3IFUA

The crystal structure of porcine reproductive and respiratory syndrome virus (prrsv) leader protease nsp1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
175
structure length
175
Chain Sequence
DRCTCTPNARVFVAEGQVYCTRCLSARSLLPLNLQVPELGVLGLFYRPEEPLRWTLPRAFPTVECSPAGACWLSAIFPIARMTSGNLNFQQRMVRVAAEIYRAGQLTPTVLKTLQVYERGCRWYPIVGPVPGVGVYANSLHVSDKPFPGATHVLTNLPLPQRPKPEDFCPFECAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of porcine reproductive and respiratory syndrome virus leader protease Nsp1alpha
pubmed doi rcsb
source organism Porcine reproductive and respiratory syndrome virus
molecule tags Transcription
molecule keywords Non-structural protein
total genus 37
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2009-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05410 Peptidase_C31 Porcine arterivirus-type cysteine proteinase alpha
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.250 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ifuA01
3.90.70.60 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3ifuA02
3IFUA
chains in the Genus database with same CATH superfamily
2GU2A 1L1OC 1PIPA 3CD6Z 2DJFB 4MXUA 2JA8I 3GTMS 3WXFA 4BQVA 3IOQA 5CHTA 3AI8A 5CHVA 3S1QI 3BPFA 1XKGA 1Y08A 1AYWA 3USVA 2NVQI 4RF1A 4BOSA 3U8EA 5A2Qb 3BC3A 3O0UA 3BOWA 3S3RA 1Q7Y1 1POPA 2Q51A 4BBSI 1QMYA 3GKQA 2R7ZI 3T4NB 4R3DA 5FPWA 2HD5A 2QREB 3QSDA 4ZUXU 3IF8A 3D2LA 4QRVA 1U9WA 1Z02A 4X6AI 4PT5A 1NB3A 1ZH1A 3MP2A 3TRKA 1RO4A 3RZOI 4P16A 4RV9A 1PPPA 4MZOA 5JH3A 2RIQA 3S14I 3NH8A 3HOWI 4I07A 2WB1A 1O0EA 1Q821 3GCFA 5E6JA 5J94A 1M901 2FYEA 4A3JI 1VJVA 2AKLA 2VUGA 2IPPB 1PVJA 1Y1WI 5FLXb 1PADA 2E02A 4AYBA 2E00A 3OVZA 4A5UA 2OTL1 2DJGB 1TFIA 3S3QA 3P5JB 3B79A 3OW2Y 2QA41 3P5WA 4A3LI 2NVYI 1F2AA 2DE6A 2DC7A 1X9YA 3CC21 2OTJ1 1YIJZ 5T64A 1DL6A 1NUIA 3MZLB 2FE8A 2AIMA 1FDOA 3OF8A 3F3PC 3CQZI 1AU2A 1KQSY 2P28A 2JIRA 1ZB8A 1I50I 2K5RA 2NVTI 1EF7A 1YZBA 4E32A 3OQCA 2AVWA 4AXLA 1S72Z 2OOYB 