4ZTBA

Crystal structure of nsp2 protease from chikungunya virus in p212121 space group at 2.59 a (4molecules/asu).
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
321
structure length
321
Chain Sequence
FQNKANVCWAKSLVPILETAGIKLNDRQWSQIIQAFKEDKAYSPEVALNEICTRMYGVDLDSGLFSKPLVSVYYADNHWDNRPGGKMFGFNPEAASILERKYPFTKGKWNINKQICVTTRRIEDFNPTTNIIPANRRLPHSLVAEHRPVKGERMEWLVNKINGHHVLLVSGYNLALPTKRVTWVAPLGVRGADYTYNLELGLPATLGRYDLVVINIHTPFRIHHYQQCVDHAMKLQMLGGDSLRLLKPGGSLLIRAYGYADRTSERVICVLGRKFRSSRALKPPCVTSNTEMFFLFSNFDNGRRNFTTHVMNNQLNAAFVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of nsP2 protease from Chikungunya virus in P212121 space group at 2.59 A (4molecules/ASU).
rcsb
source organism Chikungunya virus
molecule tags Hydrolase
molecule keywords Protease nsP2
total genus 88
structure length 321
sequence length 321
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4ztbA02
3.90.70.110 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4ztbA01
1VP9A 2P1DA 5EQJB 3I5UA 5DRTA 1HNNA 5DPMA 1EIZA 1RI5A 2OYRA 4YMGA 3NDIA 5F2NA 2ZBRA 3KQSA 5HOQA 5KYGA 1M0EA 1NKVA 1G38A 4MTLA 5HIIA 2XYVA 3T7SA 3DUWA 1N7IA 4DMGA 2ZZNA 2Z6UA 3DMHA 4QVKA 4AZTA 3EVFA 1XCLA 5K0GA 2AOUB 1X1CA 4R6WA 2PT6A 4DA4A 4KVZA 5CUQA 4AZVA 3G8BA 3E23A 4PYJA 4E70A 4AZSA 3S68A 1PRYA 4M36A 3OU2A 1KPHA 2O07A 3HTXA 4MQ4A 5DM2A 4PCAA 4LECA 3NTVA 3OE5A 1G6Q1 2EFJA 3P2EA 3UZUA 3A25A 4A6EA 5BW5A 3FRIA 5G02A 3M6WA 3CKKA 3DOUA 1N2XA 2H00A 3G2MA 2G71A 1YFJA 4E32A 4YV0A 2I9KA 3KQOA 2OB1A 3U81A 2R3SA 4KDRA 5EHIA 3JWGA 3LKZA 3I9FA 3PT9A 5BXYA 2XBMA 4RTSA 1JQDA 4RVFA 3FPEA 3NVKI 5DSTA 1F38A 4PGHA 4E2WA 1DL5A 4RTJA 4L7VA 2E5WA 5DX1A 1TW3A 4V0RA 3PX3A 5DX0A 5FHRA 1FP2A 4RVHA 2PJDA 5EG5A 3PVCA 5FTWA 3TPZA 3TM4A 5H02A 2QRVB 3A7EA 5HIKA 3KQQA 1G55A 2HWKA 2I6GA 3UJ8A 5E2BA 3V8VA 3TR6A 1KXZA 1QAQA 3TOSA 2CL5A 2H11A 1JG4A 3FTDA 3KQTA 4YUZA 2AN5A 2P3LA 3R6TA 4WVLA 5DWQA 1IXKA 3B5IA 3M33A 4RX1A 1ORIA 3KHKA 3KQPA 3R0QA 4KRGA 3VSEA 5EKXA 5MHTA 3DXZA 3FPFA 3I58A 3G5LA 5CVDA 3SM3A 2UYHA 4BY9E 3GO4A 4O29A 1NW3A 3CBGA 2IDKA 2PY6A 1ZGJA 1RI1A 3C6KA 4JXJA 3P9KA 3NJRA 1IY9A 1WS6A 4U7TB 1JSXA 3MHTA 1EG2A 2PBFA 5K05A 1FJXA 1EAMA 4PYOA 3MERA 4HG2A 5D1NA 3T7RA 5K8VA 5E9JA 2ZZMA 4CTKA 5KVAA 2NYUA 3OE4A 2VZ9A 3DLIA 1KPGA 3OU6A 1M6EX 3G2QA 3HCBA 4EVIA 1WY7A 3BWMA 3R9XB 4PWYA 3CJRA 1AF7A 1SQFA 2JHPA 2VP3A 2YXEA 2UYOA 3FYDA 3LDFA 3UFBA 4UOEA 2G70A 3UJ7A 4FR0A 1TW2A 1I9GA 1G8SA 1RI4A 1PJZA 1VL5A 2BM9A 1QANA 2P8JA 2HV9A 2YX1A 3I53A 1D2GA 3NW9A 4HRAA 3GRUA 4RYLA 4CKBA 5HIMA 2JHAA 2NNWB 3OZRA 3E8SA 4GOOD 5DM0A 1RJGA 3MTIA 2IH5A 1U2ZA 1NW6A 3KQMA 3EVEA 2PLWA 1NBIA 2ZFUA 5ICFA 4FGZA 4GBED 1VLMA 4FSXA 5EZSA 4C06A 4GOMD 5P8WA 5K0FA 5F2KA 1UFKA 1ZHFA 3G88A 1SUIA 2WK1A 3C3PA 1L3BA 3DXYA 3P2IA 4DZRA 3UBTA 3E05A 4LWPA 4FZVA 5FCDA 2IIPA 2HR1A 3TKAA 3QOXA 3BT7A 3TM5A 3GNLA 2R6ZA 4PONA 3TRKA 3KQYA 3M6XA 1I1NA 2JG3A 3REOA 3OFKA 5GP1A 1JQ3A 2PXCA 5CVVA 1P39A 4HC4A 1QAMA 4RWZA 2O57A 3ER8A 3ERCA 3GIWA 1P1BA 2BM8A 4P58A 3FUXA 2NXJA 4PYMA 4PYIA 1F3LA 5E1OA 5BP7A 5FQNA 1KHHA 2PX8A 2OXTA 2IDJA 1M6YA 4R6XA 5BW4A 2YQZA 3IEIA 2ORED 4C04A 4DCMA 4QTUB 4HH4A 2OPBA 4PIPA 1VQ1A 4QQKA 3EPPA 5CIYA 4BLUA 4HGZA 5GM1A 2PSSA 2BR5A 4ER3A 1X1BA 3FUVA 1WZNA 2ZTHA 4QDJA 3AJDA 5KQSA 2GH1A 2P3QA 4LWOA 2ZW9A 4OA8A 3DR5A 5DX8A 4ZTBA 5DM4A 4Z2YA 3GRRA 1KYZA 2AOTA 3HA7A 1R6AA 2ONZA 3P9NA 4X63A 5FWDA 5LQCA 5GIOE 1L1EA 2FK7A 2JH9A 2OB2A 3DXXA 4X1OA 4K6MA 3GCZA 4MWZA 2ZBQA 3UJCA 2AOXA 3LSTA 2PXXA 1BC5A 4DCGA 4EQZA 1X1DA 4FT2A 4B17A 2CMGA 1SVUA 5EOVA 4C03A 1DUSA 4F86A 5LSAA 2AOVA 4IV8A 1YF3A 2HNKA 3FPGA 2V74B 4BP3A 3LDGA 1L3CA 1Y8CA 3UJ6A 2B3TA 1G8AA 3LPMA 3TQSA 3CCFA 5K0LA 1MJFA 3FTCA 1BHJA 5K03A 4IV0A 3GRVA 3DTNA 4DF3A 4PYNA 3A7DA 4QQNA 4CWAA 3JWJA 5C9ZA 4RTKA 3M6VA 3OPNA 3GWZA 3BGDA 2IP2A 4QDKA 2Y1XA 2GA9A 5HZMA 3LGAA 3LCUA 3OFJA 2EJUA 2XVAA 1FP1D 2PGXA 1WG8A 5EPEA 3NMUF 4RVGA 3EVGA 3HA5A 2QRVA 2GLUA 4PGGA 4E31A 5ERGB 1ZG3A 5K0JA 3FRHA 3HCEA 3EVDA 1D2CA 3CJQA 5FADA 3EMDA 2AOTB 1VPTA 1KIAA 1P91A 1XXLA 5EMMA 3LDUA 3NVMB 1EJ0A 1H1DA 1VE3A 1YZHA 2IH4A 3LKDA 2QM3A 4GC9A 1B42A 4FS8A 4OBXA 3KPVA 2UZ4A 5EHGA 4RTNA 1L3IA 1SKMA 3HCFA 5EEHA 2PT9A 5K01A 4RTOA 5ICCA 1O9GA 3KQVA 4OQEA 4RSRA 3GRYA 4BLVA 3KPWA 2P7HA 3RODA 1EJ6A 1R18A 2FPOA 3FUWA 3M6UA 2VS1A 1JR4A 4IWNA 2BR3A 3SX0A 1NBHA 1RI2A 2JHCA 1HMYA 3A4TA 4QPPA 2H1RA 2QY6A 2V7EA 4X61A 4POOA 4KDCA 5LQRA 2WA1A 4PIMA 1SQGA 3GJYA 1JSZA 1UIRA 2ZULA 2UYCA 3HVIA 5E1BA 4RVDA 5FQOA 3THRA 5DM1A 3Q87B 1SG9A 3A27A 5U4XA 2NXCA 3QOWA 1N7JA 1R74A 2JH8A 4CTJA 3PS9A 4YUYA 3ELYA 3EVCA 4P7KA 3P9IA 3O7WA 4H0NA 4ER5A 3UJ9A 4RTQA 3UJBA 4GEKA 3ELWA 2FCAA 5E9QA 5HILA 2ZLBA 5K0CA 2ZWAA 4C08A 3PTAA 5E1DA 4YUXA 5EIWA 4OX9Y 2P40A 4P7JA 5CVUA 3KR9A 3PX2A 2PWYA 2ZBPA 3FUTA 5EGSA 4QTTB 4ER0A 3BXOA 4XCXA 1O54A 2YUIA 3HCDA 2CMHA 2NP7A 3FUUA 4PCLA 5EEGA 5DXAA 3AWIA 1XDSA 3ID6C 5EMJA 5EVJA 2ERCA 3MCTA 4HTFB 4DKJA 1TPYA 2PX5A 5CVJA 2AN4A 3F4KA 5T64A 5LR6A 3HVKA 5FWAA 1JG1A 2GB4A 5HFJA 3LHDA 4C07A 5LQNA 3G2PA 2P3OA 2VDVE 3GDHA 4PYQA 1Q0SA 2PX2A 1JTFA 3QV2A 2IBTA 2UYQA 3DULA 3FPHA 3HVHA 3ELDA 2ADMA 5C1IA 3OZSA 3P71T 2AZTA 