4ZTBA

Crystal structure of nsp2 protease from chikungunya virus in p212121 space group at 2.59 a (4molecules/asu).
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
321
structure length
321
Chain Sequence
FQNKANVCWAKSLVPILETAGIKLNDRQWSQIIQAFKEDKAYSPEVALNEICTRMYGVDLDSGLFSKPLVSVYYADNHWDNRPGGKMFGFNPEAASILERKYPFTKGKWNINKQICVTTRRIEDFNPTTNIIPANRRLPHSLVAEHRPVKGERMEWLVNKINGHHVLLVSGYNLALPTKRVTWVAPLGVRGADYTYNLELGLPATLGRYDLVVINIHTPFRIHHYQQCVDHAMKLQMLGGDSLRLLKPGGSLLIRAYGYADRTSERVICVLGRKFRSSRALKPPCVTSNTEMFFLFSNFDNGRRNFTTHVMNNQLNAAFVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of nsP2 protease from Chikungunya virus in P212121 space group at 2.59 A (4molecules/ASU).
rcsb
source organism Chikungunya virus
molecule tags Hydrolase
molecule keywords Protease nsP2
total genus 88
structure length 321
sequence length 321
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4ztbA02
3.90.70.110 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4ztbA01
2PGXA 2IBSA 1I1NA 3EGIA 1TW3A 1NE2A 4RTJA 2GS9A 1M6EX 2WA1A 2NXJA 2AOTA 5FWDA 2VP3A 3OCJA 4UOEA 3NVKI 3DXYA 3HCAA 1SUSA 4RVDA 4V0RA 3LKDA 3UA3A 2IPXA 1KIAA 2LD4A 5CM2Z 3QOWA 1YFJA 4WXHA 2NXCA 3GXOA 2NNWB 4RTLA 2EJUA 2H11A 5E9WA 3BWYA 4DMGA 1X1CA 2AN3A 1EG2A 2JHAA 3ELYA 2P40A 3TRKA 3BGIA 3M6VA 4E33A 3OZRA 3HTXA 3F4KA 5LQAA 3SVZA 2HNKA 1FJXA 2YXLA 3FRHA 3EVEA 3A4TA 4A6DA 1XVAA 4YV0A 1YUBA 5DLYA 2EFJA 3DLIA 3DTNA 5DPMA 3FUTA 2JG3A 2NP7A 1PJZA 5FUBA 2I7CA 1D2CA 3NWEA 3P2IA 4EQZA 3KR2A 2OB2A 3PX3A 4RTKA 2C7PA 5ERGB 1IY9A 5ICEA 1H1DA 1RI3A 4M36A 3UJCA 2AOVA 2CWWA 5DRYA 3E8SA 2AOUB 3R3HA 3A27A 3ELUA 5E2BA 1JR4A 2P41A 3L8DA 2OYRA 3CGGA 3MTEA 4ER3A 4PGHA 5CVVA 3RW9A 1X1DA 4XUDA 2AZTA 5EMMA 4ER5A 1EJ6A 4YV2A 3P9NA 3CJQA 1D2GA 2FYTA 3EGEA 3HVIA 5ICGA 1BOOA 4RTNA 3G8BA 3A7DA 1RI2A 2OB1A 3ELDA 3EMDA 1WXXA 1TPYA 3GIWA 3I9FA 3IV6A 4P7FA 5K09A 2CL5A 3G7UA 4BP1A 1NW6A 1IXKA 4M7RA 4HTFB 4QVKA 3FPHA 3NWBA 3PFGA 1NW7A 9MHTA 3FUUA 3G88A 4HGZA 3CBGA 4E31A 1JG3A 4C07A 4DCMA 1VBFA 5EZSA 5IKMA 3HNRA 3OU2A 3UFBA 5K0CA 5LQNA 3LCUA 4GC5A 4RTRA 5U4XA 1R18A 1IM8A 3KHKA 4AZWA 4CKEA 4RTOA 3LDUA 3TM4A 1SG9A 1R00A 3GRYA 5EMKA 2C7OA 1VQ1A 4CTKA 3KQPA 4O29A 1SVUA 2CKDA 4DCGA 4QDJA 5K03A 3UA4A 3EEYA 1L3IA 3OU6A 4GQBA 1SQGA 2UYHA 3G2PA 2C7QA 2O0LA 2G70A 2YX1A 3PLAE 1F3LA 2CMGA 3AXSA 3M33A 3G2QA 5HFJA 3TKAA 3V97A 4OA5A 1DL5A 3O4FA 5K0GA 2NYUA 1AF7A 5EGSA 1NW8A 5DX1A 3UJAA 2VDWA 5D1NA 2YTZA 5C0OE 1YF3A 3UBTA 3M6XA 1RI4A 2YXDA 1F38A 4PIMA 4DZRA 2XVMA 4LG1A 3AJDA 3OFJA 4OBXA 2BH2A 1UWVA 2XYVA 4LECA 4IKPA 5E1BA 1JQDA 3ER8A 1JQ3A 2EJTA 2I62A 3LCCA 4PINA 3FUWA 4PYNA 5F2OA 2HMYB 4QQNA 4EVIA 1P91A 3UWPA 3TPZA 1UIRA 2HV9A 3UJDA 5HIKA 3HA3A 2AR0A 2BR5A 5EHIA 5DX0A 3FTDA 1JSXA 3HVKA 4PYJA 1QANA 2JJQA 3IYLW 3KPJA 3GGDA 2G72A 2WK1A 3KQSA 4X1OA 2B9EA 4EKGA 4HH4A 5C9ZA 5GIPE 4C06A 2EX4A 1XDUA 2AS0A 3GRUA 4KWCA 1NV9A 3HP7A 1R8XA 2PX2A 2ORED 4QQKA 1NV8A 2FK7A 2YR0A 2R6ZA 4KVZA 5DSXA 3HA7A 4KW7A 5LQCA 3IHTA 1NBIA 3AY0A 3R24A 5GIOE 4Y2HA 1AV6A 1QAOA 4ER0A 4YMGA 10MHA 3FPEA 5K0NA 4Z2YA 2PSSA 5GINE 4U7PB 3I64A 3AXTA 4OBWA 3QV2A 3LPMA 4MWZA 2ONZA 1KHHA 2O57A 3KQWA 4C05A 3JWIA 1XTPA 4HG2A 4PYQA 3A25A 3TMAA 4EKIA 2PX8A 1KP9A 2QRVA 3LSTA 4PONA 2UZ4A 2GAFA 4YUVA 5T67A 3PFHA 1JQEA 2AVNA 2G8NA 4CKCA 3KQTA 3C0KA 5K0LA 4OX9Y 4V0QA 4E70A 4E2YA 4HRAA 1G8SA 3LDGA 3UJBA 1NW3A 3KPWA 1RI1A 3C3YA 3PT9A 4LWPA 4Y30A 3T7RA 2PXAA 1YB2A 2AOTB 2H1RA 2BM9A 5EIWA 2K4MA 3DXZA 3KKZA 1JTFA 4B17A 4YUWA 2P7IA 3EEOA 3FRIA 4L7VA 2OPBA 4MHTA 4RTPA 2ZLBA 4G56A 3I58A 3THSA 5CD1A 3RODA 3OU7A 2N47A 3B3GA 4K6MA 3H2BA 4GOOD 4ER6A 1Q0TA 1Q0SA 4F84A 5CIYA 2GB4A 5CVDA 3LDFA 4CTJA 4FS8A 3B7PA 2IH2A 4YUYA 2ZZMA 3KPVA 5DSTA 1VIDA 1X1BA 2PXXA 2R3SA 5EIFA 4P7KA 3P8ZA 5ICFA 2B25A 4YMHA 5EQJB 1DUSA 4MIKA 2PY6A 1RJGA 1UFKA 3DMFA 5P8WA 3TQSA 3I5UA 3EVAA 5C1IA 3DXXA 2PX5A 5E8RA 2OO3A 4HC4A 5FADA 3R0QA 3RIEA 2IIPA 2OZVA 3P9CA 3PS9A 5K05A 4MTLA 2OY0A 3SSOA 5KS2A 5LSAA 2ZZNA 4LWOA 4XUCA 1BHJA 3NW9A 2FPOA 4DF3A 5T64A 2P3OA 3GJYA 3FPGA 4RVFA 4U7TB 4GC9A 2ZBQA 3KPYA 5MHTA 1QYRA 1RI5A 4GOMD 5DM0A 2PXCA 3T0IA 1RJEA 2B78A 4EK9A 3SX0A 1V39A 3O31A 2BM8A 4RWZA 4XUEA 3CJRA 3LHDA 7MHTA 3NDJA 3BGVA 3ID6C 5EKUA 4EMSA 3BGDA 5LQKA 4CWAA 2JH9A 3OZTA 5KYGA 1EIZA 3DMHA 2P3QA 3E7PA 4KDCA 3GCZA 3TR6A 2GA9A 2AN4A 3DUWA 3E23A 3G2MA 3DMGA 4FR0A 4DA4A 3NJRA 3ELWA 3PTAA 1BKYA 1EQAA 2ZWVA 2A14A 2H00A 5DX8A 5GM1A 4C03A 4X63A 3BKWA 4IWNA 3LBYA 4PYOA 3SXJA 2XYRA 4YV1A 3X0DA 5BP7A 4PGGA 1YZHA 3EVFA 5KVAA 4C04A 2ESRA 3CVOA 3D2LA 5CVJA 5LQJA 3LX6A 1N7JA 2XVAA 3ER9A 2VDVE 1HMYA 1HNNA 3GNLA 5DTQA 2IBTA 2QYOA 3B89A 5EKXA 4CXMA 4PYLA 4RTQA 2FCAA 2B3TA 3BWBA 3CCFA 3WSTA 1WG8A 4GOLD 4RSRA 1L3CA 3MCTA 4RVGA 2DPMA 2BZGA 3G8AA 2ZVJA 1EAMA 4X41A 3VC2A 1ZGAA 1MHTA 8MHTA 1XDSA 4R8RA 3CC8A 5EMJA 5DXJA 5CUQA 5DWQA 2IFTA 2YXEA 4JXJA 3JWGA 3TM5A 5HOQA 3HM2A 1L3BA 1R6AA 3HEMA 5EVJA 3A26A 1PRYA 3UJ6A 5BW4A 2YQZA 5EEHA 1R74A 2V7EA 3P71T 1AQJA 2DULA 4P58A 4E2XA 3V8VA 3DULA 3R9XB 1N2XA 3O7WA 4C4AA 3NMUF 2PX4A 2ZFUA 1JSZA 1KYWA 2Z6AA 3BWCA 4PYMA 3OFKA 3Q7EA 3DLCA 4DQ0A 1G6Q1 3SM3A 3T7SA 5FA8A 5BW5A 1O9GA 3GU3A 4CKBA 