3IFUA

The crystal structure of porcine reproductive and respiratory syndrome virus (prrsv) leader protease nsp1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
175
structure length
175
Chain Sequence
DRCTCTPNARVFVAEGQVYCTRCLSARSLLPLNLQVPELGVLGLFYRPEEPLRWTLPRAFPTVECSPAGACWLSAIFPIARMTSGNLNFQQRMVRVAAEIYRAGQLTPTVLKTLQVYERGCRWYPIVGPVPGVGVYANSLHVSDKPFPGATHVLTNLPLPQRPKPEDFCPFECAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-structural protein
publication title Crystal structure of porcine reproductive and respiratory syndrome virus leader protease Nsp1alpha
pubmed doi rcsb
source organism Porcine reproductive and respiratory syndrome virus
molecule tags Transcription
total genus 37
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2009-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05410 Peptidase_C31 Porcine arterivirus-type cysteine proteinase alpha
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.250 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ifuA01
3.90.70.60 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3ifuA02
3IFUA
chains in the Genus database with same CATH superfamily
3ERVA 2PREA 2XU1A 3Q87A 4BQVA 3IOQA 3LFYA 2LEXA 4QTTA 1SIWA 2DJFB 1QMYA 3MORA 5CHVA 1KRLA 3F3FC 1Q811 1Q822 3MONA 2Y0SA 2OTL1 3CMA1 1I3QI 2PM9A 3CPWY 3CC2Z 4QRXA 1M901 3C0RA 2PMZA 1PVJA 2I3CA 1YHQZ 1ZCMA 2DC9A 4Y52I 3BBAA 8PCHA 1KQSZ 3HOWI 2P3YA 3CC4Z 1YVBA 3G4S1 4QH6A 5IP9I 1MEMA 2HXZA 1M1K1 4MH4A 3PNRA 4YVAA 4I07A 3BPMA 2R93I 1FH0A 4HWYA 1F2BA 4DMYA 1TWCI 2LFUA 3I56Z 1WIIA 1YJW1 1F2CA 1MS6A 2QRDB 3OW2Z 1STFE 5A2Qb 3PRMA 2W03A 2VPWA 3G71Z 1TLOA 4XX2A 4HXDB 2JIQA 1NB3A 2DE7A 3W31A 2JA5I 2R6NA 3BCNA 4PI3A 1YZBA 4X6JA 1EWLA 2JNYA 4PP1A 4BY7I 4CZWA 3KFQA 1FDIA 1PPNA 4K7CA 2K5RA 1W2BZ 2WB1A 3CCLZ 1EWPA 1RO4A 4E30A 4N8WA 4YYRA 4EWCA 2OTLZ 1Y8CA 3CXCZ 4CL1A 2IPPB 1USPB 1LQLA 3PBHA 3KKUA 1ATKA 2YJ9A 4N4ZA 5CM2M 5JZEA 3U8EA 3S3RA 2NAPA 3CCU1 4W4UA 3G4SZ 3IFUA 1WJ2A 4CDEB 5FLXb 1QOLA 1VQP1 5CVOB 2DC7A 2BDLA 3D6SA 3HHAA 3I4MI 1CVZA 2BTWA 4CDDB 3S2HI 2VPYA 1NL6A 3IUTA 1QDQA 2JMOA 3CCSZ 4NBFA 2Q51A 1ME3A 3I3TA 3GTJI 3F75A 1SP4B 3PHWA 4HH4A 5T6BA 4OVZA 3PW3A 1IWDA 1U9QX 4MD7A 2PBHA 3J81b 2NQAA 3P5VA 3S1RI 3K9MA 2OTJ1 3GTKI 1M6DA 3D2LA 1BQIA 2AYDA 2R9CA 2IZ3A 1VQKZ 4RKXA 3BC3A 4A3JI 4BOPA 3TMPA 3HD3A 1VQL1 3IMAA 2V8JA 2XU4A 3BOWA 1N8R2 3CCUZ 1VQO1 3GTOI 4NBGA 1VQPZ 3GTGI 3GTPI 3CH2X 3MZLB 1X0TA 1Q861 5KO3A 3D6WA 1AU3A 4WA6A 1BP4A 1YK8A 4WURA 2YU9I 4P6EA 5T67A 3NH5A 2NVQI 4Q8HA 2VHFA 3EERA 4NBCA 4BY1I 3H3VJ 4A3LI 2AUZA 4REZA 3RNVA 3PO2I 1S4VA 1CV8A 2IV2X 2NQDB 1KC82 2QEXZ 1JQPA 2FTDA 4MI7A 1NB5A 1YITZ 1WW9A 2DJGB 1P9NA 2R6MA 1F29A 4RVHA 3HHIA 2DCAA 1X3ZA 4RV9A 1CQDA 1YJNZ 2AU1A 2PADA 2Y6EA 2OOXB 3CC71 4D8BA 1YJ91 1ZB9A 1KXRA 1QVGZ 3CCR1 3H0GI 1Q7Y2 1QYPA 1K9M1 3I551 3LXSA 4D8EA 1VQ81 1YI21 1VQ9Z 3GTLI 3BPFA 3K24A 2QREB 4YV8A 2HD5A 4RNAA 3CCQ1 3TDHB 2J6AA 3CMEZ 4ZTBA 3QJ3A 4W5BA 4XZXA 3VMHA 2FRQA 1KFUL 5IP7I 1VQOZ 3BY4A 3HOUI 3MHSA 2YADA 1AIMA 