1VIDA 3B3JA 3C0KA 3DP7A 4RTPA 1FBNA 4Y2HA 1MHTA 1P1CA 3MGGA 5GIPE 4MHTA 1JG2A 3G7UA 1KP9A 3CJTA 3SGLA 5JR3A 4AUKA 3CGGA 2P41A 2P7IA 5E8JA 5ICEA 3SXJA 1WXWA 4DM3A 2HTEA 3HNRA 2G1PA 3B3GA 5M5BA 3BWCA 2PKWA 2OY0A 3P9CA 2AVNA 4V0QA 3PLAE 4FP9A 4MIKA 5HIJA 4XUDA 1D2HA 4G56A 3D2LA 1V39A 2P35A 4YV1A 4YV2A 3I64A 1RJFA 4C05A 4E30A 3PFGA 3SSNA 2CWWA 8MHTA 3MQ2A 2C7RA 2EJTA 3SVZA 1ORHA 3G5TA 5LQAA 4GF5A 5E8RA 2BR4A 3MCZA 5DTMA 3L8DA 2Q41A 2GPYA 1XDZA 5FULA 1AQJA 3BWBA 1ZGAA 5GM2A 4YUWA 3T0IA 2ONYA 3M4XA 3EEYA 3BKXA 3LECA 3HCCA 3HP7A 2Z6QA 1NW8A 3MAGA 3TMAA 1O9HA 2IGTA 4X41A 1QYRA 4M7RA 3BWYA 1R8YA 3R24A 1ZQ9A 2FRXA 4KW7A 5DSXA 4YUVA 3DH0A 4ER6A 1KYWA 1G60A 2F8LA 4E2ZA 3O4FA 2C7OA 3DMGA 1WXXA 4ER7A 2B78A 5FA8A 4Y30A 5GOZA 5GINE 2IFTA 2QE6A 3ELUA 4ISCA 3KR2A 5E2AA 2PVCA 3UA3A 3AXTA 3X0DA 4BLWA 2PWPA 2FYTA 3CC8A 5DTRA 3B7PA 5F2OA 4DQ0A 5FHQA 2YXLA 3SMQA 1I4WA 2BZGA 4KIFA 3KR0A 4RTLA 3EEOA 2AN3A 4EKIA 1SUSA 3MB5A 4OBWA 4GOLD 2OZVA 3Q7EA 4R8SA 1NW7A 3EVZA 2PV0A 3KKZA 1UWVA 4YMHA 1KPIA 1YFLA 3DMFA 4KIGA 5DXJA 3UJDA 4XUCA 4RTMA 2ZSUA 2GAFA 4R05A 3KU1A 3UJAA 4OA5A 1X1AA 4CKEA 5T6BA 1YUBA 2ZIFA 5EC8A 3P2KA 1XCJA 4E33A 2NXNA 3BGVA 4PINA 2GS9A 5KQRA 3HCAA 7MHTA 2AR0A 2EG5A 3LBFA 3VYWA 5DRYA 4HTFA 3AXSA 4FT4A 2ZCJA 4HSGA 1DCTA 3P8ZA 1XJ5A 1NV9A 1JTEA 2OO3A 3OZTA 5CVEA 2YVLA 4GOND 5D1HA 3A26A 5IH3A 3EMBA 5DT2A 1RJEA 2I7CA 5IKMA 1XVAA 3BZBA 2PX4A 1OR8A 2ZZKA 3GRZA 3EVAA 1NT2A 3FPJA 1AQIA 1ZKDA 1R8XA 3VC1A 1IM8A 1RJDA 1JG3A 3HA3A 4QVGA 4PNEA 3KPYA 3G2OA 1XDUA 3LL7A 5FUBA 3O31A 2CKDA 1BOOA 3H2BA 5K09A 4PYLA 1KR5A 3K0BA 4C4AA 2O0LA 3EGVA 3MTEA 1X19A 2ZWVA 3G8AA 2IBSA 1YZ3A 3E7PA 5JUWA 5KS2A 2FHPA 3IV6A 4RTRA 3ER9A 2BH2A 1QZZA 3JWHA 4EMSA 2N47A 5CD1A 4IKPA 5CCXA 2VDWA 3TKYA 5EZQA 3KR1A 4P7FA 5LQJA 2YXDA 9MHTA 3DLCA 4GQBA 1RI3A 5C0OE 5LQUA 2DULA 3PB3A 3WSTA 3OU7A 3KPJA 3FTEA 2C7QA 3SSOA 4LG1A 3ORHA 2IPXA 4KWCA 3C3YA 5EIFA 1T43A 1EQAA 4U7PB 2K4MA 3JWIA 3HVJA 2Z6AA 3V97A 4AX8A 5HEKA 4WXHA 2B25A 2NXEA 2VDUE 3B3FA 3BGIA 3HEMA 3IYLW 4GUAA 1AV6A 2AOWA 2B2CA 4HGYA 1R00A 3THSA 4P7GA 3LX6A 5K0NA 1L9KA 4GC5A 5K0EA 4NECA 1VBFA 2AVDA 3NWEA 2O05A 2O06A 1FPQA 3LCCA 1JQEA 2OBFA 3P97A 5CCBA 5K0BA 5LQKA 5GWXA 5EMLA 2AOUA 3FZGA 3KQWA 3CVOA 3HM2A 3RIEA 3R3HA 2QYOA 4PYKA 5E1MA 4EKGA 5ICGA 4E2XA 2Y1WA 2NP6A 4FSDA 3GGDA 3FYCA 3VC2A 4CXMA 2KW5A 1YB2A 3TLJA 3C6MA 3UA4A 4M38A 3FTFA 2WA2A 2YTZA 4X60A 4ATNA 2IH2A 3ANXA 2C7PA 1NV8A 2ZVJA 5E9WA 3TFWA 2AS0A 3IHTA 3EGIA 2LD4A 3LBYA 1VP3A 5EKUA 1BKYA 5DTQA 2OKCA 5EMKA 4XUEA 2I62A 3G89A 2XVMA 3M70A 4EK9A 5DLYA 3NWBA 4M37A 4F85A 3T7TA 5B1SA 4E2YA 2G72A 3EGEA 1NW5A 3AY0A 4OQDA 2XYQA 2ZIGA 3EVBA 3SR4A 2HMYB 1INLA 2PXAA 3K6RA 2B9EA 3B89A 3OCJA 5FA5A 4QPNA 4BP1A 4CKCA 2DPMA 2FK8A 3LCVB 2ZIEA 1QAOA 3GU3A 3GXOA 3KPUA 3SSMA 1Q0TA 2YR0A 3RW9A 5T67A 5CM2Z 3ME5A 2A14A 2ESRA 2XYRA 1XTPA 2JJQA 3BUSA 4R8RA 10MHA 3NDJA 3BKWA 4RV9A 4F84A 2G8NA 3PFHA 1Z3CA 4A6DA 4AZWA 3UWPA 2EX4A 1NE2A
chains in the Genus database with same CATH superfamily
1KI3A 2NQIA 1CP3A 1G19A 2IYXA 3CISA 2IOQA 3KKMA 1IC6A 2FMKA 3D8RA 5CTAA 4BUJA 2CUZA 3NNDA 4HFMA 2J4DA 1WF6A 3M6FA 1QFZA 4X85A 4DMGA 3L7IA 3Q8KA 2UZIR 2PN1A 3OIWA 4US0R 5D85A 3WNDA 1USUA 3UF0A 1U5IA 1DPGA 1JQBA 4KWIA 4G8JA 3SLKA 3PFNA 5CUQA 5J4KA 1U81A 3CKLA 1YIDA 3H75A 3WYAA 2GUWA 2ZWIA 3NM5A 1MDFA 3QELB 7ADHA 4IIFA 1GTMA 3VKWA 1ABBA 1W36C 1VFPA 1E2MA 2I1WA 2XQIA 3NTVA 1WKBA 1GCAA 2GEBA 2HBYA 3KVYA 1G6Q1 2OV3A 1CRLA 4PW0A 1MRZA 3RUCA 1YCHA 1BW9A 3INTA 3Q40A 4Z86A 4EP1A 3GLIE 1RM3A 3CRZA 1KMNA 1VGQA 3JQAD 1EWVA 1RMQA 4WOCA 2FJPA 3RKRA 5LZ9A 2DX7A 2QPAA 4ED9A 4LS3A 1KZ4A 1NI4A 3AMVA 2C2XA 3G5MA 3EHDA 4FDVA 1KSJA 1IPEA 1GFWA 2ZITA 3S81A 2FDXA 4LJ6A 2JLCA 3ND8A 1XQVA 1BXKA 2WJGA 5F7OA 3AVTA 4Q03A 1F6WA 1VL2A 2HMAA 2YMLA 1FIUA 4FCWA 5AQEA 3AEZA 1U2GC 2WF9A 4LXXA 1JFFB 3FYUB 1FQWA 1X80B 3KZNA 1K9SA 4IH9A 2FUEA 4QM7A 3R9WA 2EBHX 3KT8A 4AKHA 2WD8A 1TU6A 3HCOA 2VNAA 4PG6A 1ISHA 1CS8A 3E1GA 1KDVA 1G55A 4KH1A 1ODFA 1HE8B 2NU7B 2O2GA 1JF8A 2QUKA 4KBGA 4OQ4A 5HKLA 4GYKA 4BJ3A 4D97A 1BSVA 4NLLA 1WE2A 1I3CA 3DB2A 4RQAA 4U7JA 3QFFA 4GMHA 3CLUC 4KACA 4NZYA 4AS1A 3OLYA 3L43A 2JCVA 4RX1A 1N2CB 3A1WA 4YO7A 4NARA 1H2BA 1UM9A 3STVA 1RRMA 4HATA 5IHPA 5CCDA 1KQNA 2D6FA 4BVLA 2ZBGA 1M3SA 2BE9A 2PK3A 4YCLA 1RZUA 3ZPXA 4UUPA 2FN3A 3AY6A 2Y66A 1IVNA 4PXAA 3WXMA 2EP7A 1K06A 1YRLA 2ZKLA 3D6HA 3DOOA 2C2WA 1NMSA 2BC9A 1OXXK 2P69A 1EMDA 1W29A 3KV1A 3RBZA 2FSGA 3VISA 2IS6A 4FZJA 4MR7B 1JILA 5DF1A 4YJFB 3AVUA 4JB0A 3PI6A 3MERA 1RIIA 2BGMA 2CXXA 3L4BA 3NTLA 1ORWA 2G28A 1LFDB 4CF7A 4YHBA 3STTA 5JZMA 1NSYA 3V2HA 4Q7LA 3SYLA 4NY1A 4QBHA 1T3HA 2GR9A 2ORWA 1RM4A 1DARA 2JHPA 4QTXA 5F02A 3UFBA 4E08A 1ZEMA 4Y3UA 2G70A 3LBHA 4ZHQF 3SHTA 4NE2A 3OE1A 4UUAA 4MWTA 1EZZA 1QANA 2YX1A 3UJPA 2ZE5A 4EAAA 1EE1A 2FETA 1SK8A 2BTWA 4ETWA 4WKBA 4Q9JA 4HX5A 1BEEA 3X1KA 5KPDA 1E4VA 1XE3A 3ES9A 1CEEA 2YFYA 1NLFA 1XELA 2Y71A 4GBED 4YFVA 2VNIA 4FSXA 3V5NA 4RMIA 5BNFA 2AIRA 3DAHA 3ZHXA 1WDTA 3QY0A 1Y8RB 4F9TA 5EF4A 5BRJA 1S0UA 2V7PA 3LRXA 4HLCA 4DZRA 4K6GA 1C4XA 3NB0A 2RI6A 1J6UA 4X3CA 3L4BC 1G4AE 1KETA 1E7SA 1KR2A 3QWFA 2B1NA 2NTVA 3ZIUA 3VJRA 