  3KW9 A;  2Z84 A;  3W30 A;  2FUD A;  3RVW A;  3TNX A;  3QSD A;  1GEC E;  2FO5 A;  4YYS A;  4BOZ A;  1QOL A;  2HD5 A;  2P86 A;  4G54 A;  1EWL A;  2NQI A;  3OF8 A;  4I04 A;  5F02 A;  2DC6 A;  4DMX A;  3BOW A;  1EF7 A;  3H89 A;  1F29 A;  2DC8 A;  2AGA A;  3BCN A;  1SNK A; 
#chains in the Genus database with same CATH homology
 1QDQ A;  1ZIV A;  2DCA A;  2VHS A;  2FTD A;  4W5C A;  1CS8 A;  1NLJ A;  2R6N A;  8PCH A;  4MSX A;  2HHN A;  1CPJ A;  1F2C A;  4PAD A;  3WXF A;  3O0U A;  2NQA A;  2FT2 A;  2GHU A;  2G6D A;  1MDW A;  2CIO A;  2ATO A;  4PI3 A;  1YVB A;  1A6R A;  5FPW A;  2R9F A;  3HD3 A;  5JA7 A;  5J94 A;  2CB5 A;  4N79 A;  4C5P A;  1JQP A;  1AYV A;  2AVW A;  1U9Q X;  2F1G A;  6PAD A;  1YK8 A;  1EWO A;  1CJL A;  3S3Q A;  1VSN A;  3H8C A;  3QJ3 A;  1U5I A;  2P7U A;  1DEU A;  1EWP A;  1ITO A;  1MIR A;  2DC9 A;  5CHT A;  2G8J A;  2FQ9 A;  4NV7 A;  1GLO A;  4KLB A;  4BQV A;  3WXG A;  4P6E A;  2AS8 A;  2E00 A;  3LXS A;  1AIM A;  3U8E A;  3C9E A;  2YJ9 A;  4BS5 A;  3CH3 X;  2XU1 A;  1ZCM A;  3DF0 A;  4QRG A;  4YYW A;  3M99 A;  4X6H A;  2FRQ A;  5EGW A;  3V6C A;  4X6I A;  4I07 A;  4YYU A;  4P6G A;  5JH3 A;  3RVX A;  1NPZ A;  1ME4 A;  2FYE A;  1GCB A;  4CZW A;  5K16 A;  3MHH A;  9PAP A;  2VFB A;  2ARY A;  4BSQ A;  3KWZ A;  4YYQ A;  1PE6 A;  3IEJ A;  3BWK A;  3KX1 A;  3LTW A;  1BY8 A;  2G7Y A;  2DC7 A;  1ICF A;  2WBF X;  1E2T A;  1AYW A;  3PBH A;  1AU0 A;  2NQD B;  2HXZ A;  1PPO A;  4CDF B;  2DCD A;  3IOQ A;  3N3G A;  2Y6E A;  1W4T A;  2XU3 A;  3N3K A;  2O6X A;  4DMY A;  3BPF A;  4ZUX U;  5CVM A;  1DF0 A;  1VJV A;  3I06 A;  1PPD A;  2VHF A;  1U9W A;  2G8E A;  2JQF R;  3F5V A;  5CHV A;  2R9O A;  3P5W A;  5CVN B;  1THE A;  4K7C A;  3GCB A;  1X9Y A;  2AIM A;  4X6J A;  1YK7 A;  3K24 A;  1PXV A;  2B1M A;  2YJB A;  2DCB A;  2BDL A;  1SP4 B;  1POP A;  2PRE A;  1KHP A;  1YAL A;  1PAD A;  1TL9 A;  4CDD B;  1AU4 A;  1BQI A;  3IHP A;  3S3R A;  1EWM A;  4Q8H A;  2P0R A;  2XU4 A;  3KSE A;  2AUZ A;  1PCI A;  5A24 A;  1MEM A;  2XU5 A;  4CDC