3IV2A 4NBBA 2BTWB 2YJ2A 4MZOA 2QLVB 2QA41 2RIQA 4DQYB 3CCVZ 1VQN1 4E2WA 2FQ9A 1K8A1 3OVXA 4BSQA 3S3QA 4OELA 3WXGA 4QRGA 4OVZB 3D9XA 1KD11 3VB9A 2DC6A 3JAMf 4E2YA 2E2JI 2HU9A 3RVWA 2DE6A 2ARYA 4GUAA 3CC7Z 2HH5A 4A3DI 1XKGA 2F1GA 3H7DA 2P7UA 3ESWA 3I55Z 2DZZA 3RZDI 1AECA 3J80f 1PFTA 2G6DA 1JJ2Z 3S15I 2FYEA 1VQ71 1K731 3CCQZ 1NUIA 2XU5A 3OISA 2AVWA 2QR1B 2DCDA 4S1TA 2WAQA 3I06A 1SNKA 1KQSY 1VJVA 3H6SA 2HF1A 3IEJA 1Q812 3M3YI 1Q6KA 3MHHA 2P28A 3I4NI 2QA4Z 1CPJA 1U9VA 1VQNZ 1YK7A 4X6HA 1CJLA 3WXEA 1YUKA 1M902 4X6AI 1DKIA 2JUBA 3NFZA 2R9FA 3AI8A 2JA7I 5FPWA 9PAPA 1X9YA 2XU3A 2NVYI 3FQMA 2C0YA 3ZNHA 2H85A 3B21A 1M1K2 3CMAZ 5C4XI 2B63I 2Q4ZA 4A3MI 1X3WA 1CB5A 1PBHA 3O65A 1TWAI 1PPPA 3CBJA 3BB7A 2W04A 3HKZA 3VTNA 3OQCA 2BU3A 1VQ41 3TRKA 4NOZA 3QSDA 1QVFZ 4OW0A 5JH3A 1VQM1 1R9TI 3KWBX 2YJCA 3N4CA 5C44I 2HHNA 2JIMA 2QKDA 1DF0A 2IZ4A 1W2BY 1VQ7Z 2M48A 2R9OA 2JS4A 1THEA 2V3VA 5AN9F 1YJWZ 2CIOA 3H89A 1NP6A 3S17I 1AU4A 2E01A 3BG1B 5IT9f 1GECE 3KSEA 3VMIA 5T64A 3M4OI 2FT2A 5F02A 2E7ZA 5CHTA 1L1OC 1AYUA 1N2FA 3CCE1 4E2XA 3E9SA 1Q16A 3CCJ1 5J94A 3M99A 2JIPA 4BXXI 1GCBA 3CBKA 3NH8A 1RO0A 2IBIA 4BS6A 1DL6A 1ME4A 3K8UA 2OOYB 2GU2A 4BBRI 1VQ4Z 3IHPA 5LL6f 2NVXI 4RF0A 1EF7A 5PADA 3F3PC 4RVDA 2BDZA 4I05A 5C4JI 1A6RA 1QF8A 1Z02A 4A3II 4MRIA 3PO3S 3B79A 4RY2A 2OP3A 3KIHA 3USVA 4MD9A 1ZH1A 1NJI1 1EWOA 4PT5A 2JRIA 4RVGA 5CVNB 4MONA 2K3RA 1YUAA 3NDJA 4Y7NI 1S721 3S1MI 1AU2A 1PPOA 3H8CA 1AU0A 4CDCB 1ZIVA 1U5IA 5D1OA 2E02A 1F2AA 3W30A 4M0WA 1ZB8A 3PRPA 2E00A 4KLBA 2J7QC 2OTJZ 2H7JA 5A2Qf 1POPA 2B1MA 5EF4A 3MTVA 3CCJZ 2AKLA 1NLJA 3HOXI 1CSBB 3IX0A 4RF1A 1Q862 1VQLZ 2GHUA 4CDFB 4NB8A 1YIJ1 1Z01A 2FRAA 2VHSA 3S2DI 4DK1A 2V8IA 2JTCA 3I07A 1VQ61 2GTIA 2E2II 3P5WA 1QVGY 4I04A 4PP2E 3PO3I 2GFOA 5EGWA 3GTQI 3CC41 1PADA 1Q821 4E33A 1S7MA 4A3FI 1MIRA 4NB9A 5FLXf 4DGLA 2AGAA 2E03A 5JA7A 3IR7A 3S16I 4IUMA 3CD61 4A5UA 3GCFA 5IT9b 1Y08A 4DMXA 1VQ51 4TNUA 1K9M2 4A93I 4XUIA 2NQGA 3I561 2NVTI 5A24A 2JQFR 1EWMA 3PDFA 4MXUA 2VUGA 3P5JB 2F4MA 3CPWZ 1YJ9Z 3V6CA 1VLAA 4HGZA 3KIFA 3CCRZ 1AA6A 4NBHA 3P5XA 3HOZI 4E31A 3FKII 5CVMA 4XR7A 1VQ8Z 1YI2Z 3OVZA 3GKQA 3MP2A 3J81f 4AXLA 3FQQA 1I6HI 4FJCA 2LIYA 1YIJZ 3C9EA 1VSNA 3E1ZB 4W5CA 1CTEA 1Y1VS 3RZOI 1AYWA 3CCL1 2JA6I 1JWHC 1K8A2 4Q8GA 1U9XA 4MZSA 3KX1A 2G8EA 1VQ6Z 4A3CI 1ITOA 1AYVA 4NBEA 4E32A 1Z03A 1KD12 4BBSI 1ML8A 3CQZI 1Y4HA 3PHUA 2E2HI 4N79A 3WXFA 1KFXL 1RNIA 4NBDA 1SFOI 3T4NB 3CCM1 2G2KA 1JJ2Y 3KW9A 3KWZA 5EZSA 3CD6Z 2Z84A 2KI7B 4NH1C 2FO5A 1WCMI 2F4OA 1DEUA 3F5VA 3O1GA 3TE5B 2NQIA 2Y5BA 4E2ZA 1GLOA 5D1OB 1VQ5Z 3OW2Y 3V6EA 2P86A 4YYWA 1TU6A 3CCS1 2JA8I 2RBLA 2YJ8A 1K732 1BGOA 1MEGA 4FK5A 1PIPA 2WBFX 3G6E1 3H8BA 4BOQA 4ZUXU 2M6NA 4A3GI 3S1NI 2OULA 2EGTA 3CH3X 1U9WA 1K83I 2B1NA 1RLYA 4BPVA 4D8IA 3BWKA 1Y1VI 2O53A 3TNXA 3CXCY 2AIMA 2FE8A 3NHEA 3OF9A 5D1PA 3DF0A 4X6IA 4MD8A 4MSXA 3MJ5A 2QRCB 4NBAA 2G7YA 1VQK1 1MDWA 4G54A 4AXMA 1PE6A 1PCIA 3QT4A 1QVFY 2GTHA 1WZNA 2RT9A 1TWHI 4MM3B 2OZKA 3BG0B 1O0EA 2ATOA 3CCMZ 4FIPA 2ACTA 2P0RA 3NDIA 2VPZA 