5JMTA 1O6ZA 2R6ZA 3UBMA 5JZBA 4IVQA 1HKUA 2R44A 5KREA 3NYRA 4QRGA 1K7CA 1M8JA 2CF5A 3A2MA 1NYLA 4RWZA 3PG5A 1G8YA 2A35A 2ZRJA 4HRVA 4B6RA 4AICA 2BM8A 4D3XA 1RZRA 2XE4A 3E61A 3GEDA 1YA6A 3W6UA 4JQZA 4LF6B 4BNXA 3ICCA 3C4JA 2ZXEA 3B6MA 4RDXA 3DW1X 3LT0A 1E60A 1VMEA 1M6YA 1VPEA 1KQFA 1IOLA 2HRDA 3O2QB 3PE6A 1TO2E 3ESZA 2IK8A 1Z8DA 3PIRA 4HDCA 3BL5A 2HREA 2J5KA 2DPLA 3MJ4A 3TINA 1LX7A 3TX6A 3ROXA 3PHCA 4NFSA 2H9AA 3DV9A 3BM5A 2G8LA 4UJ3A 2PSSA 2A9QA 2ACVA 2AQHA 2UZ1B 2NVOA 2P3QA 1L4BA 3BEDA 5ENZA 3WLEA 4CCYB 1M1YA 2IPOA 1DRKA 3CUYA 2X8AA 1E1MA 1I0IA 3FKJA 1MF7A 4E5SA 2YJCA 1S2NA 4H35A 4XSVA 3TCXB 3WZLA 3H1EA 2XB4A 2A88A 3VU8A 3AFGA 5E4YA 1JIXA 3R8FA 4LFAB 3GHYA 4YQEA 2HYIC 1W2WB 4BNWA 4EJ2A 1GZSA 1FDRA 4PSKA 1YF3A 4OAPA 2E82A 2V4UA 1MJ5A 2BISA 3UB2A 2EZUA 5B57C 5F78A 2ZSAA 4KB5A 4B3BA 2WDZA 4Z1OA 2ZYRA 1QO0D 1P19A 3OVZA 2DY0A 2BD0A 2QLTA 2XWPA 3R7AA 1GGHA 4C43A 3WIBA 3MC1A 4W7HA 1ODSA 1LQUA 2RHDA 3PU6A 1UBUS 2XXJA 1TUBB 1W6RA 3DPSA 4KXYA 2LDXA 3VI4B 4G1VA 4RDCA 5IZ4A 3P5UA 4LEIA 2QGFA 3E35A 4G1CA 1Z2OX 2JFXA 2ZRPA 3JVIA 4KQIA 2UZAA 3RRBA 4J75A 2QZSA 2B4QA 3BD8A 2YUTA 4J3JA 2AK3A 4P4TA 5DZSA 2B34A 2BTOA 3T1VA 2XUJA 3K1JA 3A6EA 1E2KA 3C5HA 3KM0A 2JVKA 3E5MA 4UEQA 3TSCA 2WB2A 4JXXA 2C2BA 4L4SA 3EMDA 1D4ZA 3L8YA 4IZ6A 1HFJA 2UUPA 4YJDA 4BO2A 1HNXB 1OASA 4M9CA 2JCBA 3KSEA 3K0AA 4QZVA 1HKHA 4XGKA 2B8WA 3RVPA 1C7IA 4YYSA 1VL1A 1TAUA 2FWBA 5IEJA 1XVTA 1SKMA 1YV9A 5BW8A 1SHJA 1TADA 3UAGA 1KDTA 1TVCA 4H7FA 4DR2B 2YWDA 4TZTA 2ZM5A 1K8RA 1LBSA 1D5CA 1N0IA 4OF4A 4RJJA 4C6TA 2QTAA 4K9KA 4FDTA 4MUMA 3RLFA 4NQRA 1D2EA 3HHAA 1A8QA 5LBTA 1NIPA 4PVCA 3S2EA 2JFFA 4D9GA 2VHJA 4PRYA 1PPDA 1UK8A 2WJPA 5F9MA 2FE1A 5CA0B 2NN3C 3DWFA 3JD1A 3MELA 4OJYA 5E0KB 3HXOA 2GEKA 3RFTA 4DDHA 2GHRA 1WHTA 1PWYE 1KBOA 2NQ2C 4EDFA 4IO1A 2EU8A 2DT5A 1I01A 4Q01A 4BC1A 4E0BA 4FFRA 1A2BA 3UW3A 2Q49A 4PHCA 1E3MA 1Y3DE 1U2PA 3MLAA 4P7JA 1EK5A 2V55B 5CVUA 3SMVA 3T7IA 3PVSA 2DFTA 4DA8A 2XCTB 4CDDB 1VE5A 1J5PA 2F00A 4KUEA 5K7SA 3F47A 1Z0UA 3JZMA 2P30A 4N18A 2BEKA 1F29A 3BFVA 1GQOA 1GVHA 4K9PA 4FFSA 4TQGA 1XDSA 1GU1A 3KOOA 1GAXA 2HT1A 1IHPA 3OT1B 4B3FX 3CT6A 1A96A 1KSGA 4IS3A 3RKSA 4BPBA 3FHOA 4GRIA 3GA0A 4BDTA 5ALXA 4GPZA 1DQSA 4TUYA 2R7MA 1LDGA 1PBNA 3H6KA 5B7NA 1Q0SA 3BPFA 1Y37A 2QUZA 3B3QA 1BKDR 3T52A 1D4FA 3ELDA 5IJAA 1WTCA 3B3JA 3ETNA 1U0JA 2EZ9A 3ZBTA 2YINC 2PKEA 4TTQA 1ID8A 3CUTA 3N86A 1IWDA 3CLRD 1VI5A 4C3OB 1R4ZA 4YBRA 1CR0A 2H9IA 3BH0A 3W04A 4CCYA 3QHPA 5EIEA 3GCXA 4QEZA 2HTEA 2W93A 3CLUD 2NPFA 1XQXA 5CBKA 1I6MA 2F43A 2OWDA 3GZTB 4CCAA 4CDEB 2OP1A 1MO2A 2X3UA 5ERYA 1DB3A 1JKIA 4KE6A 1GTZA 4L51A 4R1SA 1AU9A 1RQ2A 4FEYA 1F2TB 1JBQA 1SB8A 4LGVA 3V4FA 3U6KA 1A95A 1D2HA 2D7DA 2PL3A 4NJEB 1T9DA 3DOJA 1NSTA 1RJFA 3K8QA 2PGOA 3QXJA 4E5DA 3SHFA 2FG5A 3EXFA 3T3NA 5J1SB 3GJQA 1A72A 3F98A 4GQIA 4IG9A 4X90A 2QVXX 3UQZA 3W2IA 1Z17A 2D8AA 1XDZA 1AHHA 4Z9YA 2D7JA 1N2HA 2MMGA 3CXUA 4RM3A 3WWDA 1AQJA 1MIRA 3WNZA 4GLJA 2CXOA 4ZKEA 1ISJA 1V71A 2HK7A 1P9LA 1CJMA 2AN1A 2PL1A 1NW8A 3UMBA 1UKEA 4NS1A 2FPPB 2XNDA 3IP3A 3L9WA 4I1UA 2P6MA 5AK4A 4AZ0B 1R8YA 4PADA 2Q5LA 1NU6A 3GLIB 5JXIA 4I19A 5TS3A 3LPLA 4URWR 2BFWA 2DQSA 4FCVA 5H5JA 3OE7A 3TFQA 2DFLA 3WYGA 3L05A 2OVBA 3AOGA 1NVMB 2NPIA 4S24A 1JLSA 3I2KA 3CC8A 3ZJTA 1Y8QA 2R6R1 4M9XA 3TVTA 4AY5A 4I4CA 3THYA 5FKJA 3AK4A 4D0GA 1DKRA 4JFRA 4MV7A 3OZWA 1XEWX 3K0AB 1GGKA 4OBWA 1G5FA 4GXNA 4OYHA 3HBLA 4UCWA 2QTVA 4D9HA 4CIYA 2IQ5A 3GPBA 3PQ4A 3TIVA 1VBMA 1LI4A 4GR5A 3RCBA 4MKRA 3TRHA 3TYXA 5C8YB 3RAFC 3DMFA 2OHOA 4JP1A 4ZODA 4YAGA 4U5XA 4CZWA 2CIOA 1U3UA 3Q7RA 1M2OA 4S05A 3B51X 4EJFA 2C5GA 4KV7A 1RS0A 1KAMA 4IHJA 2HPZA 3ZQJA 2D0DA 4EY7A 3HBNA 5BYAA 3OVXA 3DCJA 1G64A 1G6OA 2O2JA 4O1MA 4ZREA 5LZ7A 3RSCA 4A9AA 4HTFA 2XADA 4O2RA 1P8JA 2WQ7A 2MSEB 4I99A 2BPOA 4CM1A 4JD5A 3H4MA 2H65A 3KZMA 3N0RA 3P8ZA 3WWEA 1Y6FA 5INTA 3H9EO 5IKXA 1JQAA 4BP8A 2YS6A 3FROA 4UTXA 4PO8A 3OTGA 1V25A 3KHUA 5DT2A 1VHQA 2D62A 2F8MA 4LFCB 3S1AA 5AW1A 5KX5B 1PJCA 3GRZA 3CVXA 4QGSA 1NKSA 2WT4A 3REFA 5CNKA 4KKVA 4Q1AA 3VO9A 2E02A 1RTTA 3R75A 1XD8A 2AZ4A 1VG9B 3S99A 2OULA 4YYQA 1E18A 2JLQA 4HWPA 2HF8A 2HSEA 2W9XA 3GLUA 3HY6A 3UENA 3ZGXA 4TMFA 1XA0A 4YWJA 4REZA 4W5NA 1PNQA 1QS0A 4TWBA 3OD1A 2GRAA 2ZWVA 2XCRB 2AUTA 3E7PA 3PCTA 4MXDA 2BH2A 4MS1B 1DVRA 1L2TA 1NUTA 2MOKA 3GOQA 4BAZA 1NDUA 2KPOA 3C45A 3QTLA 3P32A 5ALMA 3P52A 2NUTB 5KVQA 3HC7A 4BIMA 5AI6A 4CTOA 2HA7A 5TPZD 2OSVA 2JATA 4Q1BA 4LC9A 3WSTA 1Q0QA 2P1RA 1Q1QA 2ERYA 1FRZA 1CUIA 1XLVA 1YZBA 2QZ9A 2ZR8A 1V7QA 2AUXA 1ZN8A 1G2QA 1QR6A 2X40A 2CW5A 2GAOA 5BN5A 3P9QA 2VDWB 2XCOA 5CT9A 3OM0A 2NZJA 3C16C 4MPDA 3RUAA 1VHDA 3U4DA 2P6UA 1Z34A 2XUQA 2RHGB 5BMVF 4BTVA 1W36B 3FSRA 4X6HA 2XH8A 4XGIA 1O97D 2CHVA 1EUDA 3FNHA 4H4DA 1L9KA 5DNUA 4KCGA 1Q15A 4YLEA 4YDSA 1ZJ6A 2CK3A 1I0LA 2Q4BA 4KPGA 5IBPA 3P97A 2C4WA 3TGPA 1KWGA 2P2YA 4YRAA 3RTDA 1H9AA 1FFHA 1US8A 2FSHA 4UD6A 3O0TA 2G4VA 5MN5A 3O47A 4G0UA 1QJ4A 1UAYA 2PRIA 4BJHB 1VYHA 4XPIA 1MQSA 4B2LA 1N8SA 1IUOA 2PMDA 3C6MA 3MJRA 2JIQA 4EO9A 4L6AA 3E22A 5KQLA 2J3IA 3FPKA 1PWHA 3EGCA 1Q0UA 2AS0A 5AKYA 3HXTA 5FOSA 2WG2A 4LRWA 2AG0A 3F5MA 3CCBA 4P4UA 1Y4UA 1G8FA 2IYSA 1XV5A 