2Y1XA 3ANXA 3P97A 4YUZA 2IGTA 2ZULA 1XCJA 4PWYA 5F2KA 1G60A 5FA5A 5K0JA 1FP2A 1INLA 4X60A 1YZ3A 4FSDA 2HWKA 3B3FA 4ZTBA 2IH5A 3MTIA 1JG1A 2P7HA 2JH8A 2IDKA 4KIGA 5EMLA 4FT2A 5JUWA 3LL7A 1KYZA 2FK8A 3A7EA 2HTEA 2WA2A 5HILA 5HIIA 3UZUA 4E32A 1G38A 2ZIEA 3KR0A 4OQDA 3UJ9A 1WY7A 3MGGA 1Y8CA 4BY9E 5FWAA 2NP6A 3KQMA 2PLWA 4HGYA 2OBFA 4RX1A 2I9KA 3MAGA 4POOA 3T7TA 1NT2A 4AZTA 5DTMA 5K0BA 2I6GA 5FTWA 4MQ4A 2QM3A 4KIFA 3LGAA 2PJDA 2QRVB 4AUKA 2VZ9A 2QY6A 3GO4A 4RV9A 4E2WA 2UYQA 2PVCA 3LCVB 4BP3A 1O54A 1P1BA 5GWXA 1R8YA 3G2OA 4NECA 4GUAA 2CMHA 3TLJA 2AVDA 4P7JA 4A6EA 3FUXA 4FP9A 2P35A 4IV8A 4GOND 4KRGA 3MB5A 5EZQA 1ORHA 1SQFA 3DOUA 2IDJA 2JHPA 4QTTB 2G71A 3EVCA 5K0EA 1SUIA 3BKXA 1NKVA 5D1HA 4E2ZA 2AN5A 3GWZA 4QTUB 4C08A 3FZGA 3EPPA 3UJ7A 2EG5A 1B42A 4BLUA 1ZQ9A 3I53A 3SGLA 2BR4A 4BLVA 3REOA 1QAMA 1EJ0A 1XCLA 3PB3A 5M5BA 3EMBA 1KPIA 2ZSUA 3BZBA 3SR4A 3KPUA 3VSEA 2C7RA 1L9KA 4ER7A 3ERCA 3ME5A 3NTVA 4RTMA 3MHTA 3E05A 4BLWA 4AX8A 3KU1A 1JTEA 1QAQA 3HA5A 1QZZA 5H02A 5B1SA 2VDUE 3TKYA 5EOVA 4E30A 4AZSA 2FRXA 2IH4A 1VP9A 4F85A 2BR3A 3TOSA 1MJFA 5IH3A 5KQSA 5CCBA 1ZGJA 2V74B 3MERA 2ZZKA 5FHQA 3EVGA 3OE5A 3C6KA 3C6MA 3KQVA 3FYDA 3LECA 4QPNA 3HVJA 5E9QA 5FULA 3SSMA 4DM3A 1FP1D 5LQRA 2PV0A 1WXWA 3M6UA 2XYQA 1T43A 3EGVA 5BXYA 3KQYA 2O05A 3OPNA 2ZIFA 4R6XA 5CVUA 4R05A 1AQIA 1ZHFA 4AZVA 2HR1A 4H0NA 4M37A 4PCLA 3BUSA 2ZIGA 1KXZA 1N7IA 3M70A 3P9KA 4R8SA 2ERCA 4PYIA 2KW5A 3FPJA 5DXAA 4YUXA 2ADMA 1FPQA 4GBED 5EPEA 2OXTA 2PBFA 2ZBPA 3LKZA 2P3LA 1P1CA 3THRA 5DRTA 4M38A 5G02A 1FBNA 3R6TA 3C3PA 2PWPA 1VL5A 4HTFA 4DKJA 2ZBRA 4OQEA 5EHGA 1RJDA 5K8VA 5EC8A 3B5IA 2G1PA 4OA8A 5F2NA 3NDIA 4P7GA 2B2CA 2GH1A 1OR8A 2NXNA 2E5WA 5ICCA 1TW2A 3BWMA 3FTFA 3VC1A 3EVBA 2P1DA 2PT6A 2NXEA 5LR6A 3HCDA 3IEIA 3CJTA 1SKMA 3DR5A 4KDRA 4ATNA 2QE6A 3FTCA 2GPYA 3Q87B 1VE3A 4FZVA 1NW5A 5DTRA 2OKCA 3GRZA 5HEKA 1NBHA 3LBFA 4PCAA 3PVCA 1JG2A 3G5TA 3GRVA 3B3JA 1X19A 2PKWA 5FHRA 2AOWA 5K01A 1M6YA 5GOZA 5K0FA 2Z6UA 2UYCA 2ZWAA 3EVDA 3ORHA 2AOXA 1JG4A 4R6WA 3QOXA 1X1AA 4FSXA 3HCBA 5KQRA 4FT4A 5LQUA 3CKKA 1Z3CA 4WVLA 2FHPA 3M6WA 1RJFA 1P39A 5E1DA 3GDHA 3HCCA 2ZCJA 1WZNA 2YUIA 4PNEA 2IP2A 3G89A 5GP1A 5DT2A 2YVLA 1XJ5A 3P2EA 3VYWA 3DP7A 5DM1A 3AWIA 4RVHA 5DM4A 5FCDA 3HCFA 4QPPA 2Z6QA 1YFLA 3K6RA 2AOUA 4GEKA 5CVEA 5HIJA 1U2ZA 3U81A 1BC5A 2O07A 3KR9A 4PYKA 3P2KA 1WS6A 3S68A 1DCTA 3BT7A 5EEGA 3DH0A 5E9JA 4IV0A 2O06A 4GF5A 3K0BA 5FQOA 4XCXA 1ZKDA 3M4XA 3UJ8A 5E2AA 3KQQA 4PIPA 2UYOA 3OZSA 4HSGA 1L1EA 1ORIA 3EVZA 3KR1A 5T6BA 1M0EA 2GLUA 2VS1A 3MCZA 1VP3A 2Y1WA 3NVMB 2ZW9A 3FYCA 3KQOA 3MQ2A 1KPHA 4QVGA 2P8JA 1XXLA 3FPFA 3GRRA 3JWJA 1ZG3A 1D2HA 1VLMA 2ONYA 3SMQA 3TFWA 5HIMA 1I4WA 2Q41A 3FUVA 1G55A 5FQNA 1O9HA 1VPTA 4QDKA 2F8LA 2ZTHA 2PT9A 5E1MA 5GM2A 4RTSA 1I9GA 1KPGA 5DM2A 5E1OA 1G8AA 4FGZA 5EG5A 5HZMA 1XDZA 5E8JA 3FTEA 2PWYA 3OE4A 3HVHA 3HCEA 5CCXA 5JR3A 3BXOA 4RYLA 4X61A 3G5LA 4F86A 3PX2A 4ISCA 2JHCA 3JWHA 1KR5A 2XBMA 3P9IA 3SSNA
chains in the Genus database with same CATH superfamily
4L0MA 3NATA 1TW3A 4QXRA 2AGAA 1RYNA 3S8EA 3HZZA 5CAEB 4RMHA 3COPA 1GZSA 2WP8J 3GBSA 1GGNA 4ITUA 5BV1A 3DXYA 4DLXA 2AG5A 1C1DB 3KDSE 5CJ2A 2YJGA 2XOKD 1U3GA 2PD3A 3FGNA 4LVNA 4M1TA 4PW0A 4QXAA 3G8YA 2C2YA 3LX8A 4UM9B 2WMNB 4WFKA 1GAQA 5EUCA 4QECA 3ZHQA 1KP2A 4EHKA 4EPRA 4FDVA 3T9FA 5CA1B 1PX0A 1B8NA 4OMDA 2P9HA 3ACDA 4AIRA 5LZ2A 4BEBA 1SZJG 3SZUA 3IEMA 1PV4A 3EX7C 1FJXA 1RLTA 2BVNA 4WKCA 3HWRA 4M7WA 5B1IA 2ZYTX 2F8TA 4KGVA 5HK8A 5TGDA 5J9FA 1GDDA 3W9BA 2DAPA 3SYLA 1GFSA 4E07A 1W76A 2PEZA 5EI5A 4BAGA 3AFMA 1II9A 2X1HA 4R3WA 5JMOA 3WWZA 5DRYA 1UMKA 4CODB 4YCCA 5KQPA 1PJ4A 1FLVA 1T8WA 2OR3A 4KRYA 5B6PA 2PUBA 1SCUA 2J0EA 3H84A 4MDFA 5BT9A 2W90A 2HREA 2O0HA 1JKJB 3UNXA 1L6IA 4URZR 1PVDA 3GP5A 2EFGA 2VKQA 2VYND 4BZPA 4ZK6A 2CNKA 3A1NA 3ABZA 1RHMA 4H9GA 4YTEA 5LBUA 2EL7A 5JHHB 5KNLA 3LDHA 4QOIA 3TR0A 4HT3B 4HNTA 4ZQGA 1N36B 1I6KA 2AR9A 2J85A 2CL5A 1Z6ZA 1M5TA 3BFJA 3G7UA 2C9BA 1NW6A 3P5BA 4L9AA 5BRJA 3HDYA 1E2UA 2BT4A 1CY4A 1A2OA 3OEHD 3IOBA 4XE5A 4CV2A 1OROA 3R4CA 4BO8A 4OGFA 2PWZA 1ZLYA 2CNBA 1ZI6A 4OKIA 2WJPA 4I3GA 1N2CE 2RGNC 4ZJPA 4I14A 1R16A 2C4VA 3SK0A 5BY2A 4E2FA 1CF2O 3O8BA 3CBJA 2AQKA 3D4LA 2HU5A 2F4NA 3CRQA 1TJ5A 1OREA 4D92A 1ABBA 3SAJA 5JJBA 4KRXA 5FL7A 1QTRA 1Q1GA 1LGYA 4G0NA 4H7KA 4Z1MA 1SG0A 3PDWA 3ZLUA 3GJ8A 5ESWA 3G0OA 3U7FB 5KSYA 3W04A 5JCJA 4KCGA 1VL6A 4W5QA 1K6MA 2C7QA 2QUJA 4XUGB 1E3WB 5AOCA 2I78A 4IGEA 3ICCA 1PZFA 1RAAA 2GD2A 4GYYA 4X1IA 1H8HA 4PEVA 2Q1XA 4LYEA 5EJGA 4CW7A 1NRJB 4N3BA 4RGQA 3W1EA 3ICQB 1I5OA 5ALHA 4B3DA 1NYLA 1ZCZA 3M6XA 4FCCA 2PMKA 4MULA 2ZGVA 3MTAA 3SEZA 4RZUA 1CUCA 1C8LA 3OFJA 3AM3A 4P9NA 2RC5A 1NC1A 4JT2A 2DZDA 2EJTA 2XLCA 4D8EA 3ZUPA 5REQA 4DSNA 4BQSA 3L6RA 3REQB 3H99A 5DGHA 1U3CA 3GGJA 1L4KA 4KGXA 1ZRMA 1NRXA 4JLMA 1M7GA 3EUWA 4AG5A 3L7YA 5F52A 2L18A 1L8LA 4CMAA 3G23A 2E85A 3WGTA 3D3KA 2DUMA 3HVKA 5ITZB 1QYWA 2HQRA 1XQ9A 3TIFA 3FBTA 4IZ6A 2I1QA 1YIOA 3KXIA 3H8BA 1T1SA 1XTTA 3PC8C 3DF9A 4LJ6A 4XIYA 3IH5A 2NO4A 3A0RB 3AONB 4Q37A 4DUPA 1NV8A 2HIAA 4M0MA 3WLFA 3SJBA 2VHVA 3UGJA 3DOOA 4G9EA 1PL8A 2ZAIA 4S1WA 4X54A 4Y2HA 2A1TR 1JFFA 2WUDA 3HJRA 5LZ7A 