2E9HA 3O0UA 5C3EI 1TWGI 1N8R1 3IF8A 1I50I 3JAMb 1BY8A 1MHWA 3GTMS 2JIOA 3K7AI 2V45A 2DZYA 3N3KA 3G6EZ 3S14I 4BOSA 4HGYA 4A3BI 1VQMZ 2QEX1 2UZJA 2G8JA 2CB5A 4BOZA 2O4HA 5EZQA 1TWFI 4YYVA 1YIT1 2PK7A 3HOVI 2AYOA 3J80b 4RS4A 3NH4A 7PCKA 1YJN1 1RO2A 4QTUA 3N3GA 4YYUA 5K16A 1KC81 4NFRA 3PHXA 2YJBA 4YYSA 1FDOA 3VMGA 3U50C 2VUMI 2AYNA 1VQ91 4PADA 1GMYA 3ZUAA 2RHBA 2VF1A 3EEDA 3CME1 2DE5A 2JQGR 1RQFA 2JR6A 1YALA 4A3KI 2DC8A 2R92I 2J7QA 1Q7Y1 1TL9A 1UKFA 5E6JA 5FLMI 3CCEZ 4R3DA 4YYQA 3OF8A 2KPIA 2RPRA 3J7A4 1ICFA 2V8KA 1KHQA 1KHPA 3RVVA 3GTMI 2AUXA 3PT2A 3CCV1 3RVXA 4P6GA 6PADA 3HOYI 3QWUA 2R7ZI 1NQCA 2DCBA 4RVFA 2HWKA 3LUSA 2JIRA 1NJI2 3CC21 1QXPA 2DCCA 4BS5A 1NPZA 1USPA 4AYBA 4A3EI 1YHQ1 1CS8A 3PSEA 3GCBA 1TFIA 2F7DA 3MZKB 1QXFA 2O6XA 2BJOA 1YT7A 2OZ2A 3P5UA 4QRVA 2PNSA 3HWNA 1PPDA 1S72Z 2R9MA 2DOSA 2VPXA 2R9NA 1Y1WI 3MTNA 4P16A 2ZAEB 1HUCB 2AS8A 3S1QI 1PXVA 2FUDA 4BOUA 4QBBA 1K3BB 3G711 4IP3A 4OEMA
chains in the Genus database with same CATH topology
3Q87A 4QTTA 1KRLA 3F3FC 1Q811 1Q822 3MONA 2Y0SA 2OTL1 3CMA1 1I3QI 2PM9A 3CPWY 3CC2Z 1M901 3C0RA 2PMZA 1PVJA 2I3CA 1YHQZ 3BBAA 4Y52I 1KQSZ 3HOWI 2P3YA 3CC4Z 3G4S1 5IP9I 1M1K1 4MH4A 2R93I 1TWCI 2LFUA 3I56Z 1WIIA 1YJW1 2QRDB 3OW2Z 5A2Qb 3PRMA 2W03A 3G71Z 4XX2A 4HXDB 2DE7A 3W31A 2JA5I 1YZBA 2JNYA 4BY7I 2K5RA 1W2BZ 2WB1A 3CCLZ 1RO4A 4E30A 4EWCA 2OTLZ 3CXCZ 4CL1A 1USPB 1LQLA 5CM2M 5JZEA 3CCU1 3G4SZ 3IFUA 5FLXb 1VQP1 3I4MI 2BTWA 3S2HI 2JMOA 3CCSZ 4NBFA 2Q51A 3GTJI 3PHWA 4HH4A 5T6BA 4OVZA 4MD7A 3J81b 3S1RI 2OTJ1 3GTKI 2IZ3A 1VQKZ 4RKXA 4A3JI 4BOPA 3TMPA 1VQL1 2V8JA 1N8R2 3CCUZ 1VQO1 3GTOI 4NBGA 1VQPZ 3GTGI 3GTPI 5KO3A 3MZLB 1X0TA 1Q861 3D6WA 4WURA 2YU9I 5T67A 3NH5A 2NVQI 3EERA 4NBCA 4BY1I 3H3VJ 4A3LI 4REZA 3RNVA 3PO2I 1KC82 2QEXZ 4MI7A 1YITZ 1WW9A 1P9NA 2R6MA 4RVHA 1X3ZA 4RV9A 4D8BA 1YJNZ 2OOXB 3CC71 1YJ91 1ZB9A 1QVGZ 3CCR1 3H0GI 1Q7Y2 1QYPA 1K9M1 3I551 4D8EA 1VQ81 1YI21 1VQ9Z 3GTLI 2QREB 4RNAA 3CCQ1 3TDHB 2J6AA 3CMEZ 4ZTBA 4XZXA 3VMHA 5IP7I 1VQOZ 3BY4A 3HOUI 2YADA 4NBBA 2BTWB 2QLVB 2QA41 2RIQA 4DQYB 3CCVZ 1VQN1 4E2WA 1K8A1 4OVZB 3D9XA 1KD11 3VB9A 3JAMf 4E2YA 2E2JI 2HU9A 2DE6A 4GUAA 3CC7Z 4A3DI 3ESWA 3I55Z 3RZDI 3J80f 1PFTA 1JJ2Z 3S15I 1VQ71 1K731 3CCQZ 1NUIA 2QR1B 4S1TA 2WAQA 1KQSY 2HF1A 1Q812 3M3YI 2P28A 3I4NI 2QA4Z 1VQNZ 1YUKA 1M902 4X6AI 1DKIA 2JUBA 3NFZA 2JA7I 2NVYI 3FQMA 3ZNHA 2H85A 3B21A 1M1K2 3CMAZ 5C4XI 2B63I 2Q4ZA 4A3MI 1X3WA 3O65A 1TWAI 3BB7A 2W04A 3HKZA 3VTNA 3OQCA 2BU3A 1VQ41 3TRKA 4NOZA 4OW0A 1QVFZ 1VQM1 1R9TI 5C44I 2QKDA 2IZ4A 1W2BY 1VQ7Z 2M48A 2JS4A 5AN9F 1YJWZ 1NP6A 3S17I 3BG1B 5IT9f 3VMIA 5T64A 3M4OI 1L1OC 1N2FA 3CCE1 4E2XA 3E9SA 3CCJ1 4BXXI 3NH8A 1RO0A 1DL6A 2OOYB 2GU2A 4BBRI 1VQ4Z 5LL6f 2NVXI 4RF0A 3F3PC 4RVDA 5C4JI 1QF8A 1Z02A 4A3II 4MRIA 3PO3S 3KIHA 4MD9A 1ZH1A 1NJI1 4PT5A 2JRIA 4RVGA 4MONA 2K3RA 1YUAA 3NDJA 4Y7NI 1S721 3S1MI 5D1OA 3W30A 4M0WA 1ZB8A 3PRPA 2J7QC 2OTJZ 5A2Qf 3MTVA 3CCJZ 2AKLA 3HOXI 3IX0A 4RF1A 1Q862 1VQLZ 4NB8A 1YIJ1 1Z01A 3S2DI 4DK1A 2V8IA 2JTCA 3I07A 1VQ61 2GTIA 2E2II 