3IP6A 3KEFA 3NWBA 4LWQA 4UREA 3SBXA 2Q9AA 1AKNA 4PQEA 3DBIA 2X8JA 2ZUWA 3EN0A 4K0KB 1T2DA 2IL1A 2QT0A 4ZJZA 1ZOIA 1Y9ZA 2O52A 3DZFA 3I6ZA 5B4TA 4FKZA 1F2VA 1UEJA 3DL7A 4JP5A 3ZEIA 2C4NA 1G5PA 1IQRA 4F4FA 1W44A 3IO3A 3TR0A 1WXEA 5C8DA 4HFNA 3S2SA 4A8JC 2Y0BA 3I9OA 1BCRB 1CG6A 2XYRA 2CHUA 3HJUA 3PQ8A 4YEDA 2HQRA 1QNLA 3DO5A 2DBYA 1H5NA 1A8SA 1CDZA 1FLVA 1TVEA 2OCIA 2POCA 1PW7A 3N8NA 5ALLA 3RVRA 2WSMA 5TMPA 1SVMA 4FD3A 1QDEA 1V43A 1VP9A 3UKDA 4JV5B 1GRVA 2R7LA 2F1HA 5DRTA 3U4AA 4RCZA 1U3WA 2D3WA 4IFIA 2ZT6A 1G38A 1OXKB 2NACA 4MVJF 4L9SA 4NYIR 4RZQA 5CH8A 3JARA 1N7IA 4I50F 4UQOA 5FBVB 3A4NA 3DMHA 4W7SA 1NJSA 3SEFA 3WTBA 4C0KA 2ZGVA 3MGAA 2NU7A 3S7TA 4FC7A 1K0FA 3KUDA 2ARKA 4HEQA 4Q6BA 4NBUA 4XVCA 5KYUB 2MYUA 2VRNA 2YN4A 3ZWCA 2FPGA 2EYQA 2I3BA 3L0YA 4GPBA 2H2WA 5K1ZA 1QMYA 1EGQA 1HRDA 1W5TA 2O07A 2Y0EA 1R4MA 4L78A 4Q4AA 4MKHA 4YXFA 3NTXA 2BGUA 3IMCA 4J4HA 2VDKB 3V8NA 3P2EA 5IWCA 1MUUA 3G8DA 2YQ5A 3TSAA 4WESB 2G76A 5G02A 1SUDA 3K9WA 3RG2A 1KZ6A 5T57A 4JI5B 2R11A 2IE0A 4LXQA 2FLVA 4YV0A 1J07A 2OCXA 3W4IA 2BHSA 4KO2S 1HG1A 3DOCA 3H6GA 3FB4A 5I01A 4HNSA 4XYBA 1SCUA 3UNXA 2FPIB 1F5SA 1XRMA 2NSHA 2NSJA 2XGGA 3QNUA 4J16A 4O4JA 5AM5A 3G68A 3TXYA 4BZQA 5FUMA 1G42A 2QL9A 4JMLA 2P0YA 4B85A 2YWBA 3HKDA 5B3KA 5KDOA 4CMKA 1FFCA 1XQ9A 4D46A 4D74A 2K5UA 5EI5A 1XLWA 2XUFA 1UBCA 3MCAA 5EE3A 3QKTA 4YRIA 4Z7JA 1V37A 1I80A 4WECA 4Z51A 4R7ZA 4UOZA 5KJFA 2RCYA 3ZE2B 5KSWB 1EUYA 1ZIVA 3AZOA 1QIHA 1X7YB 1ZN2A 3FSGD 2WKPA 3FKSA 3PC3A 3VTZA 4UJ5A 4YYVA 3JQAA 3RKUA 3LFHA 2YJ4A 3RWOA 2FA9A 4ERNA 2A1UA 4N03A 3PR1A 2W4MA 3C8MA 3JYHA 3F7OA 3L04A 4YQYA 5DYNA 1FK8A 2WF7A 1U3VA 2NT3A 1ISPA 3KQPA 1VKRA 4MUEA 4CI9A 5ADUS 5BUZA 2X5JO 2AI3A 3JRXA 5MHTA 5TQJA 1WL8A 3V2IA 1D1PA 4UE2A 3GAMA 1IULA 1JXQA 1NAIA 2QRPA 1E0JA 1PV1A 3SM3A 4BY9E 1JFFA 3FYUA 1U6JA 2EFYA 4HUQA 5BNIA 1VTKA 2XB6A 2OAGA 4O25A 1X7GA 8AT1A 3MWDA 4BEBA 2QRLA 1KI9A 5KCMA 1RHMA 2C8VA 4UNIA 2VATA 4WFQA 5HMMA 4PYOA 3VU9A 3C0RA 1O96A 1ODKA 1TC2A 5HRUA 3NOXA 1E4EA 4ENTA 4HZIA 1OJLA 2ORYA 1BEZA 3ZZ1A 2QSJA 2VHEA 4O2BA 3R9XB 1BE0A 3I3OA 3UICA 2GAAA 5DW3A 3V46A 2PGAA 2PQ2A 1TDJA 3CWQA 3QLVC 5ALPA 1CEQA 1N92A 4FKBA 3LX5A 3VOTA 2ZJ6A 3HB5X 3GFOA 4LMAA 5EXXA 4AM8A 4WOBA 4DPLA 4U2KA 1RZRD 2XGMA 1BYIA 4RS4A 2AZMA 2ZPAA 4K8RB 4BP9A 3TTXA 1BOFA 3U1VA 2ZCVA 4EW3A 4EL0A 1GVNB 2FV8A 3KLNA 4LISA 1NBIA 1M1YE 3COJA 1EFAA 1U9ZA 1MA3A 1WQ3A 3F7MA 1NSFA 3WP1B 3VNUA 5F2KA 1JLMA 3DO8A 4ACAA 4G5HA 1TQ2A 2PTGA 4NV0A 1SUIA 1L7BA 1L3BA 4XJTA 5CDSA 4OREX 3COSA 3KXPA 5HPYB 4Y18A 5EE0A 2QIPA 2XXAA 3L6RA 4L3WA 5CNJA 1ACJA 2OV2A 5IULC 2ID7A 4DIOA 4IDNA 3VVBA 3IHWA 3CNBA 4ZICA 4L15A 4PZUA 3HYRA 1GQ2A 1M8PA 1Z6ZA 1CV2A 3E8MA 3LBNA 4Z3DA 4B4WA 5I7UA 2A1UB 2IA5A 4K6CA 3JARB 1VL0A 3NAQA 4IYRA 4JY7A 2G7YA 2B99A 3DEHA 2XMCA 1MEOA 2YQZA 3T1NA 1AC5A 1BAPA 2AXEA 2ZJ2A 3QMPA 5HMLA 2XKKA 3MWLA 1W87A 1EA7A 2HA4A 2KX7A 2B8TA 4QQKA 1PLKA 1I5OA 2PLAA 2QAIA 3H4IA 1YD7A 2BBSA 3LUFA 4HGZA 4IDHA 3STYA 3V1LA 3QYJA 4BNZA 1QR2A 2OBLA 2YS7A 3OUTA 1H2RS 4DB2A 4P5DA 1F1JA 2BJHA 3PQDA 4W1QA 4F6CA 1G0OA 1WOYA 3CRVA 5EZ5A 16PKA 4MQLA 5A62A 3QXCA 1RWOA 1CQPA 4IXTA 1R6BX 4P4NA 3CF6R 1TYDE 1N6RA 1QO7A 2COEA 2XXBA 1MB9A 2QU7A 3DUFB 3I9V6 4XFKA 2O9JA 4P80A 4UPEA 2QR5A 4BQEA 4QUJA 3LLUA 3T1YB 4EQZA 1X1DA 3GMTA 3MSCA 4EI9A 1UBFA 3VU3A 2JLWA 4DBZA 1AGYA 3BSFA 4ACBA 5KYYB 1FSZA 4PS1A 3ZIAA 4H18A 3U6BA 5CDYA 1Z8NA 4NRDA 1D6JA 5H59A 3TQSA 1E5TA 1T15A 1FFDA 1RAIA 1ZNZA 4IH1A 4LVCA 1C1XA 4GZLA 4HEHA 4E03A 4EHNA 4B3SB 3MOSA 3W8DA 4JH0A 1N4DA 3OZBA 4LJ9A 5FR1A 1BXRB 3BGDA 1GGJA 3Q2KA 4QDKA 2G83A 2BFAA 1SBCA 4FR2A 3OBBA 5I4IA 3WXGA 1RXYA 5HCNA 3RLIA 1GPWB 1S8NA 3FVRA 3JYLA 4EQ6B 2IYYA 2FFAA 3QIAA 1OH7A 1PR2A 5CLHA 3PRPA 3HCEA 1WSDA 3M4JA 5J1TB 3L0OA 3GBVA 2BFOA 4I9NA 4EG7A 4FFMA 3HYTA 3UHFA 5CFNA 2NV6A 5CJ2A 3OCZA 5EJAA 1ZHOA 1LPBB 1GLGA 1LK5A 1XHEA 2HGSA 4GC9A 3V34A 1S1MA 4IGFA 4CHGA 4BWFB 3LHSA 4HB3A 1DOAA 2QD5A 3ISJA 2JANA 4MB0A 4RSRA 2QDXA 1EM8A 1S2GA 1GFZA 1Y82A 1Z16A 4D4HA 2ZYDA 1PDVA 3HY3A 4BFWA 2VNSA 3IODA 1NBHA 1RI2A 2JFBA 3SF8B 3FLMA 3T9CA 5JWHA 5H16A 3F3SA 4YACA 2WA1A 3INRA 2RAVA 4QBBA 1JSZA 1RAAA 2HK6A 3V1KA 2PSHA 2XOXA 3ZXIA 3FOEC 1TL9A 5U4XA 4G1FA 3W6OA 3PD1A 1NX6A 2CLDX 1XZIA 2E4YA 1O94D 4MZOA 2XF8A 1YK1A 2IPPB 4HB0A 4WKOA 3D0QA 1MOSA 2LWIA 3P9IA 3S0JA 4AJNA 1CVIA 2J3EA 1F0YA 1XF1A 1FLDA 3Q41A 2ETVA 4NZNA 3N7UA 4I5DA 1K1EA 4UM9B 3KR9A 4WZBB 1QXPA 3ZCTA 4OUKX 1I33A 4MQFB 1HYHA 1BNCA 1UWCA 2PWYA 2WHPA 3FR8A 4Q3CA 4QTTB 4TXNA 4DLAA 1IXYA 2YWGA 3E48A 3WBKA 1E2HA 5DE3A 1Q21A 2YN2A 3I12A 3COWA 1HTTA 2OCAA 1PWEA 1SXJE 1NP3A 4OFXA 4HTFB 1GCBA 3BD6A 4M9RA 3TE7A 5DGXA 2CNOA 4GBJA 5DVZA 2G8JA 4OB8A 1XC7A 4ZC8A 5LQNA 3PXGA 2QY9A 1TK3A 3BJMA 1RWKA 4M54A 4Y0NA 1C80A 1GA1A 1H8HA 2VDVE 4PS0A 2Y93A 1Z26A 3M6MD 1PT5A 4ZI7F 5JS8A 5BV8A 2IBTA 1DIHA 3A1CA 3NC1C 4HAWA 3W1WA 3GYGA 3I2GA 4TXLA 4DXHA 1MMFB 3FCCA 4ZK6A 4FCCA 1UKCA 4QU0A 4Y2HA 4KU4A 4I46A 5F76A 4O1HA 5ECDA 4HJXA 1P9NA 2YJGA 1DKMA 2P2SA 1JG2A 4PSDA 3THOA 1KP9A 1KJNA 3KUCA 4OHOA 1G41A 2V54A 5E8JA 1GPUA 1A5TA 3WGYA 3QWBA 4JITA 1YNSA 2JZNA 4G63A 2WF8A 5G53C 4B74A 1YVEI 1VRVA 2ZYIA 3H86A 3LGXA 3A36A 