B;  1CVZ A;  1PPN A;  4XR7 A;  3WXE A;  3N4C A;  3OF9 A;  1QMY A;  1HUC B;  3OVZ A;  3HHI A;  2PNS A;  2Y5B A;  1BP4 A;  2HH5 A;  2R9C A;  2VFC A;  4PP1 A;  3KFQ A;  1PIP A;  1KFX L;  4N4Z A;  2DCC A;  3H8B A;  3D9W A;  4RY2 A;  4BPV A;  4B55 A;  2AYO A;  4YVA A;  3ERV A;  3BPM A;  1KHQ A;  2H7J A;  1TLO A;  2C0Y A;  2AYN A;  4FIP A;  4YV8 A;  1W5R A;  1NB3 A;  3HHA A;  4W4U A;  4FK5 A;  1MHW A;  4NV8 A;  2DJF B;  4YYR A;  3PW3 A;  4AXM A;  1Y08 A;  2AUX A;  2E01 A;  3ZUA A;  1FH0 A;  2PBH A;  3P5X A;  3BC3 A;  3CBK A;  4OEM A;  1MEG A;  1ATK A;  3MTN A;  1M6D A;  2AU1 A;  2F7D A;  5CVO B;  4FJC A;  3OIS A;  1AU3 A;  3P5V A;  3V6E A;  4N8W A;  3CBJ A;  2DZZ A;  1XKG A;  1NB5 A;  2ACT A;  3OVX A;  4YYV A;  1PPP A;  3USV A;  1QXP A;  2BSZ A;  1Y4H A;  3K9M A;  1CV8 A;  1ME3 A;  3MHS A;  2IPP B;  4MZS A;  1PBH A;  4I05 A;  2BDZ A;  1YT7 A;  3O1G A;  2PAD A;  3LFY A;  3IMA A;  4Q8G A;  1CSB B;  3IUT A;  3NHE A;  1NL6 A;  1O0E A;  1AYU A;  1CB5 A;  3HWN A;  1KFU L;  2E03 A;  1AEC A;  1F2A A;  2OP3 A;  3P5U A;  4AXL A;  1KXR A;  1IWD A;  2E02 A;  4QRV A;  4BGF A;  4BS6 A;  4QH6 A;  2YJ8 A;  7PCK A;  3IV2 A;  4MZO A;  1K3B B;  4XUI A;  4OEL A;  4QRX A;  1CTE A;  2B1N A;  1STF E;  2JQG R;  1MS6 A;  3KKU A;  1GX3 A;  2NQG A;  4W5B A;  2OUL A;  3AI8 A;  3CH2 X;  1BGO A;  2YJ2 A;  3RVV A;  3B79 A;  3F75 A;  2DJG B;  3I3T A;  1U9V A;  3D6S A;  1GMY A;  3H6S A;  3KWB X;  5EF4 A;  2IBI A;  1AU2 A;  2OZ2 A;  4GUZ A;  4WA6 A;  1W6F A;  1NQC A;  5PAD A;  4HWY A;  3K8U A;  1S4V A;  3PNR A;  4QBB A;  1F2B A;  3E1Z B;  2R9M A;  2FRA A;  1Q6K A;  3QT4 A;  3H7D A;  1TU6 A;  3MOR A;  3PDF A;  2R9N A;  4CDE B;  1U9X A;  1CQD A;  2DZY A;  2GFO A;  4PP2 E;  2YJC A;  3KW9 A;  2FUD A;  3RVW A;  3TNX A;  3QSD A;  1GEC E;  2FO5 A;  4YYS A;  1QOL A;  2HD5 A;  2P86 A;  4G54 A;  1EWL A;  2NQI A;  3OF8 A;  4I04 A;  5F02 A;  2DC6 A;  4DMX A;  3BOW A;  1EF7 A;  3H89 A;  1F29 A;  2DC8 A;  3BCN A;  1SNK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...