1B8VA 1QAOA 4DIOA 2YNMD 4RF0A 1K9SA 4P32A 4FE3A 3KC2A 5JU6A 1T2EA 3N53A 1E2DA 5BQPA 3K71B 4KPUB 4G85A 3BDAA 1AB5A 3G0HA 2R8PA 1JIJA 1KI3A 1PL6A 2A9KA 4OU4A 4U5XA 4YJ3F 3OJXA 2JFNA 1UMBB 2YINC 3D02A 1OGIA 2VAWA 3KZVA 3N58A 1CW2B 5I8ZA 4G4SP 5C51B 2IV7A 3ZVKA 4P0TA 3AEZA 5CA0A 1MB2A 1U9JA 1KO5A 4GUDA 5EKDA 3ZEIA 1P8AA 4B83A 1QQ7A 4IDPA 5JRZA 2UDPA 3WMGA 4ESVA 3S6JA 2NVWA 4NSNA 3TE6A 3UWDA 3B52X 4X85A 1V8BA 3NIWA 5KWJA 1Z15A 3SQDA 3AUYA 2G1UA 2LNDA 4BQEA 1KO8A 4NI5A 4DFDA 1I7LA 2DBYA 3R5KA 2QTWB 5DLQC 1JE0A 1BAPA 1EBUA 1PR3A 5EIWA 5IASA 2BDEA 1IQ0A 1YQWA 2ZYSA 3CLKA 1YZVA 3COWA 3FRIA 4DCVA 4DB2A 4ECEA 3KFQA 2J0VA 2JBWA 1OJ7A 3AHJA 3DOHA 3H1GA 1JBQA 1H2WA 1FE8A 3EWNA 1LBHA 4G0OA 4DC9A 3KUCA 3MHHA 3TUIC 2VBGA 4FJ0A 1NVBA 3W79A 3FETA 3JRNA 2FO5A 4EYGA 3D8SA 1W9HA 4Q4LA 5CIYA 3LY8A 4Z8YA 3RUFA 1MV8A 3LDFA 1F5SA 2FN9A 2W6MA 3N2EA 1V11A 1ZU4A 4GPEA 5IDQA 4CQJA 2XAUA 4LDRA 1KEZA 3STXA 2CUNA 3CZPA 5DTIA 1NMSA 1QFXA 1Z33A 2PXXA 3JPWA 3MUNA 4FFOA 5KAPA 3H6HA 4XYBA 3VJKA 4BWVA 1F1BA 5LVAA 4Z4GA 2AG8A 4MICA 1V5EA 1BD3A 4MKFA 2QRUA 1JDNA 2E82A 1GVHA 1UP6A 2EU8A 2J3HA 1R4NA 1P9WA 2XY4A 5C1IA 3ROEA 4F92B 2GBPA 1BS1A 2OO3A 3LY9A 3OY2A 1XKQA 4HC4A 4HNQA 4CQMB 1ISJA 1PLLA 1JDTA 1JDPA 2OY0A 3EW9A 3GK3A 4MPDA 5EJ7A 2J59A 3NW9A 3QX9A 2DTDA 1RPZA 4NS1A 4GLJA 1Y9DA 1DAEA 1QIEA 1Z6PA 3RBZA 5A02A 1X7YB 4RA6A 3WP0A 4C4RA 4NCNA 1U99A 2HMAA 4X1KA 2FPSA 3F7NA 2AMYA 5GGYA 3H65A 2GVZC 3D1VA 4M1QA 2JKZA 5IDXA 2C5EA 2I2DA 2VL7A 3A1WA 1GZ3A 4HP8A 3AKCA 3OWXA 4RM2A 5FOTA 4AZ3B 3L4JA 1Y6GA 3V2IA 1C80A 5CB8A 3IO5A 4RANA 1ISSA 2WB2A 5IC5A 1E7WA 4X20B 1TCVA 4FIDA 5AM5A 4P5DA 3OBBA 4LC0A 3C3MA 2VDNB 1X7GA 3RJTA 5IKOA 2FQXA 4ZODA 3RK4A 1SUAA 3PQ5A 2ESRA 4MQLA 4KSYA 1O08A 2ZK7A 5L45A 3FPCA 3S2ZA 3TCKA 3LLSA 4MI6A 1DZ3A 2EP5A 2IX9A 4TUYB 1R1DA 1V9CA 5AJXA 1PJCA 1NA5A 3HI6A 3E22A 2A0WA 4PYLA 1A4RA 4XJSA 5L3ZA 3ZX4A 5JI2E 5DNAA 2JD2A 2GO1A 2NACA 4ZPJA 1WXGA 3PD7A 4C7XA 5EFOA 5F7JA 2XUHA 4YCNA 2W42A 4KIWA 4HLDA 4QASA 4R9VA 3L7LA 3T41A 3ZY2A 5HR5A 2FF5A 2B4YA 2LW7A 1VCOA 3T3PB 4DSZA 3KTAB 4JEIA 4N6NA 4Y2PA 1W88B 1YQEA 4A0HA 1O8BA 1MAVA 3B9RA 1PCIA 3HVRA 2ZP1A 2LV8A 1Z22A 5FLYA 3ZIDA 2DQYA 4NEQA 5TQVA 1GFZA 3HV2A 5BW4A 1GKIA 2YBDA 4CG3A 1RIIA 5B3JC 2SHKA 3QSYA 3DULA 4GNRA 2CNLA 1T3GA 2C2BA 1CUYA 3DEIA 4KQCA 1YB4A 1P81A 2DQ4A 1E0SA 2R1UA 1KTIA 5H8WA 2XU5A 3K1AB 5D84A 1U04A 2Z6AA 4PYMA 3OFKA 3S27A 2XNDA 3F3MA 1FEZA 2Y6VA 1T1JA 1OIVA 2DJ5A 2RGDA 4LVOA 4NMXB 3MG9A 3SM3A 2VRNA 4PSAA 2PGJA 4ZN6A 1A72A 1GLVA 5B7PA 1AK9A 2ZULA 2PX6A 1ZS9A 2X0JA 4RPHA 2LIPA 1INLA 1P4HA 1Z4PX 1RVDA 4ZTBA 5K3SA 5IVHA 4P4SB 4PNPA 3QW2A 2ZB4A 4MB2A 3SX4A 2VRCD 4HYEA 2Q5CA 5HIIA 1D6MA 1WUYA 1AD2A 5A0TA 1ZN9A 1L5FA 5I4BA 1BDMA 1FYVA 3PCTA 1WZUA 3OT4A 3E15A 4TT3A 3DP9A 4JLUA 2M6SA 2J33A 2C3PA 3E1KA 4BB6A 1O6FA 3F5SA 1OF1A 3LZDA 3Q3GE 4KO3S 3K5HA 1E7QA 4MRMB 2FPPA 4G0XA 4X9XA 5DTMA 3VZQA 5LLTA 1QP0A 2PJDA 2JANA 3SHOA 4X97A 4YO8A 5BW8A 3EBLA 1RWWA 3X2SA 3ZCSA 4GKKB 2UYQA 2VC2B 3DL0A 1C0LA 1RWKA 1P7YA 2NTVA 1AS0A 1R8YA 4L0DA 5BSHA 1DELA 4KVAA 2PSDA 3VR3D 2DFPA 1ORHA 1SQFA 3PQDA 1FTYA 4WK4B 5FPSA 2JNWA 3SYRA 4E08A 3SVLA 1C9NA 1I30A 1XLTC 3RS4A 1T5LA 1J49A 3O73A 4M88A 2W11A 3GUHA 1CRZA 1T4CB 2JIPA 3VPXA 3JS5A 1LLUA 3K5IA 1K5PA 4L8VA 4KQEA 3JAWB 3N9IA 4IDDA 1IOZA 2FFJA 3K0FA 4LMPA 1SHTX 4RKQA 5AH0A 1AKEA 2Q5HA 4Z9BA 3V6MA 2VQDA 4QODA 5B53A 3HXPA 5ESDA 1IN4A 1RJ9A 4TQGA 3SC6A 1SHUX 3VSEA 1OXSC 4BNKA 3A1CA 2BI8A 3R3VA 4R9UC 2QAGC 4TLBA 1FMFA 1WPGA 2X42A 3FTPA 4M4SA 4Q9HA 2ZSIA 3HB5X 2B34A 4DIBA 3HA5A 4KAFA 4YALA 3GF4A 1MC4A 3HQ4O 4ZZIA 1THEA 4QJ5A 3U3ZA 2VDLB 4F5DA 3WDLA 3ZWMA 1Y3FE 1KU6A 1KRXA 3BB4A 4OQLA 3ETCA 4QFMA 2O7NA 3NB0A 3EMKA 5LD2C 2CFIA 1C14A 5FULA 4P16A 5AKEA 2XRMA 1VGQA 2P4HX 1WXWA 2A9OA 4I6GA 1C9KA 2NNLD 1A9PA 4ND2A 4OSOA 4CR7A 3CN9A 4F04A 2VDMB 3RAGA 4MKHA 2VF4X 3C1UA 4KLCA 2VJDA 5JAPA 1RPJA 4QWWA 5C32A 3FCXA 1E9SA 3UQYS 3ENZA 3A6HA 4CLOB 3ILVA 3AB8A 4TQUS 2CFRA 2RHJA 2ERCA 4ZIRB 1VLZA 1Z45A 2FSSA 2OHOA 4HAUA 3TMYA 4D3ZA 3KVOA 2NU7A 1Z26A 2ZBPA 3PEFA 2UZ3A 1E2BA 1G9XA 2QVCA 2HA2A 4P6VF 2AFRA 2PLNA 4WK0B 4KR7A 3C4QA 3WNQA 1LU9A 2F17A 1C7RA 1LVGA 3CLRC 3PQ7A 5HUJA 2PUFA 4WCFA 4WZAE 2NQDB 1XWWA 1ZJJA 2V7XA 1GG2A 5LUAA 1KH3A 3ZBTA 3B5IA 3PYLA 3HP4A 2CC2A 3U13A 1OXKB 1DHRA 1PT8A 3LXMA 1W9MA 1WW3A 3H9QA 3JV7A 4RL4A 4RSMA 5K3CA 3R7BA 3BWMA 3RKRA 1L5YA 4OK6A 4GWKA 4PZ0A 1M6HA 3W6NA 3BRCA 3KQUA 5PADA 1L5MA 4MYTA 1ZVMA 3MGBA 4DW8A 3DR5A 1XDWA 2CNWD 3JQDA 5G1NA 4ATNA 3V2UA 3G68A 3H1FA 4UAGA 4BVAA 4CCSA 1EXVA 1NLUA 2C4HA 2FPGA 4LY6A 4AJ9A 1VGVA 2FPWA 2FMUA 2R1TB 2XB8A 2ENUA 1YVBA 2SCUB 5AK3A 4YIHA 1WMBA 5JQGF 3RSLA 1JHUA 5IWCA 3CQ9A 3UAVA 3MCAA 2BFWA 4DAEA 5HP4A 1A71A 2XMZA 5IJ0A 1KJQA 4RD0A 5LJIA 2O3RA 3QOXA 2FNAA 4IIEA 2A0FA 4HMQA 1K88A 5KVVA 1W49A 5KTMA 3K96A 3DKVA 3DVRX 1N25A 4WVLA 2XLBA 1B8PA 1PNVA 1MOSA 1Z6YA 3LRXA 4YNBA 1S3GA 1XYGA 3RVPA 3GEHA 3ONVA 3HCCA 4J0CA 2IIVA 2LKDA 4MK4A 2PKCA 1B1CA 4EPWA 2YVLA 1YD7A 2OHFA 4M1YA 4F4CA 4AMUA 2GKSA 3R0JA 3UKOA 2VZEA 5HJ7A 1O94A 4IBOA 2PTGA 1DRWA 4NCBA 5KYTA 3P0JA 1QZXA 2E4WA 1FFGA 1PJLA 2FFBA 2VG8A 3ASVA 1DBPA 2B1IA 1Z5UA 2RKBA 3NCTA 