4R9NA 4HXEB 5K8UA 2RHLA 1HPLA 2DJ5A 3OEEA 1M2FA 2Q3LA 5FPQA 1P7WA 1X7WB 3TUJC 5KINB 4AY4A 5EZYF 3WJAA 1V39A 4F11A 4YV1A 5JH3A 2H7XA 5CU7A 3V6EA 1HYQA 4PR0A 2O5RA 4Z5XA 3PFGA 5L4LA 3N8IA 2HGZA 2ZRLA 3QX9A 1EBUA 5JHGB 1NONA 2FP3A 3QUTA 4OXYA 3ZZUA 2PMBA 1C30A 1EK1A 1OWLA 1Z4PX 3PYMA 4RVCA 3RIMA 5ENDA 4IG4A 2HD5A 2HHNA 4CTMA 1G21A 1YB4A 2HMVA 2VNKA 4XYEA 5ESDA 4EVRA 3WHKA 1HXHA 3ZVLA 3CG0A 3HCCA 2OA0A 1POWA 2J09A 4CODB 5HF6A 4J6FA 4UVEA 1OXTA 2XSZA 1LTHR 4C4RA 1GLVA 3T3HA 1HOTA 1NWCA 5G1PA 3AR5A 3CZ4A 2WJZB 3OTQA 1D07A 1RRGA 3KXKA 1OF1A 1AZWA 3GPCA 4R40A 4BZZA 2BYTA 5AJWA 1CZRA 3B6IA 4G1EB 3AF2A 1R6XA 4EKEA 3CRRA 3ZWOA 4QFCA 2FZKA 2NZXA 4NBSA 3D6UA 1ELOA 3FAKA 4KDFA 1QX3A 2H1WA 3V33A 4AJEA 2G88A 4G9GA 4F60A 5B7QA 1ZAKA 5FUYA 1L4EA 1SUSA 3D3WA 3NBKA 1GTVA 2LZ0A 2H07A 5F5LA 5K4GA 3OWOA 1N77A 3IP9A 2PV0A 2RH4A 3NNNA 3L93A 1IK6A 4YMHA 4ND3A 5FNZA 3EX7C 4II3A 1YFLA 2Q6OA 4HEJA 4EECA 3LHIA 4M86A 3FDJA 3FWYA 4RACA 5JTUA 3QLJA 2ZSUA 2PVPA 1PR3A 2JGEA 3D4OA 4R05A 1T1JA 1FDOA 1H0SA 1X42A 4RKWA 4AN1A 4MVJM 5IX8A 3LU1A 3NOQA 2ZBVA 4O4LA 3WKBA 1OH6A 1O6BA 5HR5A 3K0FA 3P2MA 1I3NA 5FEMA 1F9EA 4QO7A 5AUQA 3WLFA 3CE9A 1W5AA 2E6UX 2IJGX 1EP3B 3FYTA 5TVGA 5HOEA 2I4LA 1T5IA 1FS6A 3EDQA 4BXOB 2A0FA 5IYZB 4HSGA 3MMPA 1EJ2A 2OO3A 4RJIA 4I1IA 4NR0A 4X7MA 1FRFS 1USKA 2DHRA 4G8BA 1VJRA 3QFRA 3A6FA 1CTEA 5DN9A 1UOOA 4NONA 4MLDA 3ANLA 3TUIC 3CX6A 5DNWA 1KMHA 1V8DA 3AW8A 3BJEA 2HPAA 4MDHA 4U8GA 5HZKA 2D06A 3AYXB 1C30B 1Z5UA 2CMKA 2VG8A 3AVPA 3SNKA 1RBMA 1IM8A 2ZIXA 3RJ9A 2JPDA 3GVPA 3RVJA 3H8SA 2W2KB 3LL7A 4FQ5A 2W6ZA 2C96A 1PI3A 3K20A 3RRNA 1WXDA 2FUG1 2WBLC 2W00A 2X8WA 2XAUA 3N3BC 4G5QA 4LE1A 4PI3A 5HK8A 1EFUA 3KJHA 2PKRA 4V2UA 4DMRA 2C4HA 1QZZA 4GVXA 2Q6IA 1FQKA 2N47A 3SXPA 5FYQA 4ISBA 2PS3A 5GONF 2JGKA 2G82A 1DRVA 4CLHA 3DNFA 6GPBA 3Q15C 2HF7A 2WRZA 1JIIA 3S8MA 3ZH9B 2I80A 5FBRB 3O1HB 1CP2A 3HGTA 4HGPA 4MR9B 2VYVD 2WEKA 3FTEA 2JAXA 4G6ZA 4XA8A 2FZCA 3PUKA 5H3CA 4R01A 1J33A 4GVLA 4IY1A 5EJ8A 4WPGA 2YJZA 4Z7NB 2IOFK 1V3VA 4XYGA 2QORA 2AKEA 3QBVA 1GPDG 2HDWA 4BNJA 1RCFA 4RKYA 3NV7A 1AO3A 4BCDA 4ZIRA 3JW8A 4JVOA 3C9EA 2E87A 4KR9A 4MPTA 1IZ8A 3DCYA 1TM1E 3SSAA 4BOSA 1MVLA 2BHTA 3WDLA 2V1UA 5AWFC 3WLRA 2QUAA 2BMVA 4PBTA 2PFSA 2ID8A 3R3SA 4XLTA 4ZYXA 1WKVA 5JAUA 3HL0A 1PZXA 4J1SA 5EJ9A 1G8KA 5J2UF 3OEHA 2GZ3A 5TJ9A 4PLPA 1NJ2A 5HXAA 4CF3A 1UXJA 4TLDA 2N46A 2CLEB 1B3BA 1ZITA 3UA4A 1FP4B 4BQNA 4L3OA 4BO8A 5I4BA 1SZJG 3A2KA 3I09A 3HUUA 4HH0A 3JQ8B 3T61A 5AW6A 3L82B 1N3YA 4JKYA 3X2SA 4BNYA 5ARDA 5DTQA 3MFQA 3C6ZA 1UMDB 4YP7A 4BRUA 1G17A 1E2FA 4O0LA 4MJLA 3K94A 4RC9A 1E69A 2WJHA 3T7TA 4G97A 3DVRX 3KETA 2L69A 2XITA 1COWD 3W2HA 4CFSA 1KJYA 2GJKA 1TD1A 1F5NA 3EVBA 2QLBA 2XEDA 1AG9A 1N25A 1MS6A 2PH7A 1TJ5A 2V45A 5G4KA 5BN4A 1Y4HA 5AVZA 4U0KA 1XEXA 4YJHB 2DC1A 1WMAA 3L0SA 3ME5A 5CM2Z 3SNHA 3D59A 4YP9A 3U9SA 4ARSA 1OLUB 2UZ1A 4FYYA 2F1JA 1CXZA 1CYDA 3NDJA 3PPYA 5KYTA 1C29B 3ADPA 1J0AA 1A9SA 3K5WA 1L1FA 2VJMA 1DX4A 1PJLA 1SCUB 3T3DA 1IG3A 4F3TA 4R8KA 1MH9A 1P6UA 3ADOA 4K1XA 2P1DA 4NE9A 1MEGA 2NQGA 3LY5A 4HY3A 3WL3A 2NTYC 2GK6A 2JD0A 4LDZA 1GAEO 3FZQA 2CCJA 1T5TA 2ZYHA 1IEWA 1CY2A 3H5AA 1P77A 4JC5A 4NOMA 1O6FA 5E3HA 5JS7A 2P6OA 2Q46A 5A71A 4B79A 2AOUB 1ZSYA 2PT6A 5IW8A 2B1MA 1BXRA 2BKLA 3UMGA 1KDYA 1EP1B 2OCYC 3UM9A 3BK2A 1L7VC 4Y9TA 4ENWA 1XEAA 3MWEA 4KWTA 3C2QA 2AXQA 1CFJA 1S8AA 3LL4A 3ZTTA 2J46A 3W2GA 3K73O 3OM8A 1Z5NA 5IT0A 4QT4A 3G2MA 4RSHA 4Q3OA 4BQFA 2AYNA 1C3JA 2E85A 3L5KA 4B40A 2X14A 1M1NA 3OWXA 4PPYA 5IDVA 3FG9A 1T1RA 3I04A 5JTTA 4CNBA 1YA4A 3LKZA 2FW8A 5K6AC 1M8FA 5C53B 3V4ZA 3T1HB 2C2YA 2VPQA 4OHWA 3HCRA 4RVFA 5EPUA 3RSLA 1F7VA 2XV1A 4QGBA 2C5AA 2O4UX 1L4UA 3BJIC 1HA3A 3FW1A 4JI1B 4KUHA 4UQLA 2VBIA 1DL5A 3KTOA 4JOBA 5LVAA 5FI0B 4ZEWA 1FLNA 2FOXA 1G6KA 2QRQA 4ZQCB 1C0LA 2G9VA 3MMSA 2DJGB 3NR2A 4Y2YA 4C7VA 2QMYA 2QOEA 3KFXA 1QQAA 2C9BA 4TMYA 4LPSA 4TTTS 1LTQA 1DGQA 2ZIUB 5JAZA 5ULLA 1LRKA 1U5AA 3BGSA 5J2UA 3LIIA 4OU5A 4JKIA 2H11A 3CS3A 3FTDA 3IKJA 4EPVA 4ND8B 2PGDA 3SJZA 1TKAA 2JJ2A 3CSDA 1EBBA 3M33A 1RD4A 3UT0A 2E5LB 4BNDB 2ENWA 4WL0A 4YJ2F 3ABRB 4PAWA 1C7JA 1SKBA 5CA0A 3G0OA 4F9EA 5TB5A 2ZIAA 3GO4A 3WAKA 1SWWA 2IDZA 3OY2A 3WL5A 4NKRA 3VTFA 3S70A 1HLDA 4A0QA 3CT4A 4QHYA 3WMFA 3NGMA 1V1RB 2J7PD 4KXQA 4FW9A 3OY7A 1KL7A 1K4KA 1PF7E 2CXQA 2FX3A 1X87A 5K8VA 2VTEA 4G54A 4PLYA 3OE4A 2G77B 1BN6A 5CLQA 4YI5A 3ZVKA 2Q29A 3B2QA 1MO4A 1L7DA 4IIYA 5ALFA 4BE9A 3PGJA 5IUNC 5IM4A 4LHZA 3T1OA 2BAGA 2KBFA 1E9AA 1AF7A 2YXEA 3AVXA 1UJCA 5FLEX 1FSGA 1ZBDA 1ULHA 3DLPX 1TYZA 1NF9A 5CJJA 4DCSA 3A7EA 1B15A 2Z9BA 4FOTA 5TDHA 3R3UA 5A4AA 1UFQA 1QO0A 1TJ3A 5EJEA 4JGBA 3PNSA 2C29D 4RCVA 3DZGA 5C5DA 5E4FA 1E1RA 1IXZA 5JRDS 4GOOD 1RJGA 3DTVD 3IE1A 3DOHA 2IH5A 1VE7A 1W75A 3KQMA 1I3KA 2AFRA 2IY9A 1T1EA 2O3JA 2XMGA 3DE3X 1E98A 4MR7A 1QRSA 3C3PA 2G6TA 4K9OA 2MR5A 4X7PA 5BMVA 1OBOA 4L02A 1J23A 1A9YA 1LBQA 3G13A 4AJ1A 4EB6A 4FZVA 3GG2A 2GBIA 3BMCB 2JCGA 4U6NA 4DQUA 2CLLB 2IYAA 3AI3A 4IDCA 3SG0A 2IKQA 3N58A 3UAWA 3VSDA 4DSUA 2B2XA 1ZM4A 1BGWA 4GWGA 4LN1A 4UXHA 5I9MA 1B4DA 3L7AA 1G3RA 3IPYA 1IAQA 3GIWA 4FTWA 2JIOA 4IIUA 3GW8A 4TN5A 4YBZA 3EBPA 3UMCA 3WE7A 1UADA 3M1AA 