1X0TA 1STFE 1NJI1 4N79A 2VPZA 2O53A 2E2II 2JQGR 4DMXA 2K3RA 2JQFR 1VQ6Z 4MI7A 1AU4A 3OW2Z 1FH0A 3H8BA 4X6HA 1ZCMA 3H8CA 4E2WA 1KHQA 2BTWB 4HWYA 1M902 3C9EA 5D1PA 1MEMA 1ZB9A 4N8WA 1BP4A 3CXCY 2R92I 2QLVB 2AGAA 1KC81 1TWGI 4BXXI 3LXSA 3S16I 1NQCA 1IWDA 3CMA1 1KFUL 3CCQ1 3CCJ1 2B63I 3PO2I 1NL6A 1VQ4Z 2VF1A 4A3FI 4Y52I 2E2HI 4NBEA 5KO3A 4HGZA 1DF0A 1HUCB 1TWHI 1ICFA 3GTQI 5IP7I 2O6XA 4YYVA 4M0WA 3V6EA 4YV8A 4CL1A 1MHWA 5FLMI 4A3II 3CCVZ 3M99A 2PK7A 2V45A 2DOSA 3NFZA 1TWCI 4QBBA 2XU1A 1TWFI 2YJCA 1KD11 4HXDB 4OEMA 5EZQA 2J7QA 3BPMA 1X3WA 2V8JA 3TE5B 2Y5BA 1K731 3MTNA 1NPZA 3G4S1 4BY7I 1AYVA 2YU9I 4NBFA 3CCSZ 1VQ61 2YJ8A 1LQLA 2J6AA 4MD9A 2WBFX 1SIWA 1SNKA 1THEA 2FT2A 1ME4A 3CCL1 2V8KA 4OVZB 1PBHA 1QXFA 2JIOA 3KFQA 4FK5A 1VQMZ 1AIMA 2DC6A 2P3YA 1VQ8Z 3PBHA 2AU1A 3E9SA 3RNVA 1EWMA 1Z01A 3CCS1 4D8EA 4D8IA 2PM9A 3G4SZ 3G71Z 4RKXA 1PCIA 2EGTA 3VTNA 4MZSA 3BG0B 3I56Z 2IV2X 3CCEZ 3PRMA 1KRLA 2VUMI 1KHPA 2DCAA 2BDLA 1UKFA 2NQIA 4NBCA 1YHQZ 3IFUA 2WAQA 3KWBX 3KW9A 3DF0A 4OELA 4FJCA 2LIYA 5LL6f 3HOVI 1CB5A 3PRPA 3F75A 3JAMf 3CCE1 3GTLI 3QWUA 3JAMb 3F3FC 2PMZA 1YI2Z 4IP3A 2G6DA 1PPDA 2IZ4A 3HOUI 2AYNA 4QRGA 3KIHA 4PP2E 4WA6A 4BS6A 3CC7Z 4BPVA 1NLJA 3WXEA 4YYUA 1ATKA 4NBDA 3GTMI 1QVFZ 4NB8A 2BTWA 3MORA 4XX2A 2KPIA 4DK1A 5C4XI 1JQPA 4CDDB 4NBBA 2JA6I 1YITZ 1VQL1 3OVXA 3PNRA 5AN9F 4BBRI 1U9QX 2Z84A 3CCU1 4BSQA 3RVVA 4W5BA 4XR7A 2O4HA 2HU9A 3W31A 3GTKI 2B1MA 3NH4A 2KI7B 3CBJA 1Q812 2LEXA 2JA7I 3G6EZ 3S15I 4I04A 3IX0A 2V3VA 2FRQA 3KKUA 4BS5A 2NQDB 3BWKA 1TU6A 1CPJA 5F02A 3GTPI 3S2HI 2GHUA 4E31A 1W2BY 1YIT1 3S1NI 1USPA 4QTTA 1VQ9Z 2ATOA 1QVFY 3I551 1S4VA 3TDHB 3RZDI 1YJWZ 1RNIA 4A3KI 1F29A 5C4JI 1QVGY 1ZIVA 5IT9f 1FDIA 3I55Z 2C0YA 1VQN1 1YALA 3P5XA 1BQIA 5CVNB 1AECA 4AXMA 2JNYA 3F5VA 3QT4A 1YIJ1 3GTOI 1GLOA 4MH4A 2QRDB 2QRCB 1K83I 4HH4A 3GCBA 3I4MI 4BOZA 1K8A1 1YI21 3CCJZ 4QRXA 1DKIA 3MZKB 3GTGI 3OISA 4RVDA 4PI3A 4K7CA 4MRIA 3I561 3NDIA 3BB7A 3CCRZ 2E03A 1Q861 2JTCA 2QEX1 5T6BA 3I06A 2RT9A 1QF8A 