4MO9A 1GNRA 4L08A 4OAPA 1V4NA 3NGXA 5E9JA 2OGTA 4CI0B 1J2TA 2WLTA 4RLFA 3H2IA 4I36A 2A1UA 2Q99A 4HSGA 4WBNF 4L8LA 3WRYC 1D4AA 3FHTA 1UT8A 1YJCA 1VFPA 2E9SA 2ZROA 4JUFA 4Y6QA 2ZPTX 1VIYA 2PUAA 4F2PA 3KQOA 2D1SA 1PJAA 1QGAA 4RV4A 4RXUA 1QYIA 1XXLA 1QTNA 3T9EA 4ALNA 3W3AH 3JYHA 3AO0B 4FEEA 5CCDA 3TFWA 3VPSA 5EP4A 3FUVA 3EWSA 1ZK3A 4ML3A 4A0SA 4B6EA 2EWVA 5F3RA 1MAUA 1VG8A 1YKSA 1A4XA 1Q19A 3AESB 1Q22A 1ZVQA 4MKZA 3W2TA 1VSQA 2XEDA 1QJ4A 1KK3A 2YWDA 4M49A 2BZ0A 3HVHA 3W34A 3BULA 3VKWA 3DHWC 4INAA 4XYLA 4JBYA 3MWGA 2VH5R 2JFHA 4J94A 3T99A 2C94A 1PNQA 1KR5A 1TJNA 2WU3A 3R6DA 5AKHA 4D3XA 4QDXA 3PC8A 3EGIA 2JDIA 4O4HA 1K97A 3HY6A 2J9GA 2BU3A 2R60A 3A05A 5F3WB 1P7WA 1M2JA 3R5JA 4N12A 2WM8A 1LPBB 1C81A 2P9GA 3QLUC 4ZXPA 1GTG1 1KMIY 2SKCA 4OFBA 2Y1FA 4UBMA 4A03A 3I1FA 4TVBA 3RJ5A 4F56A 2RJNA 4PZCA 4WW0A 1K8ZB 4DQLA 1H2XA 2F3UA 4WASA 2F9FA 1U8AA 3A9SA 4J0GA 4ASUD 4PFQA 1U3DA 2M2IA 3KOUA 3RRZA 1G7SA 3ZGYA 4MZXA 2VYVD 3AHDA 2VSFA 3ZLBA 3A9UA 5AKYA 2ZRBA 1SPXA 3NORA 2XRYA 2AL7A 1XVAA 1EVYA 3SF0A 3DQQA 5BSEA 5AI8A 1OE0A 2WWYA 4WECA 3HJFA 2KHZA 3ZCTA 2MMCA 4DV4B 3VJRA 3FUTA 4CEIB 3P2IA 3F47A 2HZBA 4BFVA 2YOHA 4CM3A 1QB7A 4FHCA 4Y2YA 3UF0A 3D5QA 4BECA 1R0WA 3IMGA 2MYUA 1AVTA 4B6QA 1GSHA 4ZI7F 1U9CA 1G18A 5ERGB 1Y6ZA 4ZVMA 3V2GA 1KK1A 3GRAA 5KEIA 1R9MA 1R27A 4DJAA 4MYCA 4UZFA 3MS7A 3ER6A 1EFKA 3P2MA 3NBAA 2P41A 1GZ4A 1HKHA 3PPWA 5EP2A 4RFSB 3RUCA 3SJ7A 3DF0A 4RADA 4DCJA 4UMDA 3WIDA 3VAAA 3A2LA 5CGQB 2WYUA 3P9NA 1FDSA 1I33A 4BS9A 3DLBA 1U4NA 1ITOA 1RI2A 2OB1A 3H2HA 3W6OA 4Q47A 5IAOA 3JQAA 4GXQA 2OC9A 3J7TA 1C8KA 4P7FA 2ANCA 3LTEA 5HTOA 3GLVA 3RR2A 1BEZA 3U49A 3TECE 1SCNE 3TZHA 5JH3A 3H9UA 4NZZA 5G3YA 3R7LA 1UPTA 2XCUA 3WMXA 1Y4DE 3VO2A 1RHQA 4C07A 4ZWNA 4BEJA 3R9KA 1G5TA 3F8TA 5ES4B 4NCAA 3C8UA 4B3RB 4FSHA 2QRLA 3UHPA 3QYPA 3O8OA 2H51A 2CJPA 3KELA 1JN0A 3LCUA 1BYIA 2VUSA 3P32A 3PYXA 4YV8A 2UYYA 3FGZA 5K4AA 2Q2OA 1BQ4A 4YH1A 1I3NA 2HDNB 5D3ZA 3UAXA 4DJ5X 3THYA 2MCFA 3RREA 2OUIA 3NHRA 1NYQA 2V96A 3I6BA 1CJSA 1SVUA 4O29A 4OUDB 2ABWA 2V7QD 4Q93A 2P9FA 4QOFA 4XQEA 4KVFA 5K03A 4B9EA 1CSBB 1MJGM 2F55A 2WHRA 3AL3A 2BSXA 1TM1E 3G2PA 3I2HA 4JC5A 2FG7C 2GQ0A 3IE2A 4Q6WA 1JPVA 4DMKA 3M33A 2PFSA 1BTOA 1PW7A 1U3VA 3RYCB 4UDYX 3GHYA 1JWLA 3CR8A 4UBOA 1IIBA 2VYQA 1J70A 3GMTA 4GBJA 4IVNA 3K0AB 2XGSA 2VTKA 3MIIA 2D1TA 2XVMA 4O5AA 1W44A 3RVNA 3IILA 2DXIA 1HLDA 2CL6X 4KYVA 4LVCA 2AJTA 4XGRA 4W8HA 1EBFA 1KSGA 5A1JA 1NN0A 1GPBA 1JQDA 4B84A 5LFAA 5LP6B 3BXPA 4AJJA 4KFCA 4DMXA 3LA8A 2YIJA 4OHWA 5KTYA 5C35A 4JI0B 5FJJA 1EG7A 4Q9JA 1SVWA 2XHEA 3CG0A 3IAHA 1LA2A 5ER9A 1UPFA 2PQ0A 3BD9A 4GHWA 3YASA 3GLGA 1EXWA 1XYYA 2QI9F 3DZBA 1HE4A 2OXFA 2PGDA 1YQQA 4WPGA 4TSRA 1LWOA 1F2UB 1Z29A 2AN9A 3DGEC 4IXDA 2XAAA 3MBIA 4EPTA 1G2PA 4RMJA 4WKNA 3VMFA 2HBRA 3PQ8A 4WZZA 4LE2A 3GRUA 3HR4A 3OCCA 2B8NA 2OVFA 4NABA 2FW8A 5AJHA 4EENA 2DFKB 3FVVA 3LC7O 3PCXA 4I9UA 4KVZA 3TW4A 4Z6KA 4A10A 5EIOA 2C1EA 4GX0A 3V8BA 1QO0D 4HJRA 3ZHSA 1X2EA 3DW1X 4BV3A 2QQFA 1Z9BA 3KWJA 1CDEA 2BFBB 1YWGO 4MH0R 3MWEB 4ZVPA 2VJOA 3CUEF 1ESEA 1DEXA 3L6BA 5EESA 3WLAA 4DL9A 1HRDA 2H08A 1U8CB 3PC3A 2PSHA 4ZYYA 5E95A 5AXAA 5JAOA 1KEKA 2O8NA 4AJ2A 4L4SA 4GR9A 4C4XA 5KTRA 4R8MA 3DMYA 4GL4A 4MQEA 1GUZA 5TS2A 4G1MB 1QMYA 2YYYA 3JQFA 3ZU3A 3NEYA 1B3RA 1QR2A 3FG9A 1FZQA 3LZ6A 4KLRA 4E2YA 1WKBA 1XD8A 4U3JA 5KYUB 1L8QA 4ALJA 2QF7A 1QXSA 3FYHA 4JLVA 1LRJA 4R41A 2FPIB 3QXHA 2CY0A 1FNNA 1JX6A 3QWAA 2FYEA 4TTAA 1HK7A 1FMJA 1NRWA 5TMPA 4QGSA 1TD9A 1Z0IA 5FOSA 2RB5A 2EF0A 1HDCA 2D5CA 2WSBA 1J20A 4DMMA 1YA6A 2QAGA 2OENG 3AILA 3GT3A 4PPYA 3OQMA 2ASEA 1L9XA 1LW7A 2N47A 5I9IA 4E4RA 1JHVA 3BHNA 3WADA 2JARA 3QELB 3H11B 3L8GA 4QYSA 4F84A 3PRPA 4BGDA 4LFCB 1NF9A 2I7VA 1XMSA 4Q34A 5LKRA 3OIFA 3TRFA 1M0WA 2X4DA 1IZZA 2Z1MA 3O2JA 3W31A 5TQ0A 3IJ5A 3KPVA 3NNSA 2DGDA 1DAPA 3O8NA 5AQ1A 4DSAA 4QLOA 3PNQA 3TLGA 3FTNA 3D2AA 3QUSA 5AJVB 2WMDA 5A4AA 3KX1A 1MOZA 1XJ0A 4V0NA 4GDMA 3THWB 3DE3X 3HACA 5EIBD 2QGNA 4RD6A 1SCAA 1GKYA 5E8RA 2ZRDA 2BH9A 5EF4A 1HY3A 1RWNA 1UMDB 3PVSA 1OBCA 2GXQA 4LGCA 3RRFA 1R66A 3I0MA 2X0EA 3P5VA 1EBBA 4EHBA 3SSOA 1QRTA 4MYRA 2ZZNA 1DF0A 2CBZA 4CM4B 3L6OO 1V6AA 3IQWA 4IDFA 3BXGA 1ZOLA 3I9OA 1UDWA 3KYCA 4GBGA 5DH9A 3D6NB 2ZBQA 4FHGA 3WP1B 1RXVA 4F72A 3M2TA 2BGRA 4EK9A 2O2XA 2HZ7A 2LE0A 2HSDA 2ZS7A 2QGFA 3OCUA 4BFXA 1KERA 4JNKA 2MSLA 1PJRA 1PTJC 1VZ3A 3NO4A 2P3QA 2P8SA 1WXHA 2OZKA 2WYWA 2C0CA 2H2IA 3CISA 1W73A 1ZK2A 2I2CA 2Z1NA 3FLBA 3DQPA 2ZYVX 4YAKA 3Q0TA 4FWTA 3DFIA 3O8QB 3WKEA 2PGLA 5BP7A 1AHPA 2RC6A 4YWHA 1UEJA 1WMAA 1Y7IA 2PSEA 4FNOA 4KGZA 1FFCA 3FFXA 2I33A 3PFBA 5KNCH 2ZUFA 4A36A 4YQYA 3C8DA 3PKJA 4M46A 4B0OA 3AC0A 1HH4A 3TEMA 1R0BA 1XMOB 3BWBA 3A58B 1G3MA 1XEXA 3UYLA 4YDRA 2BZGA 1I7NA 1ZSNA 4KYIB 2HMVA 4AK9A 4X41A 1JNXX 3WB1A 2O2YA 1FRNA 2LKCA 3M6MD 1XROA 2QAJA 3AU9A 4N7RA 1M2HA 5EHXA 2Q9AA 1XKLA 5FI0B 3VFDA 4F9FA 2H31A 3W7AA 2PGIA 4EHIA 1KJNA 1TEVA 2FR8A 1M6WA 2VHQA 3KWLA 1JAXA 4FD2A 3RC8A 3HEMA 4PRZA 4Q3LA 3CS3A 2W0MA 3CZQA 4NENA 3P71T 1UJ5A 4U9IS 4P5EA 1P0PA 8OHMA 4QFBA 4E2XA 3D64A 3ROZA 1TZJA 3BTOA 1Z38A 3CSUA 1F8FA 1ZIDA 2G9ZA 2QX4A 3LY5A 4KDEA 5A3VA 3D4BA 5JWRA 5BYJA 3S3QA 4L8FA 4DWWA 