1QVGY 3PO3I 3GTQI 3CC41 1Q821 4E33A 1S7MA 4A3FI 2AGAA 4NB9A 5FLXf 4DGLA 3S16I 4IUMA 3CD61 4A5UA 3GCFA 5IT9b 1VQ51 4TNUA 1K9M2 4A93I 3I561 2NVTI 4MXUA 2VUGA 3P5JB 2F4MA 3CPWZ 1YJ9Z 1VLAA 4HGZA 3KIFA 3CCRZ 4NBHA 3HOZI 4E31A 3FKII 1VQ8Z 1YI2Z 3GKQA 3MP2A 3J81f 3FQQA 1I6HI 2LIYA 1YIJZ 1Y1VS 3RZOI 3CCL1 2JA6I 1JWHC 1K8A2 1VQ6Z 4A3CI 4NBEA 4E32A 1Z03A 1KD12 4BBSI 1ML8A 3CQZI 3PHUA 2E2HI 1RNIA 4NBDA 1SFOI 3T4NB 3CCM1 2G2KA 1JJ2Y 5EZSA 3CD6Z 2Z84A 2KI7B 4NH1C 1WCMI 2F4OA 3TE5B 4E2ZA 5D1OB 1VQ5Z 3OW2Y 3CCS1 2JA8I 2RBLA 1K732 4BOQA 3G6E1 2M6NA 4A3GI 3S1NI 2EGTA 1K83I 1RLYA 4D8IA 1Y1VI 2O53A 3CXCY 2FE8A 5D1PA 4MD8A 3MJ5A 2QRCB 4NBAA 1VQK1 1QVFY 2GTHA 2RT9A 1TWHI 4MM3B 2OZKA 3BG0B 3CCMZ 3NDIA 2E9HA 5C3EI 1TWGI 1N8R1 3IF8A 1I50I 3JAMb 3GTMS 3K7AI 3G6EZ 3S14I 4BOSA 4HGYA 4A3BI 1VQMZ 2QEX1 2UZJA 4BOZA 2O4HA 5EZQA 1TWFI 1YIT1 2PK7A 3HOVI 3J80b 4RS4A 3NH4A 1YJN1 1RO2A 4QTUA 1KC81 4NFRA 3PHXA 3VMGA 2VUMI 3U50C 1VQ91 2RHBA 2VF1A 3EEDA 3CME1 2DE5A 2JR6A 1RQFA 2J7QA 4A3KI 2R92I 1Q7Y1 1UKFA 5E6JA 5FLMI 3CCEZ 4R3DA 2KPIA 2RPRA 3J7A4 2V8KA 3GTMI 3PT2A 3CCV1 3HOYI 3QWUA 2R7ZI 4RVFA 2HWKA 3LUSA 1NJI2 3CC21 1USPA 4AYBA 4A3EI 1YHQ1 3PSEA 1TFIA 3MZKB 2BJOA 1S72Z 2DOSA 4P16A 1Y1WI 2ZAEB 3S1QI 4BOUA 3G711 4IP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IFU A; 
#chains in the Genus database with same CATH topology
 3ERV A;  2PRE A;  2XU1 A;  3Q87 A;  4BQV A;  3IOQ A;  3LFY A;  2LEX A;  4QTT A;  1SIW A;  2DJF B;  1QMY A;  3MOR A;  5CHV A;  1KRL A;  3F3F C;  1Q81 1;  1Q82 2;  3MON A;  2Y0S A;  2OTL 1;  3CMA 1;  1I3Q I;  2PM9 A;  3CPW Y;  3CC2 Z;  4QRX A;  1M90 1;  3C0R A;  2PMZ A;  1PVJ A;  2I3C A;  1YHQ Z;  1ZCM A;  2DC9 A;  4Y52 I;  3BBA A;  8PCH A;  1KQS Z;  3HOW I;  2P3Y A;  3CC4 Z;  1YVB A;  3G4S 1;  4QH6 A;  5IP9 I;  1MEM A;  2HXZ A;  1M1K 1;  4MH4 A;  3PNR A;  4YVA A;  4I07 A;  3BPM A;  2R93 I;  1FH0 A;  4HWY A;  1F2B A;  4DMY A;  1TWC I;  2LFU A;  3I56 Z;  1WII A;  1YJW 1;  1F2C A;  1MS6 A;  2QRD B;  3OW2 Z;  1STF E;  5A2Q b;  3PRM A;  2W03 A;  2VPW A;  3G71 Z;  1TLO A;  4XX2 A;  4HXD B;  2JIQ A;  1NB3 A;  2DE7 A;  3W31 A;  2JA5 I;  2R6N A;  3BCN A;  4PI3 A;  1YZB A;  4X6J A;  1EWL A;  2JNY A;  4PP1 A;  4BY7 I;  4CZW A;  3KFQ A;  1FDI A;  1PPN A;  4K7C A;  2K5R A;  1W2B Z;  2WB1 A;  3CCL Z;  1EWP A;  1RO4 A;  4E30 A;  4N8W A;  4YYR A;  4EWC A;  2OTL Z;  1Y8C A;  3CXC Z;  4CL1 A;  2IPP B;  1USP B;  1LQL A;  3PBH A;  3KKU A;  1ATK A;  2YJ9 A;  4N4Z A;  5CM2 M;  5JZE A;  3U8E A;  3S3R A;  2NAP A;  3CCU 1;  4W4U A;  3G4S Z;  3IFU A;  1WJ2 A;  4CDE B;  5FLX b;  1QOL A;  1VQP 1;  5CVO B;  2DC7 A;  2BDL A;  3D6S A;  3HHA A;  3I4M I;  1CVZ A;  2BTW A;  4CDD B;  3S2H I;  2VPY A;  1NL6 A;  3IUT A;  1QDQ A;  2JMO A;  3CCS Z;  4NBF A;  2Q51 A;  1ME3 A;  3I3T A;  3GTJ I;  3F75 A;  1SP4 B;  3PHW A;  4HH4 A;  5T6B A;  4OVZ A;  3PW3 A;  1IWD A;  1U9Q X;  4MD7 A;  2PBH A;  3J81 b;  2NQA A;  3P5V A;  3S1R I;  3K9M A;  2OTJ 1;  3GTK I;  1M6D A;  3D2L A;  1BQI A;  2AYD A;  