3BIWA 3RVWA 2PGLA 1EJBA 4WLEA 4Q21A 4EG6A 1AHIA 1R6TA 2I33A 1T91A 2IDJA 3GNSA 5BW4A 3IEXA 3IR5A 5EIHA 4CEJB 3H7AA 5EUBA 3FLBA 2H7JA 2W98A 3JQAB 1SJ9A 3G8YA 3NBMA 4F1JA 4IDQA 4BOUA 1P1RA 3MGKA 5ANRB 1USWA 1EWOA 2BR5A 2WUEA 2ZIVB 4ER3A 3E9SA 3D02A 3PXUA 4JLNA 4LWZA 3BN3A 4OA8A 1P5RA 1YR3A 3CNHA 4Z8XA 4LIPD 3PENA 1TJYA 2O2ZA 1UXOA 1DV1A 1QHHB 3PI7A 1L1EA 1RHKA 3VR6D 4RYDA 5KWIA 1W88A 3IC5A 3TJRA 4QJ4A 3V9AA 1BQ3A 4K6MA 1OI2A 3DTTA 5AESA 2J7QC 4YALA 1J20A 1FVFA 3TJMA 3UJCA 1ZC4A 4DCGA 1XVUA 5KOIA 1CULC 4X6YA 3KSRA 1BW9B 3W1VA 1DUSA 2XDQB 2VA8A 3KWFA 5KU7A 1BU8A 4BP3A 1UT8A 2R6AA 2HLNA 3THXA 3IEUA 1KKMA 3NHLA 2QN2A 3D6SA 1MC8A 2ZSEA 5DHSA 2GXUA 4N01A 2RIPA 3S29A 1EDDA 3MIZA 4IHJF 5K0LA 5FH9A 2BF7A 1LU9A 2W71A 1UK6A 3PYLA 1SPXA 4QXPA 2KI5A 4D4KA 3NNSA 4N3GA 4RXTA 5F73A 4OQMA 4RTKA 4OATA 3STWA 2ZBDA 1V6CA 3CR8A 1FSSA 4AUEA 4EEZA 5BV1A 4Q3LA 2QN8A 3ROFA 3JZFA 2ZIZA 3ROZA 5HQJA 4XVRA 4GLBA 3LCUA 2GM5A 4D4JA 5HQTA 2RGNA 5BWLA 1GTSA 5PADA 1FP1D 2FLWA 2N0SA 2PGXA 2Z5VA 3Q6IA 5K3FB 3SC2B 4RVGA 3KAJA 3HA5A 3TWOA 2QYHA 3ZU3A 3BRWA 4XWWA 2A4MA 3E9CA 5L3ZA 1EK2A 3P1JA 5FADA 1PU2A 3HCPA 2XUHA 4AC9A 1VKHA 2WUWE 2FEKA 2JKZA 1NN3A 2J30A 4MPRA 2X0DA 1ZFNA 1Q1EA 4IP0A 1QE5A 2MHCA 1BYUA 4D99A 1YUMA 3VHRA 3A06A 4YAEA 2VHZA 3LPCA 3WLSA 4PPNA 3BCSA 3HU2A 1E7RA 1GSHA 3K09A 1P6QA 3SS7X 2PBHA 3MWGA 2P7HA 1IJBA 1EJ6A 3HRKA 3BZWA 5AM1A 3QVVA 2LBPA 2HMUA 4YJFA 4KO3S 4FX5A 3RVVA 3BRWD 5EJ5A 2B1JA 2JEYA 4RFSA 5JANA 5G1OA 1XI2A 4PLFA 4JBHA 2GOYA 3C70A 3MYRA 1ZLXA 2PKYX 2ZAGA 5E95A 1ZIDA 4P35A 3HJHA 5GJVC 4Q4HA 1O0BA 1Y89A 2D2XA 2FAXA 2WWFA 2ZRDA 1CS4C 3G0GA 4JZYA 4NOKA 4RF2A 3UT5A 5E9QA 1GMYA 4K3VA 2CLIB 1NP6A 3TLKA 2Q0QA 1AKVA 1LW6E 3GLKA 4NEHB 3HHPA 5KTPA 2ZJ0A 1SC3A 1XZFA 2WICA 3O75A 3A6PC 2JB9A 1WIWA 1DAKA 2ZBPA 2BKUA 2FWPA 4QICA 4TTAA 4X93A 1MC1A 4G2TA 1DU4A 1YQDA 4U7HA 1HSZA 3PIIA 3ID6C 3BULA 4RK5A 4XYMA 3TZKA 4BN0A 4ITRC 3U62A 3VNRA 3TLAA 2ZAMA 4MW4A 4ZZ0A 3WLIA 1IUPA 1H8EA 2WMNB 5LR6A 2CY0A 1P2GA 3PYXA 3ZDYB 4GEGA 3W8EA 4XIGS 1LSUA 1JSCA 4E6EA 3OPXA 4YT8A 1JPUA 1FSFA 3PEEA 2ADMA 4MRMA 4K3UA 2BW0A 4WERA 1PWXA 4HMOA 4COKA 1JU3A 1JH9A 4FJCA 1KVUA 4B4DA 3HXMA 1MHTA 4Q9IA 5DWDA 1E5QA 2WUGA 4EI8A 3RGWS 4DADA 4FNMA 2IHJA 4LOIA 4C7MA 1YDFA 2X1LA 1YUNA 4F8JA 5CDHA 1SVWA 1Y7LA 2YKGA 3CA8A 5A02A 2ODEA 1OZFA 5G2OA 1H4SA 4OMUA 3EF1A 1QPGA 1VDMA 2PKWA 1XRRA 3NJ8A 3ZYZA 3G2LA 2UUBB 1JDPA 4P36A 3LNTA 4IEEA 4MSXA 4HSEA 2BZ1A 2WZQA 1YXMA 2PS9A 3L0ZA 2RGDA 4AJLA 4E30A 3NPAA 4C14A 1Z0JA 5LMUB 1KP2A 2HJSA 2Z4SA 4DZTA 5NLLA 1LDYA 4ZDWA 4BQPA 1N36B 4C0XA 1GKKA 1P1FA 4W1SA 3S2UA 2DC6A 4YIKA 5PGMA 3EVNA 1D3AA 2QUJA 1YQTA 1Y5RA 4A8PA 2GBGA 4EO7A 3GT7A 4I81A 3KNZA 4CIWA 1BA3A 3D7NA 1N9GA 3G3EA 2OILA 5CDGA 1CYEA 5C1OA 5CPBA 2VA9A 1SD5A 4P3NA 5JH7F 1UZLA 1JSLA 1Z4IA 2K87A 1VIMA 1C9KA 1SULA 2Q9UA 2J3KA 2UVQA 4OP3A 2H1HA 2Z3VA 1S2OA 4HQNA 3KCQA 2E5FA 1NRWA 2IPMA 4YUVA 2DGDA 2CVZA 2IZ0A 1AF4A 3IP5A 4IV5A 3OMLA 3N3GA 1EPUA 4DVJA 5EHXA 5CNMA 3S2YA 4DRYA 3CRNA 821PA 3L4JA 2F8SA 4WZAB 3PDIB 1R5BA 3EOZA 3OZEA 3X0DA 4DFDA 1ODCA 3F3MA 2A0WA 2BY4A 2YBEA 3TOZA 3AETB 3KR0A 3UGTA 1UOPA 1G3IA 1WBJB 3LLSA 4LNUA 2GILA 3L07A 3H3XA 2WZCA 2V58A 3HP1A 3IE2A 4DV4B 1E64A 2M9MA 2C2OA 5C80A 4NHOA 3LA6A 4I07A 3ZS9A 5A3QA 4XPZA 2EFDB 3EZLA 4TSRA 3J81A 2JK1A 1E4EB 4MQ5A 3JD3A 4YASA 2BGGA 4XUCA 4K9LA 2GAFA 3UJAA 3BDVA 1XU9A 3GCGA 3O8RA 3ZXYA 1H66A 2QPLA 5HF9A 2WIBA 1GR1A 3I83A 2H2HA 5C4GB 4KITB 5JJIA 1TAQA 4PINA 1JECA 1G7CA 1EFTA 3KEQA 4Q3DA 1JKJB 3J7AC 3HXLA 4JBNA 3OLXA 2C2ZA 4FNAA 4DCNA 4XVUA 3BGOS 5HRAA 1TLLA 5KVVA 1YHNA 2FWJA 4LDRA 4YS6A 4ZV9A 1I10A 3WV4A 4KQWA 5FUWA 1OR8A 1UWLA 1W1IA 3UKOA 4M0KA 2DZYA 1HE1C 1SUEA 2IOYA 2IIVA 4UCXA 2JIZD 3PUYA 2X7JA 1TPZA 1UXIA 2A5GA 2GZHA 2W58A 3CW2A 3NIFB 2R7NA 3WWOA 9PAPA 4FLFA 4MS4A 1O0CA 1CBUA 1KMHB 3AERA 3VVLA 5U4QA 3RS7A 3UB4A 3W5HA 4KBFA 2PZ8A 1YIOA 1SIOA 2CYBA 3K0BA 5HS6A 3LUDA 4CF5A 4LZLA 4CGZA 1JDZA 1XCPA 3ZUAA 1FRNA 1T4CB 1X6VA 1M2VB 1YOVB 1RRCA 3MHHA 3CZMA 1R0CA 2J0EA 3WLHA 3F5QA 5AO9A 5ECGC 2E01A 3QPAA 4XD7D 5T8KC 4BFLA 1RYMA 1THZA 4MVJE 4BQIA 4BWVA 1GLNA 3OHSX 3DW3X 4EPRA 1PSWA 3H2HA 2EBWA 3OIDA 1JNXX 3E4CA 3E2PA 1XRQA 1NPDA 1A82A 1X3SA 2FUNB 4GU5A 4RAQA 5B6PA 5I3CA 3W3AA 4HVLA 2ZETA 3RFFA 4EQ6A 3VXKA 1Y8ZA 1YZNA 3Q12A 4J0QA 5DP1A 4MLCA 4LDPA 5K3OA 1WV1A 3F8SA 4YCBA 4B0PA 2R66A 1U04A 2Z6AA 2FZWA 2PJZA 4AX8A 1IMOA 3Q3VA 4B6OA 4D3DA 3SLRA 3R6GA 3C97A 5FPHA 4AT1A 2ODAA 1BWSA 1YTUA 2CE2X 5DH9A 3TW0A 4NEGA 4L4YA 4MRVA 3ECCA 5LB4A 4H3KB 4QEDA 1XD2B 2O2EA 5ES3A 4EHJA 4F04A 1VBFA 1YB5A 1H6CA 1PNTA 1UR5A 3OCWA 4WCDA 2XOKD 4II7A 1HDXA 2HHHB 4R2MA 4YGYA 5I7SA 1T5OA 4GL4A 5DB4A 4DV6B 2JI4A 1UBEA 5K3EA 2NSLA 2OO5A 1E2JA 4V0OA 2XKBA 3TTTA 4OU4A 3IEPA 3QNMA 3O82A 3X1JA 4HOYA 1W1UA 4C4XA 5C52B 5JZVA 2MSDB 3IOEA 1SEPA 2XKAA 3OCVA 1W2GA 1FTGA 4FQ8A 4X60A 2FW0A 5ALIA 3JQGA 3SOZA 5FO1A 4EUHA 1SUBA 5IXYA 3B7GA 1I2AA 2H5EA 4H59A 1Y9AA 3N1UA 3NH9A 4UZEA 4XX0B 5EKUA 5H0IA 4TKMA 2DR3A 1KEUA 4M0WA 1Y0BA 2ORIA 3G89A 3Q7TA 1IH8A 3V8EA 4EF4A 1BCRA 3IB3A 5I51A 5K2OA 2Q1YA 4P4GA 1VLJA 1V5IA 2HSDA 2ZEJA 1PKXA 3FMIA 4EO4A 4F85A 4HN4B 4O4JF 3VPHA 2CKMA 