1T36A 3L0CA 2XA1A 4PZPA 3K9LA 3RUDA 5LKAA 2FPXA 2O8EA 3OO1A 1G6Q1 3BZUA 3HL0A 1C4WA 3DOEA 1O9GA 1IMOA 2ALJA 4FDTA 1YDHA 3T61A 4D79A 2QV0A 2AUNA 3DKPA 3JQEA 4EY4A 4XYGA 2ZQYA 4KPGA 4LZJA 3FGPA 1MABA 2V7PA 3MTBA 5DI3A 3OJEA 3KEFA 5C3MA 3D6SA 1TYEB 2FFQA 1NY6A 3SYKA 1RDFA 4KOEC 2QD3A 4KWTA 4MPPA 4TZ6A 4OQDA 2B1MA 1PJQA 3WGYA 1ZC4A 2B7LA 4Q4HA 1WQ3A 2YFQA 2CK3A 5AM3A 3ANNA 1OYOA 1WB5A 4OH1A 3CH3X 1Q3HA 1EFVB 2FG6C 4GQAA 4WIAA 5SZJA 1OVGA 3RVDA 5A9SB 2QBYB 1QLWA 4EGAA 1MIOB 4RLHA 5ALXA 1QTIA 3GZNA 4FNAA 1XNJA 2IQ5A 4FQ8A 2FPUA 3KZXA 4ALLA 5DB4A 5I3ZA 3CPSA 1QFZA 3EQ7A 1KO7A 3DZKA 1YDMA 2EVWX 4ARVA 1SNYA 5IM4F 2FOIA 1H6AA 3HU5A 3P94A 3NAMA 1R4ZA 3SM9A 3IAM6 2P35A 3UV6A 2EIHA 1ZMXA 3OIYA 5DHAA 3LLVA 1KI9A 4EO9A 1SHKA 2IXGA 4M98A 3X44A 1T9CA 1BP4A 4KLBA 2H7YA 3SNKA 4DWVA 4B3HA 4JKYA 4XFDA 3EPPA 3JQQA 3RDPA 2IHNA 2V6MA 3CRZA 5KYNA 1P3Y1 2RGUA 5K3DA 4JYPA 3ZU6A 2R8RA 5FAKA 4R1TA 3Q9LA 2PSFA 5C5DA 3HXOA 1JEJA 4J49A 3VR4D 1H5QA 3T9DA 3CINA 4G5FA 1B1AA 2OZ2A 4FZ3A 1RBQA 1WPXA 1XO1A 4IOMA 5DP2A 3REOA 2FP4B 1U1GA 2ZRQA 5B5SA 4ZO7A 2IOFA 4DN6A 4GWGA 2VN8A 1Q0ZA 1G21A 1GOTA 4QU9A 3EZLA 1QOQB 4RF5A 5BURA 5FWNA 2WD9A 1OBFO 2VRCA 3LX5A 2FWJA 3WTBA 3IMAA 2IA5A 3ZDAA 1W34A 3UM9A 2E87A 1E4VA 221PA 5B1DA 1QZZA 3ECAA 4OMFG 2MWMA 3EDQA 5EPOA 5B1SA 3ZIAA 2P0YA 3BGOS 1NNLA 5FOUA 5AVUA 1GCIA 2GESA 3GRCA 4I04A 1YRAA 3NXKA 2CXSA 1WM1A 1VHTA 4NDNE 4MRPA 3KU4A 4RFVA 3KQVA 5DHQA 1ECLA 3SSMA 2H9AA 1ST3A 1TKCA 4OLJA 3K9FC 1M1NA 1S6YA 3QPVA 2G04A 1T6ZA 4KV9A 4L4ZA 2YJ9A 1W4BA 3M6UA 4IDQA 5LYJA 4P0QB 2AFHA 4FFWA 421PA 2ATOA 1F4VA 4QFDA 1RZRA 1RBYA 3U56A 1J99A 2QRGA 2FVYA 4FGKA 3FFTA 3FYUC 2VAXA 1NQVA 3HJGA 3P9KA 2QW8A 4FW8A 4FZJA 4JMLA 1J2JA 1FRZA 4AJHA 5JBQA 3TBHA 1UBHS 1G0OA 4QBBA 1VHLA 3OZEA 1YVRA 2QV7A 1ZOOA 2ROQA 3THRA 3TTWA 2DC1A 5H59A 1L5SA 5CB4A 1DBSA 3D31A 5FTJA 1N5OX 4A23A 3IAXA 4YRDA 5THKA 4UATA 1KSFX 1LY1A 1GG5A 1VRCA 3N76A 3PPXA 4TLLB 5EFZA 1VRVA 3UG7A 4V0ME 4ZCTA 1KI6A 3DFUA 3ANSA 1QH1B 3CTMA 1GA4A 3DUFB 2E4ZA 4QQRA 1M6VA 1UM9A 5KSZA 3I30X 3FTFA 4LRXA 4AB1A 2PCJA 2VWQA 1XXHA 2HFJA 5DNDA 1V3UA 5D5HA 3LVBA 2WF6A 4DRXB 2IKSA 1TVKB 4HEA6 4MVCA 4JBNA 2W4QA 4P3OA 2BUCA 4CIXA 5EZ5A 2XIQA 1ISGA 3OEWA 1EFTA 4LF5B 3BRSA 3HP1A 1OU4A 3GRZA 4MW9A 2QVYX 4RD2A 2IZ5A 1RRKA 1YMUA 1QLJA 2F43A 1Q0RA 1UBUS 2GHRA 1EFHA 1E58A 2FUCA 3DO6A 3OZWA 4IXTA 3G5TA 4Y1EA 2ZR9A 5GJBA 3EIFA 5CVMA 2CVHA 3GLFE 4WESB 4Z7QB 3FMPB 3KHUA 4NMHA 4OXXA 5EE1A 2G36A 4UTXA 4C7OA 3BXHA 5COBA 1GA1A 2AC7A 1RRMA 5CX1B 3A3OA 1YRBA 4JQCA 3TW0A 4N40A 1Z8NA 1OLOA 2FKNA 1P2TA 1X7DA 2BHLA 4PHHA 3QEAZ 1EWMA 2WJWA 3QKRA 4HDQB 3CKKA 5TMBA 1HDXA 1LSJA 4X64B 1JKMA 3FJ1A 3VKHA 1P39A 5C1BA 4XDZA 3Q7SA 1L4YA 1M2OB 1D6JA 3LTNC 1EDZA 2CXRA 3A1SA 4NZOA 4UXHA 1T35A 5AJYA 2IPLA 3AB7A 3QU9A 5D86A 1HYHA 4UEKA 5C1OA 3OJOA 3GFSA 4TPKA 2HF7A 2OO5C 2DLDA 1M0SA 2RHBA 4YACA 4AF7A 4D82A 3PLRA 5DBOA 5TY0A 1L5KA 4BQVA 3DVLA 4CDGA 5JS6A 1QRDA 1WUKS 4RD3A 3RIMA 1KF0A 3KEOA 3PSAA 4CE6A 4JBLA 4ESHA 1TMYA 1GKLA 4LSGA 1UOPA 1GL6A 3TFQA 3ZV6A 5CBKA 1S8AA 4FIZA 4HAWA 3EZ7A 1V5WA 1M2VB 3MCZA 5D6NA 5T57A 2O8DA 5E3IA 3BDIA 3NVMB 3N8KA 3UMFA 1PR9A 2XOXA 3DB1A 5EVCA 2Z2ZA 2RJOA 3QOYA 5B7GA 3B70A 3P9RA 1R5BA 2QMUA 4G4GA 1X7HA 2ZIWB 3VOSA 4C0BA 4OFZA 3LUFA 2OMKA 2CLOB 1YS1X 3ECSA 3PHBE 1I4EB 4Y2XA 1NHWA 2QS9A 3C41J 3COZA 1G8AA 1DLJA 4I50B 5D3KA 4A6XA 2V7GA 4IM7A 5JI3E 1YCHA 3CY6A 3S8MA 1SKQA 4D4LA 2GZMA 3DO8A 3DQZA 4O8ZA 3JZDA 1IPEA 1T1EA 5DXFA 2JFYA 2Z57A 1PK7A 1ZM4A 3PE6A 4OSEA 2J31A 1FC0A 1G5IA 1UWLA 5HG0A 3HTXA 3GZTB 2XBMA 1CVIA 3LUKA 3RS3A 2CLLB 4CYMA 1JUDA 3QJGA 3UMMA 3VV2A 2ONKA 2PS1A 4KR3A 2BTOA 3VTKA 2JI7A 1NUAA 4DS3A 1MEJA 5AHRA 3GVXA 3MIZA 3NXSA 3PG5A 1A8UA 1ECBA 4K0KB 2XB2A 2HPVA 2Y9PB 2VNKA 2O7SA 1NG1A 5ECDA 1IHPA 4OGKA 5AVRA 1YCFA 2NO7A 3OZRA 5GJCA 3RTCA 3UIEA 2R6JA 4NJEB 2QVXX 4WLVA 3SVZA 4BCBA 3CUSA 3A4TA 3VQTA 4Q9LA 1NVEA 1SUPA 4YV0A 1COZA 4KE7A 1QQ5A 1P2DA 2RCNA 1YU6A 4EB8A 3NBYC 1Z08A 2IUUA 5TGTA 3LOPA 1YC2A 4M0KA 1NVAA 1QGUB 1E60A 1QCDA 3ETLA 3ZWNA 4REQB 2QTAA 5FJIA 1RI3A 4AXXA 3ITNA 4YCBA 1QPBA 3DE6X 1PLJA 3K53A 3LAWA 4RBNA 1WBDA 1CP3A 1E2FA 1V1MA 1T2FA 3D8NA 4LTDA 2V4ZA 1H5NA 1AC5A 3D3WB 3QP9A 3AEXA 3RW9A 1HETA 2A84A 1U0RA 3W1VA 2JIQA 2TMKA 4QOGA 2BSAA 2JJ1A 5EJMA 2ZS8A 1QG6A 3PF8A 1W6RA 3IV6A 4KXWA 4LX8A 4V1CB 2XU1A 1JMKC 1NBMA 5KTPA 1JR3A 2XH8A 2I2XB 3T5CA 2QZPA 3USCS 4J2OA 5UKDA 4BX0A 4F8EA 3E48A 1E0AA 2ODQA 2QPAA 3W2GA 3QBDA 4G24A 5EIHA 2P2CA 1O87A 3FMIA 4TYWA 1SCKA 3HUEA 1Q91A 5K0CA 1F8GA 3ZZ0A 4DNQA 1E8NA 2FW1A 5DE3A 4ASUA 1QO7A 4J1SA 3GJ0A 4BCDA 2QNRA 5LQNA 4CDEB 3RFUA 4EGQA 3GPIA 3TSOA 4YMTA 3A9CA 3RANA 3LQFA 2H7VA 1O2DA 3F4BA 4O63O 4OIFA 4FFSA 3REGA 3WOVA 4IWXA 1HBJA 3H9GA 4OQMA 4ZP1A 4QDJA 3AUSA 3TAXA 4YR7A 1U1DA 2ZJ5A 2BBTA 4H08A 5L3RA 5BSVA 1ILEA 2FY8A 3GGSA 1RXYA 1ODKA 5TIIA 1RM3A 2GGSA 3QLUA 4OOFA 3U39A 5FLKA 4D7AA 1TVEA 2YZKA 5ADUS 2O8FA 5HX7A 5I9BA 2QQ0A 2CVZA 1DL5A 1XLWA 2CFOA 1NQWA 3GMDA 3O4FA 3FLMA 2FUKA 5E4YA 4DV6B 2V0GA 3FVQA 3MELA 5LA6F 2VVTA 4RJLA 1G20B 4FZ5A 4DZRA 2G0TA 1NSYA 3OZUA 1NXSA 1OA0A 3BWDD 3U4QB 1V3VA 1ZD1A 5CLQA 2I1VB 2FWAA 1IHOA 4J29A 5L9AA 3DE7X 4EG0A 