2R9C A;  2IZ3 A;  1VQK Z;  4RKX A;  3BC3 A;  4A3J I;  4BOP A;  3TMP A;  3HD3 A;  1VQL 1;  3IMA A;  2V8J A;  2XU4 A;  3BOW A;  1N8R 2;  3CCU Z;  1VQO 1;  3GTO I;  4NBG A;  1VQP Z;  3GTG I;  3GTP I;  3CH2 X;  3MZL B;  1X0T A;  1Q86 1;  5KO3 A;  3D6W A;  1AU3 A;  4WA6 A;  1BP4 A;  1YK8 A;  4WUR A;  2YU9 I;  4P6E A;  5T67 A;  3NH5 A;  2NVQ I;  4Q8H A;  2VHF A;  3EER A;  4NBC A;  4BY1 I;  3H3V J;  4A3L I;  2AUZ A;  4REZ A;  3RNV A;  3PO2 I;  1S4V A;  1CV8 A;  2IV2 X;  2NQD B;  1KC8 2;  2QEX Z;  1JQP A;  2FTD A;  4MI7 A;  1NB5 A;  1YIT Z;  1WW9 A;  2DJG B;  1P9N A;  2R6M A;  1F29 A;  4RVH A;  3HHI A;  2DCA A;  1X3Z A;  4RV9 A;  1CQD A;  1YJN Z;  2AU1 A;  2PAD A;  2Y6E A;  2OOX B;  3CC7 1;  4D8B A;  1YJ9 1;  1ZB9 A;  1KXR A;  1QVG Z;  3CCR 1;  3H0G I;  1Q7Y 2;  1QYP A;  1K9M 1;  3I55 1;  3LXS A;  4D8E A;  1VQ8 1;  1YI2 1;  1VQ9 Z;  3GTL I;  3BPF A;  3K24 A;  2QRE B;  4YV8 A;  2HD5 A;  4RNA A;  3CCQ 1;  3TDH B;  2J6A A;  3CME Z;  4ZTB A;  3QJ3 A;  4W5B A;  4XZX A;  3VMH A;  2FRQ A;  1KFU L;  5IP7 I;  1VQO Z;  3BY4 A;  3HOU I;  3MHS A;  2YAD A;  1AIM A;  3IV2 A;  4NBB A;  2BTW B;  2YJ2 A;  4MZO A;  2QLV B;  2QA4 1;  2RIQ A;  4DQY B;  3CCV Z;  1VQN 1;  4E2W A;  2FQ9 A;  1K8A 1;  3OVX A;  4BSQ A;  3S3Q A;  4OEL A;  3WXG A;  4QRG A;  4OVZ B;  3D9X A;  1KD1 1;  3VB9 A;  2DC6 A;  3JAM f;  4E2Y A;  2E2J I;  2HU9 A;  3RVW A;  2DE6 A;  2ARY A;  4GUA A;  3CC7 Z;  2HH5 A;  4A3D I;  1XKG A;  2F1G A;  3H7D A;  2P7U A;  3ESW A;  3I55 Z;  2DZZ A;  3RZD I;  1AEC A;  3J80 f;  1PFT A;  2G6D A;  1JJ2 Z;  3S15 I;  2FYE A;  1VQ7 1;  1K73 1;  3CCQ Z;  1NUI A;  2XU5 A;  3OIS A;  2AVW A;  2QR1 B;  2DCD A;  4S1T A;  2WAQ A;  3I06 A;  1SNK A;  1KQS Y;  1VJV A;  3H6S A;  2HF1 A;  3IEJ A;  1Q81 2;  3M3Y I;  1Q6K A;  3MHH A;  2P28 A;  3I4N I;  2QA4 Z;  1CPJ A;  1U9V A;  1VQN Z;  1YK7 A;  4X6H A;  1CJL A;  3WXE A;  1YUK A;  1M90 2;  4X6A I;  1DKI A;  2JUB A;  3NFZ A;  2R9F A;  3AI8 A;  2JA7 I;  5FPW A;  9PAP A;  1X9Y A;  2XU3 A;  2NVY I;  3FQM A;  2C0Y A;  3ZNH A;  2H85 A;  3B21 A;  1M1K 2;  3CMA Z;  5C4X I;  2B63 I;  2Q4Z A;  4A3M I;  1X3W A;  1CB5 A;  1PBH A;  3O65 A;  1TWA I;  1PPP A;  3CBJ A;  3BB7 A;  2W04 A;  3HKZ A;  3VTN A;  3OQC A;  2BU3 A;  1VQ4 1;  3TRK A;  4NOZ A;  3QSD A;  1QVF Z;  4OW0 A;  5JH3 A;  1VQM 1;  1R9T I;  3KWB X;  2YJC A;  3N4C A;  5C44 I;  2HHN A;  2JIM A;  2QKD A;  1DF0 A;  2IZ4 A;  1W2B Y;  1VQ7 Z;  2M48 A;  2R9O A;  2JS4 A;  1THE A;  2V3V A;  5AN9 F;  1YJW Z;  2CIO A;  3H89 A;  1NP6 A;  3S17 I;  1AU4 A;  2E01 A;  3BG1 B;  5IT9 f;  1GEC E;  3KSE A;  3VMI A;  5T64 A;  3M4O I;  2FT2 A;  5F02 A;  2E7Z A;  5CHT A;  1L1O C;  1AYU A;  1N2F A;  3CCE 1;  4E2X A;  3E9S A;  1Q16 A;  3CCJ 1;  5J94 A;  3M99 A;  2JIP A;  4BXX I;  1GCB A;  3CBK A;  3NH8 A;  1RO0 A;  2IBI A;  4BS6 A;  1DL6 A;  1ME4 A;  3K8U A;  2OOY B;  2GU2 A;  4BBR I;  1VQ4 Z;  3IHP A;  5LL6 f;  2NVX I;  4RF0 A;  1EF7 A;  5PAD A;  3F3P C;  4RVD A;  2BDZ A;  4I05 A;  5C4J I;  1A6R A;  1QF8 A;  