1NVGA 3COPA 3P27A 5COBA 1ABEA 1YC5A 1GV0A 2DQYA 1DXHA 1CUAA 1O58A 4CKCB 4DCUA 1SHUX 2E55A 2MSWA 4DWOA 4IX1A 1H9CA 5FA5A 1DBSA 1SAYA 2A1TR 4IJVA 4UDXX 2IOHA 4FHGA 1GT6A 1MOQA 1RHRA 1TA9A 2CDNA 2JBHA 1CZOA 2WTXA 1KK3A 3DWEX 4M0LA 3RO7A 2WJ3A 5T67A 4BO0A 3MWDB 1S8OA 5CBPB 3DFMA 3I39X 4P33A 4JJAA 2F7SA 4XXHA 1CLUA 1EUCB 4YYUA 1WB6A 1QH1B 4A6DA 4JJIA 4KO1S 2W7TA 2X5NA 5D7BA 5B1HA 1E9FA 4KO4S 4UDYX 3HJGA 4LAFA 4NCAA 4HDMB 3VSCA 5HIAA 1FFSA 1KJWA 1QFYA 2XECA 5K51A 5BT9A 5DCLA 2IELA 3IS3A 2OR3A 3Q5DA 4INZA 4QLAA 4R98A 4S04A 2QN6A 4FFBB 1CV8A 2Q2WA 4TVKA 3AC0A 5CMLA 1ZY2A 3WR5A 2XYVA 3KLBA 5CLFA 2XGSA 5BOSB 4J8PA 3C6QA 4L0DA 1R3DA 4I50B 1II0A 1JG6A 3X1YA 4AJJA 1WB5A 3QYPA 4ZGGA 3PGKA 3MQ4A 2H2AA 1RM0A 3JD2A 2TECE 3VX4A 1QORA 3RYTC 2F6RA 1YR7A 3CKYA 4BLSA 3E2MA 5DISB 4FE4A 2V5UA 5DJ5A 1XPRA 1YMUA 4ZCMA 2IY7A 4MQEB 1L4MA 4EB6B 4H7KA 1E66A 2VKQA 3LQ4A 3NI2A 3N8HA 3NHSA 3RC3A 5H4GA 2R6NA 4HH1A 3HKDB 1ZCMA 1KO5A 4B45A 2WJJA 4ZANA 1I6LA 3O8CA 3MUFA 4BQSA 5JSHA 3W2TA 2P5SA 4YCMA 1NMQA 2Z0MA 3I2IA 2G07A 3ZDZB 3DE0X 4UM9D 4JI4B 4ZQBA 3T5AA 1MP0A 1XEWY 3QRWA 3EYWA 5EYPB 4OSOA 2AV6A 2X2PA 4D96A 1NL3A 2W2LA 3FPEA 2IYZA 2R8EA 1I3OA 1U9IA 1FUEA 2AFIA 2F9LA 3GNTA 3QU4A 5EE9A 3VDXA 3MXTA 2Y5BA 4O2AF 1X38A 4P6EA 1TW3A 3ZI7A 1GGEA 4EMTA 2ECPA 2QXUA 4TQUS 1NVFA 3RAGA 3GZJA 1T0JB 3SBEA 2GJ9A 3PFFA 4TL6A 2BWJA 5DHTA 3AP3A 4JLVA 1DC4A 1PL6A 2ZUUA 3BK7A 1Z3IX 2Y68A 3HNPA 4LV5B 1GUAA 2I6GA 3NBZC 3ICPA 4E21A 3T9AA 1M5RA 2Z2XA 3TR6A 3L01A 4NC9A 1XPJA 2RH8A 1KU6A 3LI2A 5DGCA 5KOHB 3HY4A 2Z5LA 3R6TA 4GOKA 1IXKA 4NE7A 3RWBA 1ORIA 1GZHB 1T5DX 2DVMA 1DCMA 2YHIA 3FFAA 5KSZA 1BD3A 4ZXPA 1RHQA 1WLSA 3FPFA 1BJRE 4L8LA 3QEOA 4OHPA 1CQJB 4LYJA 4XZXA 1V2HE 3ZQ6A 2JGLA 1A9XA 1YFZA 2IRWA 4Z9AA 4XLLA 4PFJA 3CZRA 3DAPA 1RI1A 3C6KA 3L0BA 1WCYA 4BNKA 1T6XA 3U7HB 4DGQA 4TYPA 1IOVA 4MRRA 3MHTA 4D8IA 2PBFA 4HNHA 2XMPA 4J0CA 2A0XA 2WV9A 5E9JA 4C0LA 5JH7A 2BN4A 2W2PA 2NOAA 2AMLA 4JDPA 2JGMA 3G2QA 1M6NA 4AXMA 1Q92A 4YCNA 1P4RA 3BAFA 3ETLA 4Y2XA 4TKLA 1UKBA 3TI9A 3LDFA 4YJ3B 1OX5A 3L7CA 2Q5HA 3ZN2A 1J49A 1Q0ZA 1TW2A 2UYGA 3PFIA 3DE7X 4QSMA 4CMAA 1J2EA 1JB9A 421PA 1UF9A 4DCOA 4OY3A 4G84A 3GRUA 4EW6A 2OHGA 4ZVOA 4NPAA 9LDTA 2VDMB 3OZRA 4TV8A 5JZ9A 2DPYA 5A24A 2BCJQ 4R9SA 4R9RA 1WXIA 2XSZD 3E27A 1V26A 1BMQA 4L9RA 4OLJA 4OK3A 3PQ2A 5AKHA 2NVWA 2HU5A 4CKWA 6REQA 4R68A 4EHBA 2EL9A 1USGA 3OUZA 2J0UB 2PLRA 3LUCA 4CDMA 3L77A 3E15A 3IT1A 3GLFE 2Q3MA 3AH8A 1P0CA 2H16A 2V1XA 9ABPA 4N4AA 1QIMA 2ZRKA 5EHNA 2A5JA 4PONA 2ZE6A 3UB3A 2PUTA 1P2VA 1KIFA 4IX9A 1IOWA 1IY8A 2WM8A 3RFCA 4RETA 1E3TA 1NI3A 1QGUB 4HNVA 1E3SA 1CRWG 1VB5A 3QJGA 1JIQA 1PUXA 2C7VA 3SYTA 1WW2A 4ZJPA 2DERA 2ZXFA 1GN8A 5BP7A 3CUVA 3BDAA 2HW8A 2OXTA 1X8LA 2MMCA 4FWTA 2FRQA 3AEUB 3UCXA 2QTGA 3K5PA 5J3JA 3I0MA 2REOA 4PHGA 3PXXA 3TOCA 1U9XA 2R9MA 1JBEA 5K8CA 2FN8A 1W4CA 2D3TA 3SZUA 5CIYA 4X8MA 4DOMA 3VR6A 4EFDA 1WRBA 4OBEA 4N12A 4G0PA 2W6MA 4XIFA 4FIDA 4Q3BA 3FTPA 5AI5A 3GJZA 2BFDB 4UUMA 4ZOAA 3AF4A 4E4RA 3RWMB 3GLGA 1LZLA 1MX5A 2ONZA 4UMVA 1OSNA 4OGFA 4YAUA 2W70A 1VXRA 3U7RA 3EXHB 1H1LA 2AFIE 1G1AA 4A5OA 1C3VA 4QG7A 4RH1A 2NV2B 3IDAA 3WYCA 2D8MA 3OUUA 3QX7A 5HKKA 1KEVA 2VK4A 1RYZA 4BKPA 1VA5A 1US8B 1E1KA 3A04A 4QFBA 4S1WA 1IHXA 2HNKA 4YGXB 3U0BA 3UXEA 4E5VA 2IU4A 3VR4A 1XJ0A 2IODA 2KJQA 2YICA 4IGAA 1OH5A 1ZAYA 3TEJA 2NO1A 4YXWA 5L51A 1UZNA 1IL0A 2HMTA 3KOYA 3NP9A 5DNYB 1PX0A 4MDEA 4K9QA 5BY2A 1BHJA 1O94C 3PUVA 5BSMA 2RHOA 4PYNA 4CWAA 1AUXA 4M8IA 2YIMA 1FYFA 2EZ4A 2C9ZA 2BDTA 1ZMBA 1ZNWA 4DAEA 2WFAA 1I8TA 1GFSA 3OQNA 1C5KA 4ZC1A 5LL6P 4MS3A 3H89A 4HAXA 1M33A 1XZNA 3MILA 3OFVA 5JISA 2OYSA 1JU9A 3MRXA 3MHPA 4BN4A 2FR8C 4BEWA 5K0JA 2C5EA 2CXPA 5C8YF 2YDXA 2M32A 4JSRA 1AK2A 1TTHA 1LSOA 1U8XX 3HZHA 4JR1A 1GY8A 1Y3HA 4Y9SA 4YDHB 4DQXA 1QOQB 5KTNA 4I8IA 1PJBA 3LDUA 2VI5A 2JI9A 1CVLA 4M7PA 4M8NE 3SZMA 4LC0A 3GUHA 4HEA1 2ZR0A 5CXXA 4DCPA 4EG0A 5C7YA 2FWAA 3HCFA 3I5AA 4LBYA 1Z0DA 1Y4ZA 2GCNA 3TQFA 4RTOA 3ORYA 1QUEA 1YOBA 4WCVA 4D8WA 4Y9DA 1C8BA 1L8AA 3BB3A 4ZQFA 2AIMA 2HAEA 2PPLA 2DTEA 5AW0A 2YJNA 4QVIA 4W5BA 1J70A 3EQ2A 4YB8A 2C59A 1KWKA 2XYPA 1K8QA 3CMMA 3O21A 4JYCA 4W5TA 5EJGA 2EFGA 2MINB 2QTCA 4MROA 1MGPA 1V9LA 2R00A 3D4NA 3HVIA 4HF7A 4P93A 4MCIA 1UL1X 2AA3A 3AHEA 4RVDA 1A1VA 5CA1B 3LUGA 1UQRA 1QVVA 3AB8A 2X0RA 3C41J 3DS8A 3GMIA 4PU0A 2GRUA 3WWYA 3ELYA 2PGNA 1JQLB 4LOJA 2XTMA 1MBZA 4YUAA 5SY9A 3UV6A 1FSPA 1DEOA 3CNEA 1U8UA 3KZCA 4JBWA 1ESEA 2ZROA 3LK7A 3LO5A 3QVMA 4P2GA 2AD1A 2SICE 3PJGA 2PVSA 3D5QA 1NDQA 3DZDA 4CDNA 4DMCA 2B4RO 1DHTA 3WNQA 3DQPA 1SCNE 4XCXA 1AXRA 1TYCA 2NP7A 2JI6A 4ES6A 5DXAA 2BKEA 3X1ZA 1JLLA 3VM6A 1QVWA 5BV0A 4GI7A 1SQSA 2J87A 2VHTA 2PKQO 1PTJC 2YOGA 1JUDA 1UZUA 1A7KA 1BG6A 5DHPA 5KYYA 1EHYA 1Y8QB 5KJ6A 4INAA 2DFPA 3JPWA 3OZSA 4IUDS 2B8JA 4Q12A 2AUZA 2FZLA 2J9XB 1NUSA 2NU9A 4ZALA 4IBOA 4XKJA 3WLQA 1HLPA 1YKFA 4LHSA 5AJXA 4IVNA 1B0PA 1LD3A 1JRLA 4FYPA 2V8OA 2I1VB 4FYXA 1KMIY 1EX1A 1WPGA 1PT6A 4IQ4A 3SXJA 1P31A 5ICMA 3ASUA 4W1PA 4Z9FA 3J80A 1R0WA 3B7WA 2PUCA 1SBYA 1Y1RA 3B3GA 3GLHE 5CFQA 4C2TA 3REQA 2CSXA 1Y3AA 2GQ0A 3E9MA 1E1QA 1Z62A 4A8JB 1SCKA 2NQAA 4R41A 3PD7A 1MPTA 1QCCA 2C84A 5BWOA 1WWKA 