1RLOA 3L0IB 3VTAA 1LH0A 2BEWA 3H6SA 2JFWA 2FXVA 3ZZUA 1AIPA 2GILA 3IR7A 1XZPA 2Y05A 3L49A 2UXCB 4OATA 4DQDA 2XTNA 3SP1A 4HFJA 3GELA 5IH7A 2IU0A 2AR0A 2WRZA 2D1YA 4XM1A 2J1LA 4L72A 3ZNNA 5DX0A 3ZZTA 3BMNA 8ATCA 1QANA 2I66A 4ON9A 4RDIA 4O2AA 5SY4A 2JIZD 3KV3O 5A4JA 2YW2A 3CX8A 3TXXA 2R9OA 2EX4A 5CXUA 3QKSA 1NFFA 3AR6A 1R8XA 4EYOA 3KHSA 3GQBA 2W2LA 2EP7A 2RGRA 4ENSA 2R6ZA 3WGQA 2PUCA 4PICA 1K7XB 1NBIA 3ZGXA 5HA5A 3UGQA 3TVTA 4YMGA 1JLRA 2IYFA 2HO4A 2WJIA 3FPEA 1AN0A 4G65A 4XPZA 4EEZA 1VPDA 4HUJA 2KE5A 2Y92A 4MAFA 3TX6A 4I1UA 5FUMA 2XD9A 1KHHA 3G0DA 3IT1A 3QTLA 3JWIA 1Y5NA 3UTDA 3WGVA 4EG1A 1FDRA 5GMOA 5F33A 2Q62A 4F97A 2O7QA 3PV0A 5EE3A 1OHHD 1CF9A 3W9SA 2FZCA 1X9GA 1B6TA 1NHGA 1P6QA 2PLFA 2RFLA 3TQIA 4IUMA 3PFHA 3SZLA 2BFOA 5CR9A 5IYZB 5ITWA 5J2UF 5BN3B 2AJDA 4N5NA 4LGVA 4MEJA 1Y08A 1SUEA 1ECGA 2OSBA 2ZSAA 4EB0A 3TSAA 3AVPA 3BCUA 3NBXX 3EULA 4ETMA 2Y68A 3O91A 1K1EA 2Y76A 4PPNA 3UK7A 3OOWA 4PYRA 1IE3A 3DOIA 3OPMA 3GJ5A 4G2TA 5G0UA 4XM2A 4RTPA 2GWHA 1PU2A 4LHXA 3ZJVA 3KQLA 4L50A 4ZVNA 1OGJA 4XI9A 1RRVA 2HWUA 3QI7A 4GGPA 1UC4B 4TMKA 1NUUA 2MSKA 2HK6A 4GOOD 3E5NA 3ZH2A 1Q0SA 4WE3A 3QFFA 3ZV4A 4ZEXA 4D97A 3I5XA 1XJCA 1UKZA 5I4KA 5E3JA 5BN4B 1S8FA 1QRAA 3OHSX 2O8CA 4C04A 3OEHA 4FXOA 2G4LA 3L6DA 4BRWA 2QN9A 2FGKA 3DMFA 1LUAA 2TS1A 3NBZC 4IL5A 5JR3A 4FIPA 1TYDE 3I5UA 4W6ZA 1ECJA 1X80B 2ZUTA 4C7KA 3V48A 1KC3A 3C4VA 1O8CA 1B0AA 2GYUA 4UULA 4U1RA 3E8XA 5FORA 3P9CA 1K66A 2Q7DA 2XCIA 4MTLA 3AKDA 3FMOB 2DPYA 3M4NA 1TEZA 2Q5JA 3ON5A 4TS4A 5T64A 1RXWA 2SKEA 2VHEA 3OUUA 1FP4A 1O77A 2HGZA 2PHZA 4OM8A 4YAIA 1RJEA 1VCIA 2PR7A 1XDBA 1VSVA 2BM8A 2RGAA 4IIBA 3ML1A 5EHZA 2C2MA 2IS2A 3T1YB 4HQRA 3BGDA 2O3JA 3OZTA 4HYYA 2HRBA 5DASA 3SS7X 2JF0A 2QRHA 3SKYA 1ULHA 4MR9B 1M83A 2O7VA 3HXKA 3DMGA 3H8SA 2QRMA 3KB1A 1TMKA 1LZLA 2ZWVA 4GP7A 5GM1A 3H2KA 5D7BA 2NTNA 3TJZA 3X0DA 3E9RA 4Q3OA 2X5KO 3MMNA 2NSHA 3T5MA 1VKJA 4OI4A 1SZCA 3VUEA 5LQJA 2MJLA 5KCZA 2R00A 3LV8A 2Q2QA 1QG4A 2HNBA 4G1BA 1XA4A 3D1LA 3HKEB 4B3JA 4DDHA 2IBTA 4LOJA 3ENKA 1EDOA 2C77A 5KNBH 3NX4A 4W5RA 2OD9A 3SICE 4RPJA 4ZMSA 4RSRA 1GZ6A 1J0BA 1L3CA 4LXHA 1RYMA 3TR5A 4KOAA 1QHXA 5JRDS 4S1OA 2I6UA 3KIPA 1XDSA 1XTRA 3CC8A 1YT7A 4XLLA 5IW8A 5TQ2B 5DNCA 1YALA 4G09A 3KJZA 4Q7JB 4LMBA 3I2YX 4E5NA 2PUHA 4BP8A 2OT3B 3QKIA 1Z83A 3A26A 4LAFA 3RJ9A 3W5BA 3IMFA 2O2EA 4JC8A 5D3MA 4PR3A 5ILGA 4ZYUA 5K8UA 1ATIA 3DPSA 1ENZA 1VA4A 4IIJA 1UBNA 4N0DA 3LC0A 2EGUA 1ZH8A 3IPLA 1SCIA 2JA2A 3QVOA 2C4MA 4HDNA 5CA1F 1SXJE 4CDDB 4E94A 1GMYA 2JCYA 4DB4A 3EFOA 5B55A 1KAOA 3FSJX 3V8EA 4E51A 1VSTA 1W6UA 1T5BA 1VOTA 4UAVA 4DQXA 3H05A 4EAAA 4OFWA 2J3DA 4L0QA 4PFSA 1TZMA 1KJ9A 4LSWA 1ZDMA 1Y3IA 5JVDA 1R9NA 1PSZA 3ZDDA 4B81A 2RGNA 4J1TC 4ZD6A 4INPA 1ETHA 2TMYA 3MWYW 4OQFA 4I2NA 4BDTA 1XKXA 5FPYA 2HRQA 2JH8A 2REOA 3OCYA 4N4AA 1GEGA 3NOOA 5EMLA 3GRKA 4RK0A 4AXBA 1GIAA 1IOLA 3ORFA 5E2IA 2YWFA 2IS4A 1Y7PA 3KR0A 5FPWA 2JK0A 1JI0A 4H3SA 2XZTA 1WXQA 3HWX1 3UJ9A 1Z2NX 4A5OA 4D81A 4LK3A 2Q0QA 4UTNA 1X1TA 1X7WB 2OEPA 2RG1A 1N78A 3I8OA 2P78A 4YK7A 4K86A 4A91A 1V41E 4ND8B 3B9BA 4MA5A 2WOOA 3B9QA 4X1YA 5KMGB 4Z3OA 1Z47A 1G7TA 3H3XA 3RS0A 3T3MB 3T3IA 3U7GA 2AKEA 3HCOA 2VNHA 2C7BA 3TAUA 4HN4B 3EVNA 1FYXA 2J5RA 2Q9BA 3WLMA 1XPUA 3PL1A 1M2FA 3ZTYA 1UJCA 3AH8A 2A94A 4B3IA 2MSDB 1NXPA 1MQ9A 3N1UA 2FF7A 3PFCA 3TW8B 1R3UA 1U9ZA 4C2TA 1G9SA 4ZFNA 3L4BA 1GAWA 1OC4A 4EYEA 1HORA 1EFRA 3E2PA 2JLCA 4FUQA 1EF7A 3PHXA 1WZEA 4U7DA 3F0TA 5DTEA 1H0SA 2Q45A 2RHCA 1WQ4A 3NFRA 3V8MA 2QTGA 2QJWA 3GAMA 1A7AA 4LZZA 2ZI6A 4BMZA 2GZRA 4BLVA 2GUGA 1FOEB 3W4JA 1PIPA 4EJ2A 3ZTTA 1TO1E 1WOMA 2C7RA 1MHPA 1D7AA 1CB7A 1PWZA 4O1IA 5GVRA 1KQNA 3WNVA 3ZTWA 5B58C 2ILVA 2OLKA 1OFIA 4RTMA 1DIRA 1SK8A 1OAAA 2PUJA 4Z3DA 3TG2A 3MHTA 2R8EA 2C8LA 3K4QA 3ND8A 3MTDA 3SOZA 1L5VA 2J6HA 3AUTA 2VDUE 3K32A 4RLQA 5JFOA 3IRVA 4UUMA 3OLXA 1I5RA 1DRJA 2BR3A 2K87A 2R85A 1YB1A 4E5MA 1ZGJA 1ZNQO 2V5UA 2PH5A 1XRRA 3AF5A 5DNWA 5FHQA 1MJNA 2R48A 2HQSA 2UZIR 1Z73A 3LECA 1FU8A 4GI5A 4H15A 4L9RA 2ZUCA 4QPNA 3CNOA 3EZXA 4NBRA 1MNQA 2G1JA 4PSKA 2Q2WA 1T43A 1W5EA 1I7QB 2QMOA 2B99A 2SKDA 9ABPA 4NEGA 1UXIA 3MF4A 3BMCB 3LT0A 5CIQA 2ARYA 2BF7A 5AM2A 1CERA 5C37A 1M2KA 1CT9A 3ZOZA 3EXFB 3N8DA 3N4CA 4JITA 5JMTA 1FFHA 3MOSA 1XTZA 1E2QA 1DBIA 3QZUA 3CSDA 2WFLA 1AKTA 2XMGA 4J1QA 3TTVA 4C4YA 1FJGB 3C3PA 1KU0A 4NC9A 1S2GA 2QA5A 2CXUA 3EDYA 5MGBA 2O8DB 2AYOA 4BOPA 1RJDA 2I54A 1K4MA 1E1MA 4BNDA 2G1PA 4S05A 3E5HA 4R1LA 3NDIA 4C0LA 1E2MA 1EHCA 1AKNA 4ZJUA 3NPMA 5L3QA 5BMVA 3GMIA 4BMSA 1RZVA 3AZOA 3CE6A 3EASA 1JKFA 4R01A 3QXGA 4NOKA 4WZAA 5F5NA 2XNDD 3WHKA 3IEIA 3BIJA 1X86B 4KBYA 3AP3A 3T5GA 3UHJA 1G59A 4BJ6A 3QKUA 5DHUA 5BVGA 1VSNA 1HQCA 4LUCA 5FI3A 3MJVA 5EWMB 4PHFA 3A6FA 3MJSA 2FN8A 4Q3EA 4G8CA 3N0VA 4KXNA 5KSPA 3ORRA 4B4OA 5B1EA 5AW6A 1RQGA 4LPSA 3QVWA 5JXGA 2WDZA 3FOWA 5ED0A 5JFTA 5JPCA 1DJMA 2WDPA 4DA7A 1G8KA 1M5RA 3FRJA 3MAAC 5FT9A 2ZAMA 1J21A 4WN9B 4YRCA 4ODIA 3RV4A 5CFPA 5K3OA 4I55B 2IY7A 4Z7OB 1WSBA 4KTVE 2JC3A 2W8BB 4TV8B 4LDJA 4G9BA 4EX6A 1JDBC 3TDNA 2VQFB 4BVGA 4OJYA 3P9SA 5CT4A 4AG3A 1U2TA 4LN1A 1KDPA 1XJ5A 4IGAA 1CUAA 2CMFA 3IS3A 5AMXA 1B14A 1NLFA 1GAXA 1QV9A 2YHSA 2Z6QA 4BXOB 