1Z02 A;  4A3I I;  4MRI A;  3PO3 S;  3B79 A;  4RY2 A;  2OP3 A;  3KIH A;  3USV A;  4MD9 A;  1ZH1 A;  1NJI 1;  1EWO A;  4PT5 A;  2JRI A;  4RVG A;  5CVN B;  4MON A;  2K3R A;  1YUA A;  3NDJ A;  4Y7N I;  1S72 1;  3S1M I;  1AU2 A;  1PPO A;  3H8C A;  1AU0 A;  4CDC B;  1ZIV A;  1U5I A;  5D1O A;  2E02 A;  1F2A A;  3W30 A;  4M0W A;  1ZB8 A;  3PRP A;  2E00 A;  4KLB A;  2J7Q C;  2OTJ Z;  2H7J A;  5A2Q f;  1POP A;  2B1M A;  5EF4 A;  3MTV A;  3CCJ Z;  2AKL A;  1NLJ A;  3HOX I;  1CSB B;  3IX0 A;  4RF1 A;  1Q86 2;  1VQL Z;  2GHU A;  4CDF B;  4NB8 A;  1YIJ 1;  1Z01 A;  2FRA A;  2VHS A;  3S2D I;  4DK1 A;  2V8I A;  2JTC A;  3I07 A;  1VQ6 1;  2GTI A;  2E2I I;  3P5W A;  1QVG Y;  4I04 A;  4PP2 E;  3PO3 I;  2GFO A;  5EGW A;  3GTQ I;  3CC4 1;  1PAD A;  1Q82 1;  4E33 A;  1S7M A;  4A3F I;  1MIR A;  4NB9 A;  5FLX f;  4DGL A;  2AGA A;  2E03 A;  5JA7 A;  3IR7 A;  3S16 I;  4IUM A;  3CD6 1;  4A5U A;  3GCF A;  5IT9 b;  1Y08 A;  4DMX A;  1VQ5 1;  4TNU A;  1K9M 2;  4A93 I;  4XUI A;  2NQG A;  3I56 1;  2NVT I;  5A24 A;  2JQF R;  1EWM A;  3PDF A;  4MXU A;  2VUG A;  3P5J B;  2F4M A;  3CPW Z;  1YJ9 Z;  3V6C A;  1VLA A;  4HGZ A;  3KIF A;  3CCR Z;  1AA6 A;  4NBH A;  3P5X A;  3HOZ I;  4E31 A;  3FKI I;  5CVM A;  4XR7 A;  1VQ8 Z;  1YI2 Z;  3OVZ A;  3GKQ A;  3MP2 A;  3J81 f;  4AXL A;  3FQQ A;  1I6H I;  4FJC A;  2LIY A;  1YIJ Z;  3C9E A;  1VSN A;  3E1Z B;  4W5C A;  1CTE A;  1Y1V S;  3RZO I;  1AYW A;  3CCL 1;  2JA6 I;  1JWH C;  1K8A 2;  4Q8G A;  1U9X A;  4MZS A;  3KX1 A;  2G8E A;  1VQ6 Z;  4A3C I;  1ITO A;  1AYV A;  4NBE A;  4E32 A;  1Z03 A;  1KD1 2;  4BBS I;  1ML8 A;  3CQZ I;  1Y4H A;  3PHU A;  2E2H I;  4N79 A;  3WXF A;  1KFX L;  1RNI A;  4NBD A;  1SFO I;  3T4N B;  3CCM 1;  2G2K A;  1JJ2 Y;  3KW9 A;  3KWZ A;  5EZS A;  3CD6 Z;  2Z84 A;  2KI7 B;  4NH1 C;  2FO5 A;  1WCM I;  2F4O A;  1DEU A;  3F5V A;  3O1G A;  3TE5 B;  2NQI A;  2Y5B A;  4E2Z A;  1GLO A;  5D1O B;  1VQ5 Z;  3OW2 Y;  3V6E A;  2P86 A;  4YYW A;  1TU6 A;  3CCS 1;  2JA8 I;  2RBL A;  2YJ8 A;  1K73 2;  1BGO A;  1MEG A;  4FK5 A;  1PIP A;  2WBF X;  3G6E 1;  3H8B A;  4BOQ A;  4ZUX U;  2M6N A;  4A3G I;  3S1N I;  2OUL A;  2EGT A;  3CH3 X;  1U9W A;  1K83 I;  2B1N A;  1RLY A;  4BPV A;  4D8I A;  3BWK A;  1Y1V I;  2O53 A;  3TNX A;  3CXC Y;  2AIM A;  2FE8 A;  3NHE A;  3OF9 A;  5D1P A;  3DF0 A;  4X6I A;  4MD8 A;  4MSX A;  3MJ5 A;  2QRC B;  4NBA A;  2G7Y A;  1VQK 1;  1MDW A;  4G54 A;  4AXM A;  1PE6 A;  1PCI A;  3QT4 A;  1QVF Y;  2GTH A;  1WZN A;  2RT9 A;  1TWH I;  4MM3 B;  2OZK A;  3BG0 B;  1O0E A;  2ATO A;  3CCM Z;  4FIP A;  2ACT A;  2P0R A;  3NDI A;  2VPZ A;  2E9H A;  3O0U A;  5C3E I;  1TWG I;  1N8R 1;  3IF8 A;  1I50 I;  3JAM b;  1BY8 A;  1MHW A;  3GTM S;  2JIO A;  3K7A I;  2V45 A;  2DZY A;  3N3K A;  3G6E Z;  3S14 I;  4BOS A;  4HGY A;  4A3B I;  1VQM Z;  2QEX 1;  2UZJ A;  2G8J A;  2CB5 A;  4BOZ A;  2O4H A;  5EZQ A;  1TWF I;  4YYV A;  1YIT 1;  2PK7 A;  3HOV I;  2AYO A;  3J80 b;  4RS4 A;  3NH4 A;  7PCK A;  1YJN 1;  1RO2 A;  4QTU A;  3N3G A;  