3RTEA 2PH5A 3TTWA 1L5ZA 5KKNB 4P53A 4RL4A 4U0JA 5GPBA 2I3GA 3DMTA 2VTKA 1R0LA 4IF4A 1PT9A 2XRYA 4I6GA 4YONB 4ZVKA 2IV3A 3OPQA 5BV2P 1PNOA 1KGDA 1ZXLA 1PR0A 3GI1A 2QIOA 4ZDIA 3I01A 4HS4A 2JGNA 4YUWA 5CR9A 3DD5A 4YMUA 3AOEA 3SHVA 4H27A 3M5CA 4OXQA 3FVQA 1JJIA 2W6ID 4G0ZA 4XB6B 4DNFA 1JJAA 3FLAA 4OP2A 1T9AA 1IONA 2A9JA 3BMQB 3VVCA 4NYJQ 3ZDQA 4BS9A 1E9BA 5DSXA 3QKRB 3GZNB 3RC7A 1VG1A 4RNCA 3T1QA 4C6TB 1KYWA 3A4IA 4N3CA 5BV7A 2PYZA 3EUEA 4E2ZA 2ATOA 3PNBA 1K63A 4XDGA 3ELUA 4OQPA 3UA3A 1AZLA 1UCFA 3AXTA 1PW5A 2B94A 2EIXA 1QYIA 2NX2A 3KEGA 5F2OA 2IU6A 1HL3A 3IRUA 3VQTA 4B09A 4ZU3A 4DG8A 5L6LB 4G5GA 2C4MA 3EEOA 4EWLA 1QCZA 4GZ5A 4XVQA 2E1PA 4ND5A 1CU1A 4OKNA 1U5BA 4X1KB 4KXVA 4JNKA 2Q1UA 1QDUA 1UWVA 2WHYA 4O0MA 4UVGA 5EYPA 5LA6B 3V4SA 1LPSA 2OAQ1 1KGSA 3JR7A 1PSZA 4H6VA 2PMKA 4MYRA 1Q57A 1L5LA 3VH3A 3ZX5A 2R2GA 5FT9A 4EKYA 1POPA 5JRJA 1F06A 4V2IA 1RPTA 2DUWA 1X1AA 2ISSD 5SY4A 2ZJFA 3PHIA 4H4EA 5F1OA 1ATZA 1UJ5A 3K24A 4A1OA 1ZOOA 1U3TA 1EVEA 5SZHB 1NJ5A 3WIDA 4BATA 1POXA 2WLSA 1QVZA 4W8GA 1ME3A 2ETXA 3VHXB 5IBQA 1I6WA 4ZMRA 1ETHA 5ALSA 1TUBA 1TZCA 3E9DA 4BJ6A 3SJAA 4U2FA 4INJA 4B47A 2FW1A 4EA8A 2J9FA 1JTEA 5LJIA 3I34X 4GOND 1ZJJA 4XM2A 3TL2A 4QYIA 3WNBA 4LYHA 5JA7A 3K5HA 3WP0A 5I47A 3HXPA 1NBWB 2I03A 1SXGA 1E6CA 4HQ0A 3RVLA 3MW8A 3ANSA 1WW3A 1ZKDA 2ZAYA 3AWDA 4XWAA 1BMTA 4N7MA 4HWOA 1VYUA 2FPRA 4C7XA 4DVGA 3H3JA 5KNBA 4TMZA 5FUBA 3F8WA 4AB1A 5K09A 2BDLA 3LT1A 3JQRA 5E38A 1DIAA 2J6IA 3H17A 3Q6MA 4ID9A 3HDJA 1D1TA 1O5IA 1DDGA 1QZXA 2AH5A 3V7WA 5JDIA 2PZEA 3BTOA 1N2CE 2O2XA 2AN9A 2QVZX 2VJNA 3JWHA 4KQMA 3OX3A 4EMSA 5CD1A 4L8YA 3KXLA 1GL3A 5A05A 1CY6A 1KOLA 1L5VA 4XB2A 1QMGA 1ISFA 1J7KA 4NV3A 4TMKA 5ALDA 2UVPA 3CNQS 3I8OA 3DLCA 2GJ4A 3I9MA 4MWGA 4FOOA 3HE3A 3QITA 4M1MA 3DBRA 3AFOA 3H2SA 3OU7A 1PZEA 3T95A 3D7RA 2HD4A 4RGQA 3K6KA 4BO9A 3QVOA 1LA2A 1E61A 1XDWA 4K1LA 3JWIA 1JAIA 2G80A 3S1LA 4ECEA 3OHMA 2GPWA 5EMNA 4FLMA 3VJKA 4ASUD 2RBGA 3B3FA 2VJPA 1E20A 2A8YA 2Z08A 3JQ7B 3IYLW 4IWXA 1PL0A 4KIJA 5KDLA 4DT1A 5BWNA 5J2TB 1AJEA 4N8WA 1RBZA 3K9FC 1E59A 1G98A 3PUWA 4OKSA 5IKEA 1QPZA 3CX7A 1FTWA 2NV0A 4HB4A 4K86A 3IOMA 1ZUIA 2N1MA 2OP3A 1L4FA 2VOJA 1N6KA 3IELA 3QVKA 4JT8A 5GJWC 4ZVLA 3UWOA 2BFCB 2VSFA 1XX6A 4UFNA 2XOEA 5ALNA 2J9GA 5F9HA 2KSQA 2QN7A 4QODA 3ICWA 1BFUA 4KI0A 2VCYA 4K81B 1JEYB 3KSDO 1WU7A 3FYCA 3VC2A 1BXGA 1YC2A 4OH1A 4WUVA 2VRCA 4F5EA 5AW3A 1HV8A 3K2QA 1FRQA 5FPYA 3QI7A 1MD9A 2ZSJA 3DZ8A 2NW6A 1V16B 2XNCA 4RPGA 4G0NA 4LQCA 2VHFA 2XNDD 1O4VA 4M2LA 1B6TA 2Q3DA 1J9GA 1RRPA 2QZPA 4EKNB 1YB1A 2I62A 4EY8A 3SI7A 1UKZA 1I5RA 4LZJA 5B1EA 3S28A 2OK8A 5DASA 3EVTA 4JBIA 1V8ZA 2ZRGA 4NZMA 5DEOA 2BGRA 3DBHA 2XTAA 6ADHA 3WL7A 4OQDA 2XYQA 5FL3A 1T4MA 1T9GS 4BU1A 4CBVA 1R0XA 2I99A 1KEPA 3K6RA 4MW2A 2DC8A 4BP1A 2IHTA 2R87A 2FK8A 4X8LA 5REQB 2WOJA 4U1RA 2H2GA 4BFYA 4CV0A 4Z4QA 4DREA 2AW5A 4LYDA 3CY6A 4MH0R 1QF6A 4JOSA 2XA1A 2HSJA 3OCYA 3OX2A 4HS9A 3A11A 1ZK1A 3IUTA 4DQDA 3AEKA 2XTNA 1T4CA 3KJXA 1K7SN 4M1ZA 3ZDEA 3F2IA 1PJ4A 2OENG 4HZUA 1P9WA 3QI2A 5B6JA 2VBFA 4FIPA 1DT5A 5GQSA 1F2AA 4OV6B 2FUCA 1GXSB 2QROA 5KYGA 2D1YA 4DNPA 1UOQA 4V1CB 1A76A 1DI0A 4QRIA 3DT9A 1LPAB 1XFDA 1ZXXA 2PUDA 1HDZA 2HMSA 2W6IA 4GMKA 4OHMA 2VSXA 4TPKA 2QMOA 2ZZNA 1P60A 5FLXA 1D1QA 3H83A 4EHDA 2GK3A 2Z8ZA 1MT0A 3L18A 1QO9A 4OBBA 4AZVA 1UINA 5ER6A 4GL2A 4FJ1A 4E70A 4J2OA 1ZL2A 3N2ZB 5DU2A 5F52A 3RRYA 4PZAA 2QLLA 1IZ0A 1Y6ZA 3LDAA 5M7EA 1KI7A 1IN4A 3I1FA 4MWSA 2G5PA 3ZGLA 4ARBA 1A1SA 1KAOA 4U2DA 3UZUA 4D9FA 4R1LA 4AY2A 3NEYA 2D13A 1U6KA 4TZ0A 2JFQA 3B9RA 2H2DA 5T3UA 1NF3A 3A9UA 1E1LA 2RGGA 2WTBA 3L1HA 4XD7A 4C3VA 1U0HC 3NBYC 3DVLA 1E9CA 5A0TA 1DKNA 3CZ5A 4V3BA 1K98A 3DE1X 4BTLA 1K5HA 2HIHA 4BOPA 1W93A 4AULA 2BH9A 4N54A 1CIPA 1USVA 1AKTA 1NTRA 5TPZA 1M2VA 1YOVA 2H54A 2IEZA 2P6PA 4JJEA 4MRSA 5AHXA 5D8DA 4DLXA 4FYIA 1SO8A 3H2ZA 1PVOA 1QPBA 3JRNA 3CH5A 3OTHA 3P4YA 1L8XA 4CMHA 4B3TB 3VU9B 3L8GA 3P4XA 4TKVB 5I4KA 3V8VA 3HWWA 4OQQA 4NJOA 3QE2A 4N40A 4ZI7B 2FPLA 1SZPA 4DIBA 3ZK7A 3SDZA 3EY4A 1XVLA 3D64A 1A9OA 2FU5C 1TF7A 1Y1PA 3FDZA 2ZUBA 5G0UA 4R5HA 2C54A 3VSEA 4HAUA 5TPWB 3T54A 4YPVA 2EJWA 5E3JA 2D7CA 2HLHA 2RGEA 3GCWA 3I58A 5HJEA 1RC0A 1EUZA 1XRLA 1NY5A 2DH5A 3I2FA 3RHFA 5BR4A 1N5OX 3EXHC 3QEMB 2QP4A 2PSFA 5CHEA 1FJGB 1RAGA 1OXSC 3VHXA 2PH3A 1K5DA 1RKBA 3HO8A 5YASA 3WBBA 2YZMA 4EFNA 1ZN9A 5CA0F 2PQ6A 3VTAA 1FJXA 2R60A 2E21A 4JMPA 1U9WA 1HQCA 2GX6A 2IYQA 3BQNB 4H6XA 4BO4A 4RF4A 3ECSA 5HE9A 1JYEA 4AF8A 5JS6A 5DBGA 4EA7A 1FU4A 1F7UA 2FR0A 2ZSKA 4G89A 3BICA 3C7CB 1DEKA 2ECKA 1ESNA 3NHPA 4FFPA 4NBRA 4RPLA 4UOEA 4KQKA 1JI3A 1L8QA 2VP0A 2DF8A 4K0RA 4TVBA 3STUA 2BSQA 2RE8A 3L6CA 4CT4B 4MQEA 4I2NA 3W5IA 5JD5A 3EMKA 2FTDA 4CV2A 3ZWKA 4CM3A 4XR7A 2WTAA 3LMKA 3HJBA 4DWJA 4QYMA 4J0HA 2G25A 4GGMX 5CDTA 2I8CA 1R1DA 2JFYA 1TGVA 4RFLA 3GLVA 4RKEA 4PP1A 3TZLA 1HGXA 3OF5A 1XZCA 3HWX1 3O1GA 4DMKA 2WK1A 3L7LA 1ZD4A 4QOJA 4NAHA 1ZZGA 2QI9C 1AMOA 3R7BA 4Q4AB 4HWGA 2IXAA 2ROQA 2C9YA 1ORTA 1Z7EA 1XHFA 2DZZA 3NG1A 3QVGB 3DR3A 4OEHA 2GTPA 3A1NA 1PLJA 3K9NA 3PITA 3KKOA 1OYVA 4QPCA 3G5UA 3WSWA 4CPDA 4F45A 4Y6SA 4D4MA 5KMGB 4KREA 3FCEA 4LRQA 1M9NA 3NRJA 3RJTA 2ICAA 4DJ5X 3NHMA 4W4UA