3ADCA 3B6ZA 1M2NA 3RVJA 2FAXA 2VPQA 3MJCA 3NZEA 4JX8A 2G0NA 2ZJ2A 3EIUA 5E4JA 4EMBA 1AECA 1E1NA 2I4RA 5EHNA 3BT7A 2MINA 4URFA 3NT2A 2OV6A 2WWRA 4LSZA 3WYAA 1Z7WA 2C9MA 4ZU1X 3TZ6A 1F6DA 4JBHA 4U6NA 3TOXA 3BZWA 2WVJA 4IG4A 5ESXA 1RYZA 1YE5A 4YJDA 3P9ZA 2A9PA 1XK7A 1DXQA 2RBKA 1VP3A 1BO6A 4OHPA 1JEDA 1Q77A 1SK9A 5AKKA 3ZQUA 5AK4A 5IP5A 5KB3A 4IEIA 1KR2A 4XARA 3WB9A 4DBLC 3HYLA 3NASA 4O25A 3LXSA 1FS6A 5A7FA 1AM4D 4M1WA 2XUAA 1FQKA 5EGNA 1EVQA 5ILQA 3TI9A 4CKWB 5JC1A 2E7ZA 3RHZA 1J97A 1U1IA 3E3AA 3ETGA 2AHRA 4IGFA 1IY0A 4UU1A 4BZXA 2CT8A 4YRNA 1ADBA 4WUTA 2OFPA 3ZWCA 3I72A 2XUIA 4X61A 1PDVA 3IAUA 4OOEA 1E79A 3QBJA 4FEYA 4KXMA 3U2QA 1E59A 5HUQA 1ZIOA 2H1IA 4MRRA 5C5CA 1AYUA 1I1NA 3R8XA 4DLTA 2XB9A 2GJKA 2GS9A 1Q1NA 2WYIA 4CCWA 4EUHA 1M6EX 3A36A 3FB4A 3GW8A 4L9SA 2FPKA 3JWEA 4G07A 1QIMA 2GCIA 4PGFA 2BZSA 4AAYA 1MC5A 1U5AA 4DG5A 4GT1A 3FF1A 5AXDA 1AA6A 3UPTA 1PV1A 2V97A 1M8KA 3HJBA 2NNWB 3INGA 4KNVA 4RTLA 4FQ5A 3I52A 1E69A 3EFBA 4JYBA 4PR0A 1XF1A 2X76A 4D25A 4YYWA 3BGIA 1FVFA 1MVLA 3WLSA 3ICWA 4DLPA 1VKNA 3KCQA 3AMVA 2E00A 3SFVA 1PGQA 5ECGC 3DYVA 4L6AA 3A0UA 1EUCA 1QG2A 2F64A 2WWWA 2XA9A 1OKKD 5AW9A 3T9BA 1D2CA 5E6SB 3UCXA 2JG3A 5K8IA 4UUBA 4YP7A 3FUCA 2PA0A 1D0SA 4HQLA 4O4IB 1GSOA 2FEKA 3CF4A 3RU7A 1EWQA 2C7PA 3DD5A 5LA6A 4F12A 1CVZA 5IN4A 1V25A 2R97A 1J0XO 2WHPB 2Q7OE 1I2DA 4EI7A 1LPSA 4YP6A 2C97A 2JZOA 3A9VA 2OYRA 3NG1A 4N9WA 2CNWA 4R8KA 1IAQA 3OPYA 4MDYA 5LOVF 3EGEA 3B6JA 4ZAZA 2DM6A 3HGMA 1E1CB 5K09A 2ET6A 1PHPA 1JJBA 1LPAB 1ONNA 1UKEA 4H6PA 4HL6A 2OKGA 2WJHA 2WWGA 4RDHA 3ZBQA 4D6YA 5KQGA 3UV7A 3M6LA 1NW7A 2IEIA 2OZLB 2PT5A 3ZE0B 5E6JA 2HNAA 4PG6A 3OLYA 2ETXA 5A5EA 4O2AF 2PIAA 2J07A 5F5XA 3Q3VA 4RIGA 3KYIB 1L7VC 4HNGA 4IXMA 3U31A 3OX2A 5EKSA 5GV8A 2H1HA 4FOOA 1N5LA 3TXAA 1YMVA 5C7LO 1W2GA 4JVOA 1EEXB 1DMSA 2M6RA 1QHGA 4Y6SA 5BR1A 1KEEB 4YO7A 4CQNA 3UBMA 1IM8A 3ESYA 2VTEA 3W8DA 1ZGBA 4AZWA 4EJFA 5K0TA 4TZ0A 3GLHB 1X7ZA 5U9CA 2C7OA 2QL6A 2EQBA 2FZWA 2W6IA 4QA9A 1AU2A 3RQIA 4I99A 2GFOA 1KKMA 3HEAA 4EB6A 2VOEA 4MV9A 4QELA 4W1PA 1G8GA 2FFRA 4ECAA 2CJWB 3KUUA 3GGCA 3AFIA 1AUXA 2G70A 3VRHA 1XRQA 1Q1EA 1H4TA 4D43A 2Z56A 1RPNA 1JEEA 4HYQA 2BFPA 5FFNA 1GTSA 3R7SA 1NW8A 1SBHA 2ZIXB 4W9NC 3KUKA 1NLMA 3OIUA 3LP6A 3O5AA 5EJ9A 1A8SA 3OVMA 3VU9B 4W8OA 4YJHA 1JKIA 3RSOA 4GR5A 3UAYA 4V0KA 4BN5A 2Y3IA 5CPBA 1IUKA 2XYVA 4EHJA 1RXIA 3R7WA 4JXZA 1EK2A 1GGEA 2CUZA 1VYUA 3B20A 3G9UA 5T8KC 3HG7A 1IUNA 3I01A 2OP1A 4QTZA 2O2JA 3W5VA 4M87A 1HTWA 1XD2A 2WTNA 4J8PA 4UNIA 2YOGA 4WK6A 3STUA 3VR4H 4DC1A 2XIJA 3H7AA 2AFVA 2CKMA 3E9MA 2E21A 1TLOA 3KTFA 4UVGA 3ZJTA 3L0DA 4KRFA 1T24A 4I5GA 3LW8A 4GMXA 4S1VA 4AJIA 3OMWA 5FEUA 4JI8B 2DBZA 5SZHB 3WFIA 4MWGA 1Q7EA 2RH4A 3GV0A 4IJVA 2LBPA 3LPLA 4TQAA 3A2KA 1XDUA 1R0ZA 2AS0A 1MQ8B 2ZVPX 1UJ2A 4OAOA 1SY7A 2FSHA 2PA3A 4LBYA 3V1KA 2YR0A 4AKEA 2VI5A 2OQRA 5AKXA 2PZMA 2WLSA 3RUHA 1ZN8A 4LZWA 4H1HA 3F7TA 2WICA 1ADGA 3CNHA 4IJKA 2IUEA 1WR8A 1XBTA 2N75A 2XECA 3FZYA 3IAS6 1BG6A 4DCSA 4MW2A 3ZUAA 4NE7A 3U7IA 3RFFA 2BPOA 1MAAA 2W6JD 1LBTA 1AURA 2ID9A 2ONZA 3LPMA 3D5EA 3QNUA 2Y8EA 4HRVA 4BE4A 1RJWA 5BSRA 4I05A 2VJPA 1NUHA 1WTAA 2PMCA 4ZT5A 4OVZA 3VZBA 4YYSA 1FSSA 3AI1A 1KQGA 2VYVA 2MDTA 1C7QA 3EXEB 1IXZA 1KVSA 1P7PA 2J45A 2F9MA 4FNMA 3PGXA 4H7PA 4LRWA 4EPVA 1HTTA 1L7XA 3SE7A 1H8ED 2OBXA 2F1KA 5KNBD 3UW3A 2Z3WA 5HVNA 2XB4A 3N2KA 4KZKA 4YMIA 3W7BA 4KHPB 3MYRA 4AG6A 2AOTB 1ZH4A 2K4MA 3HDQA 4R54A 4IILA 1HX7A 1DQSA 1XPJA 1ONPA 3WMRA 5C7YA 4B3TB 1K7EB 3WNDA 3JZIA 3SIWA 4YUWA 4ZOQI 4UHEA 4WXMA 3UWSA 1JIVA 1TUGA 2QLFA 4G0MA 4JYCA 3WJ2A 4MS1B 1WD5A 3G9TA 3OQJA 2HJHA 1HZZC 4D4GA 2XXJA 1KO1A 5E9AA 3PE4A 2D54A 2Z5VA 5FH9A 1ZMTA 4K6MA 4DE5A 4PADA 4FLFA 1LDNA 4QOHA 2XCSB 1Y7TA 2H5IA 1DVRA 3B5JA 2VNSA 4UHKA 5JQGB 4BS6A 1RE0A 4H0FA 4MI1A 4E5KA 1JWBB 4YUYA 2O7RA 1EI9A 4U2KA 4H7JA 5J5VA 2AEFA 4BBPA 4YDQA 3ANYB 3DZDA 2IP4A 2BL4A 4PBSA 1P2GA 3OKPA 3TI7A 1E8DA 3F6BX 3SEFA 3AF4A 3ZNOA 5CFNA 5F7XA 1CY1A 1B7GO 3W2HA 1H0RA 4RVUA 4H3KB 2GEKA 1X8JA 3O9VA 3PHIA 3RVKA 1KYIA 2BGIA 5HF5A 3RSGA 4Y67A 3BVPA 3O84A 2GM5A 2G5PA 4DLUA 4WKGA 5DN6A 2M6LA 1YQUA 2IF0A 4REZA 2X2FA 3IEJA 2ZIVB 5DISB 5JNVA 4E11A 5MHTA 4WOJA 2FWPA 3ZCPA 2DCCA 2AFHE 3AIIA 1GRCA 1TKRA 3DOJA 2D1QA 4GZLA 2RDMA 3I3SR 1UMCA 3N8NA 1FNBA 4AJOA 3AYZB 1DXOA 3U5TA 2BGTA 3NDJA 2JLYA 2OECA 4W5JA 3JPYA 1EP1B 1NSTA 4BJ1A 2EJWA 2PR2A 2PRZA 3BF8A 4MROA 2IY9A 1RPTA 3E23A 4B3BA 4PBTA 4X6HA 1TJYA 2F8SA 4MQ6A 1EQAA 4JUBA 4M1SA 1T9KA 3MAJA 1YAHA 1GPYA 1OILA 4IWNA 1JDJA 2OCIA 3BJZA 1Z2EA 1AZLA 3CZRA 3N86A 2DWUA 4GI7A 1LNQA 1YDFA 4YMVA 2ATXA 2G80A 1IDN1 3Q7PA 3A9RA 1MJHA 4AF8A 5NULA 2ZYAA 3F6EX 3O1IC 1MO4A 4KODA 4MMZB 3ADKA 4PSDA 2XXAA 4F4IA 1OZGA 1LLDA 4CKZA 3D8TA 1HE8B 3BBPA 3L8CA 4RVGA 5JAUA 1CYEA 4YI3A 2HPZA 5LU8A 4ZHQB 1C4KA 5EYPA 2ZTVA 2JAQA 4KMOA 3FDJA 3SXUB 4LRTB 2GCNA 2FE4A 4B3FX 1HNZB 2P9CA 3O8LA 3ZG6A 1ZGHA 1MZVA 2B20A 2ZWIA 3K9MA 1PSDA 1GU7A 2OILA 3P52A 3BE4A 5CK5A 1OLUB 3OEEA 1Q57A 4LMAA 4YC7A 3LJKA 3IURA 4IICA 4ND6A 3EK2A 1KE1A 4BTEA 1USUA 5KU1A 3AUFA 2ID4A 3O7WA 4QRIA 3IOQA 4ZOBA 5E3HA 5BOVA 2JI6A 4QLAA 3L0PA 1C9YA 1L1FA 3J81A 1A9QA 2TECE 5EAIA 2K7FA 3OEYA 3FHLA 1QR6A 