4YYU A;  5K16 A;  1KC8 1;  4NFR A;  3PHX A;  2YJB A;  4YYS A;  1FDO A;  3VMG A;  3U50 C;  2VUM I;  2AYN A;  1VQ9 1;  4PAD A;  1GMY A;  3ZUA A;  2RHB A;  2VF1 A;  3EED A;  3CME 1;  2DE5 A;  2JQG R;  1RQF A;  2JR6 A;  1YAL A;  4A3K I;  2DC8 A;  2R92 I;  2J7Q A;  1Q7Y 1;  1TL9 A;  1UKF A;  5E6J A;  5FLM I;  3CCE Z;  4R3D A;  4YYQ A;  3OF8 A;  2KPI A;  2RPR A;  3J7A 4;  1ICF A;  2V8K A;  1KHQ A;  1KHP A;  3RVV A;  3GTM I;  2AUX A;  3PT2 A;  3CCV 1;  3RVX A;  4P6G A;  6PAD A;  3HOY I;  3QWU A;  2R7Z I;  1NQC A;  2DCB A;  4RVF A;  2HWK A;  3LUS A;  2JIR A;  1NJI 2;  3CC2 1;  1QXP A;  2DCC A;  4BS5 A;  1NPZ A;  1USP A;  4AYB A;  4A3E I;  1YHQ 1;  1CS8 A;  3PSE A;  3GCB A;  1TFI A;  2F7D A;  3MZK B;  1QXF A;  2O6X A;  2BJO A;  1YT7 A;  2OZ2 A;  3P5U A;  4QRV A;  2PNS A;  3HWN A;  1PPD A;  1S72 Z;  2R9M A;  2DOS A;  2VPX A;  2R9N A;  1Y1W I;  3MTN A;  4P16 A;  2ZAE B;  1HUC B;  2AS8 A;  3S1Q I;  1PXV A;  2FUD A;  4BOU A;  4QBB A;  1K3B B;  3G71 1;  4IP3 A;  4OEM A; 
#chains in the Genus database with same CATH homology
 3Q87 A;  4QTT A;  1KRL A;  3F3F C;  1Q81 1;  1Q82 2;  3MON A;  2Y0S A;  2OTL 1;  3CMA 1;  1I3Q I;  2PM9 A;  3CPW Y;  3CC2 Z;  1M90 1;  3C0R A;  2PMZ A;  1PVJ A;  2I3C A;  1YHQ Z;  3BBA A;  4Y52 I;  1KQS Z;  3HOW I;  2P3Y A;  3CC4 Z;  3G4S 1;  5IP9 I;  1M1K 1;  4MH4 A;  2R93 I;  1TWC I;  2LFU A;  3I56 Z;  1WII A;  1YJW 1;  2QRD B;  3OW2 Z;  5A2Q b;  3PRM A;  2W03 A;  3G71 Z;  4XX2 A;  4HXD B;  2DE7 A;  3W31 A;  2JA5 I;  1YZB A;  2JNY A;  4BY7 I;  2K5R A;  1W2B Z;  2WB1 A;  3CCL Z;  1RO4 A;  4E30 A;  4EWC A;  2OTL Z;  3CXC Z;  4CL1 A;  1USP B;  1LQL A;  5CM2 M;  5JZE A;  3CCU 1;  3G4S Z;  3IFU A;  5FLX b;  1VQP 1;  3I4M I;  2BTW A;  3S2H I;  2JMO A;  3CCS Z;  4NBF A;  2Q51 A;  3GTJ I;  3PHW A;  4HH4 A;  5T6B A;  4OVZ A;  4MD7 A;  3J81 b;  3S1R I;  2OTJ 1;  3GTK I;  2IZ3 A;  1VQK Z;  4RKX A;  4A3J I;  4BOP A;  3TMP A;  1VQL 1;  2V8J A;  1N8R 2;  3CCU Z;  1VQO 1;  3GTO I;  4NBG A;  1VQP Z;  3GTG I;  3GTP I;  5KO3 A;  3MZL B;  1X0T A;  1Q86 1;  3D6W A;  4WUR A;  2YU9 I;  5T67 A;  3NH5 A;  2NVQ I;  3EER A;  4NBC A;  4BY1 I;  3H3V J;  4A3L I;  4REZ A;  3RNV A;  3PO2 I;  1KC8 2;  2QEX Z;  4MI7 A;  1YIT Z;  1WW9 A;  1P9N A;  2R6M A;  4RVH A;  1X3Z A;  4RV9 A;  4D8B A;  1YJN Z;  2OOX B;  3CC7 1;  1YJ9 1;  1ZB9 A;  1QVG Z;  3CCR 1;  3H0G I;  1Q7Y 2;  1QYP A;  1K9M 1;  3I55 1;  4D8E A;  1VQ8 1;  1YI2 1;  1VQ9 Z;  3GTL I;  2QRE B;  4RNA A;  3CCQ 1;  3TDH B;  2J6A A;  3CME Z;  4ZTB A;  4XZX A;  3VMH A;  5IP7 I;  1VQO Z;  3BY4 A;  3HOU I;  2YAD A;  4NBB A;  2BTW B;  2QLV B;  2QA4 1;  2RIQ A;  4DQY B;  3CCV Z;  1VQN 1;  4E2W A;  1K8A 1;  4OVZ B;  3D9X A;  1KD1 1;  3VB9 A;  3JAM f;  4E2Y A;  2E2J I;  2HU9 A;  2DE6 A;  4GUA A;  3CC7 Z;  4A3D I;  3ESW A;  3I55 Z;  3RZD I;  3J80 f;  1PFT A;  1JJ2 Z;  3S15 I;  1VQ7 1;  1K73 1;  3CCQ Z;  1NUI A;  2QR1 B;  4S1T A;  2WAQ A;  1KQS Y;  2HF1 A;  1Q81 2;  3M3Y I;  2P28 A;  3I4N I;  2QA4 Z;  1VQN Z;  1YUK A;  1M90 2;  4X6A I;  1DKI A;  2JUB A;  3NFZ A;  2JA7 I;  2NVY I;  3FQM A;  3ZNH A;  2H85 A;  3B21 A;  1M1K 2;  3CMA Z;  5C4X I;  2B63 I;  2Q4Z A;  4A3M I;  1X3W A;  3O65 A;  1TWA I;  3BB7 A;  2W04 A;  3HKZ A;  3VTN A;  3OQC A;  2BU3 A;  1VQ4 1;  3TRK A;  4NOZ A;  4OW0 A;  1QVF Z;  1VQM 1;  1R9T I;  5C44 I;  2QKD A;  2IZ4 A;  1W2B Y;  1VQ7 Z;  2M48 A;  2JS4 A;  5AN9 F;  1YJW Z;  1NP6 A;  3S17 I;  3BG1 B;  5IT9 f;  3VMI A;  5T64 A;  3M4O I;  1L1O C;  1N2F A;  3CCE 1;  4E2X A;  3E9S A;  3CCJ 1;  4BXX I;  3NH8 A;  1RO0 A;  1DL6 A;  2OOY B;  2GU2 A;  4BBR I;  1VQ4 Z;  5LL6 f;  2NVX I;  4RF0 A;  3F3P C;  4RVD A;  5C4J I;  1QF8 A;  1Z02 A;  4A3I I;  4MRI A;  3PO3 S;  3KIH A;  4MD9 A;  1ZH1 A;  1NJI 1;  4PT5 A;  2JRI A;  4RVG A;  4MON A;  2K3R A;  1YUA A;  3NDJ A;  4Y7N I;  1S72 1;  3S1M I;  5D1O A;  3W30 A;  4M0W A;  1ZB8 A;  3PRP A;  2J7Q C;  2OTJ Z;  5A2Q f;  3MTV A;  3CCJ Z;  2AKL A;  3HOX I;  3IX0 A;  4RF1 A;  1Q86 2;  1VQL Z;  4NB8 A;  1YIJ 1;  1Z01 A;  3S2D I;  4DK1 A;  2V8I A;  2JTC A;  3I07 A;  1VQ6 1;  2GTI A;  2E2I I;  1QVG Y;  3PO3 I;  3GTQ I;  3CC4 1;  1Q82 1;  4E33 A;  1S7M A;  4A3F I;  2AGA A;  4NB9 A;  5FLX f;  4DGL A;  3S16 I;  4IUM A;  3CD6 1;  4A5U A;  3GCF A;  5IT9 b;  1VQ5 1;  4TNU A;  1K9M 2;  4A93 I;  3I56 1;  2NVT I;  4MXU A;  2VUG A;  3P5J B;  2F4M A;  3CPW Z;  1YJ9 Z;  1VLA A;  4HGZ A;  3KIF A;  3CCR Z;  4NBH A;  3HOZ I;  4E31 A;  3FKI I;  1VQ8 Z;  1YI2 Z;  3GKQ A;  3MP2 A;  3J81 f;  3FQQ A;  1I6H I;  2LIY A;  1YIJ Z;  1Y1V S;  3RZO I;  3CCL 1;  2JA6 I;  1JWH C;  1K8A 2;  1VQ6 Z;  4A3C I;  4NBE A;  4E32 A;  1Z03 A;  1KD1 2;  4BBS I;  1ML8 A;  3CQZ I;  3PHU A;  2E2H I;  1RNI A;  4NBD A;  1SFO I;  3T4N B;  3CCM 1;  2G2K A;  1JJ2 Y;  5EZS A;  3CD6 Z;  2Z84 A;  2KI7 B;  4NH1 C;  1WCM I;  2F4O A;  3TE5 B;  4E2Z A;  5D1O B;  1VQ5 Z;  3OW2 Y;  3CCS 1;  2JA8 I;  2RBL A;  1K73 2;  4BOQ A;  3G6E 1;  2M6N A;  4A3G I;  3S1N I;  2EGT A;  1K83 I;  1RLY A;  4D8I A;  1Y1V I;  2O53 A;  3CXC Y;  2FE8 A;  5D1P A;  4MD8 A;  3MJ5 A;  2QRC B;  4NBA A;  1VQK 1;  1QVF Y;  2GTH A;  2RT9 A;  1TWH I;  4MM3 B;  2OZK A;  3BG0 B;  3CCM Z;  3NDI A;  2E9H A;  5C3E I;  1TWG I;  1N8R 1;  3IF8 A;  1I50 I;  3JAM b;  3GTM S;  3K7A I;  3G6E Z;  3S14 I;  4BOS A;  4HGY A;  4A3B I;  1VQM Z;  2QEX 1;  2UZJ A;  4BOZ A;  2O4H A;  5EZQ A;  1TWF I;  1YIT 1;  2PK7 A;  3HOV I;  3J80 b;  4RS4 A;  3NH4 A;  1YJN 1;  1RO2 A;  4QTU A;  1KC8 1;  4NFR A;  3PHX A;  3VMG A;  2VUM I;  3U50 C;  1VQ9 1;  2RHB A;  2VF1 A;  3EED A;  3CME 1;  2DE5 A;  2JR6 A;  1RQF A;  2J7Q A;  4A3K I;  2R92 I;  1Q7Y 1;  1UKF A;  5E6J A;  5FLM I;  3CCE Z;  4R3D A;  2KPI A;  2RPR A;  3J7A 4;  2V8K A;  3GTM I;  3PT2 A;  3CCV 1;  3HOY I;  3QWU A;  2R7Z I;  4RVF A;  2HWK A;  3LUS A;  1NJI 2;  3CC2 1;  1USP A;  4AYB A;  4A3E I;  1YHQ 1;  3PSE A;  1TFI A;  3MZK B;  2BJO A;  1S72 Z;  2DOS A;  4P16 A;  1Y1W I;  2ZAE B;  3S1Q I;  4BOU A;  3G71 1;  4IP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...