2ATIA 3JSAA 1BCSB 4P82A 4TV9B 1W35A 3Q7QA 3L9WA 2DKFA 3IGFA 3IBSA 2IGTA 1A2QA 3KQKA 3D3JA 3HHEA 2EX1A 3M5CA 3WWCA 2WIFA 4HR7A 3I4CA 1YZ3A 2PTHA 4ZOLF 4KVGA 721PA 3GT4A 4F3RA 2Q8QA 1CZKA 3BE5A 2IEZA 2XNSA 1SHLA 1USIA 2FUNB 1VIVA 4GYWA 1YDGA 2EATA 4XJXA 4E32A 5HILA 5H7XA 4MUGA 3IBYA 1QXPA 4XYEA 4QBIA 1G6KA 4LC1A 3WLJA 3V4LA 1JSLA 4KJZA 2VJYA 1I01A 1VE1A 4EX7A 4DCOA 1CRWG 1F2TB 1UDRA 4HGYA 5CHTA 3GRPA 3LL4A 4RMGA 5LN1A 2OBLA 1U6KA 2OD2A 2QD1A 3LDAA 3Q9NA 4ZHSA 5AUPB 3JZFA 2X9QA 3Q5EA 1DC8A 1CR0A 4ZOAA 3PHGA 5JWHA 3BIOA 2F48A 3LGAA 2BJHA 1EA5A 1UOOA 1HYEA 5TT0A 4L15A 5FL3A 2YVQA 3T35A 3LP8A 5HGJA 2HJSA 1GN8A 4MVWA 5ALSA 5KTTA 1H4SA 2HKIA 1ICIA 3HUUA 4D98A 3WLKX 4ZKDA 4J6EA 4JP1A 4R1MA 2VSYA 2FXIA 1DSSG 3E9EA 3L6UA 3NTXA 5FO1A 1IUOA 4PAMA 5IZ4A 4MDHA 3MC1A 5AM4A 1NR7A 4BBAA 2X8AA 1ZICA 1NKVA 4ZT7A 1NF3A 2D5BA 1HG1A 1MVOA 1Q92A 2KI5A 3V1UA 4C08A 2B0CA 2OXIA 1ZW6A 1AQ6A 1PV2A 2E1PA 4MR7A 5F77A 2CHUA 2XTAA 2ZUSA 3CUUA 3UJPA 1T8YA 4BLUA 3PC4A 4EKEA 1TUBB 1ZCAA 4PBRA 1DUVG 2Z3ZA 3RLIA 3HSSA 4LGMA 1EJ0A 3B8HA 3BCRA 3L7MA 2NU8B 1QH9A 4Z4EA 3PB3A 2R5WA 3F3SA 3TQHA 4L3VA 3HK2A 3VMMA 5BVHA 2A0XA 1E20A 1YAJA 3D3NA 3GLFB 2HJWA 1SC9A 1EE1A 2GD0A 1I4TD 3OUZA 3NETA 5KDDA 2F67A 5DDIP 6REQA 3FSRA 1VE7A 1YE3A 3NT4A 2H1WA 4RNCA 2I80A 3RVBA 1AZWA 2BN4A 1EQUA 2L42A 3AEKA 4NONA 1D8AA 2BJVA 1KBZA 2HHCA 4RXMA 4F85A 1XTVA 3BB3A 4PHCA 1XQWA 4JSRA 4PLFA 5T5QA 2ZZKA 4EG3A 4DR6B 4E5UA 4FYVA 4HFRA 5TC4A 1OLSA 3PX7A 1V5GA 2FWIA 3ZE1B 3HR7A 4J0HA 4QZVA 8ABPA 3MUOA 4GLBA 2WSYB 2FEWB 2QPLA 3QNMA 4R1SA 3LT5A 1VLLA 5COAA 4XWKA 1ZHHA 3RU2A 4YRKA 3MCVA 4B0PA 1V9LA 1X92A 4K6KA 3DZFA 1AQYA 3C5EA 4Q7KA 3RRYA 4E1AA 4DR7B 1SUBA 2ATEA 1FH0A 3FPJA 3GDOA 4IW3B 1CQDA 4F38A 3JQPA 1WHSA 3N2LA 3DE1X 3NOQA 4JOQA 1P1CA 1PVJA 1AS2A 2HC9A 3ZLTA 1BQIA 5HW0A 4UD6A 1NBME 4EA6A 1Q12A 4LDPA 3R3XA 4NG4A 3MWDB 3IUBA 4FUTA 1UBEA 3T52A 3U19A 3EGXB 3MJRA 2CUTA 3O4IA 4KPYA 3IVRA 2C5BA 1PJ8A 1Y6RA 1Y5RA 3CX4A 1P62B 1E5LA 2C5HA 3QEBZ 4U7FA 5E4TA 4RACA 3RYFA 2XEXA 2VDRB 5TEVA 5ICCA 2L69A 3OFNA 5LMCA 1AJEA 3VC1A 1ZH6A 5DSZA 2PT6A 2NXEA 4DUGA 5JO0A 5D87A 2X2EA 1TTQB 3WRXC 4FOPA 4X95A 2O52A 4OYYA 4C14A 4N48A 3K9BA 2PH3A 1EGHA 5BN5B 2B6HA 3X1DA 1G19A 1B76A 3D4OA 4R1NA 4QLBA 2BDTA 2NZ8A 4YASA 3R8CA 3W8RA 1JEQA 2G9VA 3R74A 1DGQA 1KXJA 4FYHA 4PZAA 3GRVA 3JASA 3ZI7A 2JA1A 1Z63A 2FMHA 4XB6B 5ALVA 1YULA 1BJKA 2YJ6A 3GI1A 3KKEA 4MCAA 3V55A 1S5PA 2GCOA 1SKUA 3ZK8A 3ZDCA 3JW8A 1KQPA 1U9VA 3JARA 3BMXA 4BNUA 3FAKA 2BTWA 3HFGA 1KA9H 1O89A 4IEEA 1X42A 1DHTA 1GR0A 4A0FA 3NM5A 2BEUB 2H5JA 1EZ4A 1CQJB 2DYKA 3FDXA 5IT0A 4I55F 5JYDA 5KTKA 2VBCA 3CCBA 3I4FA 1DJPA 1E9VA 1P8JA 3UYKA 1UBMS 5ARCA 1DRVA 4IQGA 2ECKA 2BJWA 3OG9A 4KMMA 4WOBA 3MSXA 4E4TA 1IHDA 4KKXB 1RP1A 4OHOA 2HWWA 2GI4A 1OXTA 3R77A 1PD0A 3T06B 4W5NA 1RRPA 2HGSA 1P19A 3FA2A 1WS6A 1Z39A 4BN0A 5TX7A 2YFKA 3O8DA 2OP3A 2Q5IA 2ZYHA 5LZ8A 1R3DA 3VO8A 4I07A 3IQXA 3U4MA 5E2AA 3KQQA 5K8LA 1L1EA 3RC3A 3L7IA 3QX7A 4Y6RA 2ZI7A 5JC8A 1M0EA 4UAJA 3LMKA 2ZXFA 4CUZA 3KLNA 2P11A 5FKJA 3W3ZB 1YNSA 2I3BA 4OHXA 3ZVMA 3AHCA 4LJ9A 5KYYA 2VSOA 3GRRA 1CS0A 3K73O 3JWJA 1ZG3A 4O4JB 5E0KB 2D8MA 5TJ9A 4BPRA 4ZI7B 4JLDA 3VNQA 4DKXA 3IB6A 2I9PA 2L2QA 1S7CA 3I9V1 1E18A 4OUKX 3ZIUA 5IHPA 1U0JA 3DLTA 4HNAB 2NO6A 4TXMA 2ZRCA 5FAXA 5FQNA 2RIRA 5T8KA 4BFSA 1LWNA 4NMMA 2O23A 4CMHA 5CFZA 5KWEA 3ZDYB 3TLEA 2IGBA 4A16A 5CG2A 3ADDA 5DZSA 4D5EA 3KZNA 2ZQ5A 1M1YB 1AKRA 1ZJ5A 1DC5A 5C81A 2DC8A 1X3LA 4RGBA 2QUAA 3P9IA 4KNYA 2Y71A 4LV8B 1LBEA 3I28A 5HKOA 1HEUA 1PGJA 3KSEA 1N2SA 2WF9A 3H87A 4TKZA 4YFYA 1P61B 2VT2A 2XGGA 4X94A 2WIDA 2IZOA 3T3EA 3TF5A 1IY2A 1B0PA 2HLPA 3L9XA 4FBLA 2H1OA 4J0JA 3ZH9B 2LTAA 4L16A 4ZZ3A 2X2OA 3F2VA 4Y6GB 3PFKA 4RIHA 1OXXK 3A28A 3QOWA 4WXHA 2NXCA 5CIWA 5DIZA 1SUCA 1ZHOA 4L74A 5DYNA 3ODGA 5AM1A 1JRLA 3EF3A 2P40A 3ICOA 3WAJA 1BKDR 4PZ9A 4XXHA 5JWOA 1QF9A 3DNMA 4NE2A 4N76A 2ECFA 2VXYA 3HXQA 1UXOA 1O03A 2DHEA 4B7UA 5K20A 2UVPA 5AO9A 4XFKA 3O7MA 5CEFA 1X70A 1WL8A 4M0UA 1OJLA 4QYXA 4RF4A 3AVTA 2ODTX 3WI7A 3QE9Y 1LDBA 3EXIB 2ZBGA 1OGYA 1IK4A 3SX2A 4OMCA 2FUEA 1SKYB 1CUFA 2IEDA 4QPCA 1CNMA 1H1DA 1X0XA 4M36A 3O21A 2C96A 2BGGA 4MJ3A 1PPNA 1NONA 2AOUB 3AR8A 3R3HA 4FK8A 2DHRA 4QIHA 5E2BA 1FW6A 1EIWA 4O4IF 4PSUA 3U16A 4BO7A 1CPJA 4TKUB 5KVSA 2NIPA 1ZIYA 4D3DA 3ROKA 3RVQA 5JE8A 4YV2A 2C2ZA 3AIMA 4A8TA 1C5KA 1X8LA 4KI0A 3IIEA 4OCZA 1Z4OA 2ZJ8A 2X8JA 1POWA 1K6EA 1UIMA 1TKBA 1N2CA 2HF8A 5DX1A 1QHHB 1TPYA 1ZCBA 3BXEA 5DWVA 1II8B 1NQXA 2G9UA 2VRWA 4M7RA 1HXHA 2VP9A 1IBMB 1L8AA 5LYYA 1OPXA 1T2CA 1LW6E 4Q3AA 5EXPA 4BX2A 5FBVB 2QUBA 3G88A 1VSBA 4ZVKA 5LP1A 5I7WA 1JG3A 3U4QA 5FNVB 2J3LA 1E9AA 2C1XA 4JH0A 3S2FA 1Z82A 4FE4A 4YROA 2NTJA 2Q3LA 4QJIA 3RS9A 2Z2IA 1S2DA 4BQQA 1H2BA 1VI6A 3CUVA 3F3KA 4OEHA 2RHMA 1U8EA 3CVYA 4B31A 3WL7A 4ZQBA 4WJLA 2J9ZB 1ISHA 1LJUA 3DPUA 3KSDO 2EDCA 3FCCA 3TBFA 4CTKA 4DBZA 1XEFA 3LQQA 4TMYA 1XKGA 2V9PA 3G0CA 2ZIAA 2YXPX 3ET5A 3ONEA 1XRLA 3OU6A 4TMFA 1YS2X 4NX2A 4ZQHA 1IN1A 4HAXA 3QEMB 3FYTA 1Z2CA 4RIIA 1F3LA 2JBAA 4QATA 5IMSA 4HDOB 1MRSA 1KQOA 4HWOA 2VXBA 2BTQA 5DCYA 2OCPA 1B15A 4TTPA 1QM5A 3DB2A 1F2CA 3OX4A 1F12A 2YTZA 2P86A 5KC9A 2VCYA 3BL8A