2M6NA 1YHQ1 1F2CA 2AYDA 3PSEA 4OVZA 4KLBA 4RF0A 3M4OI 3K7AI 2G8EA 2XU5A 1VQ81 2NQGA 3MHSA 3TMPA 5EGWA 1Y4HA 3CD61 3IV2A 4BOPA 3LUSA 4MD7A 3PDFA 3CCLZ 5EF4A 4X6IA 2GTHA 4DQYB 2F4MA 4ZTBA 2VHFA 1QDQA 2F4OA 1VQM1 1YJ9Z 1SFOI 2R93I 4XZXA 3LFYA 4A3BI 6PADA 3CPWY 2R9CA 3S1MI 4BY1I 3MJ5A 3HKZA 2R6NA 3FQMA 2PBHA 3N4CA 2P7UA 3CH3X 1A6RA 1JJ2Z 1MEGA 4NBGA 1M6DA 2DZZA 2F7DA 3W30A 4G54A 1K3BB 1BY8A 3NH5A 1K8A2 4OW0A 1YUKA 3HD3A 2JIPA 2OULA 1GECE 3K9MA 2AUXA 5C44I 2DE5A 2Y6EA 3IEJA 2E9HA 1PXVA 4W4UA 2DCDA 2QKDA 3EEDA 4NH1C 1CSBB 2OTLZ 1U9VA 3CCV1 4A3GI 2JRIA 4I05A 2JR6A 4P6GA 5CVOB 2IBIA 3S2DI 1VQ71 3CPWZ 1JJ2Y 4MD8A 1VQNZ 3O65A 3IMAA 3RVXA 5IT9b 1Y1VI 2XU4A 1YJW1 4A3DI 3N3GA 3H89A 4E33A 4Y7NI 3FQQA 1N2FA 1Q862 3J81b 3NHEA 1AYUA 3J81f 4YYRA 1VQP1 2YADA 4A3EI 2AUZA 5JA7A 3ZNHA 1WCMI 3PT2A 4A3MI 3KSEA 4NFRA 2FRAA 3VMIA 2J7QC 1JWHC 2ARYA 2CIOA 2JUBA 1BGOA 5PADA 1Q822 1YT7A 1PPNA 2JIQA 4NBHA 4CDCB 8PCHA 3S1RI 1VQLZ 5EZSA 4CDEB 3CH2X 1TLOA 2RBLA 1YK7A 3BY4A 1MDWA 7PCKA 2FO5A 4WURA 3EERA 2NAPA 3KWZA 1CTEA 1R9TI 1QXPA 1USPB 4S1TA 2JIMA 3IUTA 4YYSA 1U9XA 2Y0SA 3K24A 4Q8HA 3PO3I 2FQ9A 1S721 2GFOA 4RVFA 1VQ5Z 3MHHA 2G8JA 3J80f 4W5CA 4EWCA 2IZ3A 3CCQZ 1Y1VS 3H3VJ 4MSXA 1CQDA 1KQSZ 9PAPA 1RO0A 2ZAEB 4GUAA 4Q8GA 2DC8A 1WJ2A 3ESWA 1QOLA 4YYWA 2NQAA 4XUIA 5A2Qf 4P6EA 4NBAA 4RS4A 4BOQA 1S7MA 1I3QI 2VPWA 1RQFA 1RLYA 5C3EI 2RPRA 4RVHA 1EWLA 2PNSA 1K9M2 1CV8A 1Q6KA 1VQKZ 2E2JI 4REZA 3CME1 2G2KA 1KXRA 1KD12 2YJ2A 1M1K1 2R9FA 2QR1B 2HWKA 3H0GI 3ZUAA 3E1ZB 2VPYA 2R9MA 2RHBA 3CC41 4A3CI 1YJ91 4E2XA 4MONA 2B1NA 4CDFB 2HXZA 3CC71 3WXGA 3PO3S 3I07A 3CMEZ 5IP9I 2DZYA 3CBKA 2R9NA 2V8IA 1N8R2 5JZEA 1YJN1 1KFXL 3O1GA 2OOXB 1YJNZ 2QA4Z 2FUDA 1PPOA 3MONA 5D1OB 1NJI2 2H7JA 5A24A 3QJ3A 1GCBA 2I3CA 2R6MA 2ACTA 3V6CA 2G7YA 1X3ZA 3CC2Z 2OTJZ 4QTUA 2E7ZA 3U50C 1U5IA 1EWPA 3GTJI 3HOZI 4E30A 3M3YI 1N8R1 2NVXI 3BG1B 3HWNA 1P9NA 2DCCA 3I3TA 2JS4A 4NOZA 2W04A 2DCBA 2DC9A 1NP6A 1VQ51 1TWAI 3VMGA 3VMHA 2DE7A 2OZ2A 3PHWA 2HHNA 2BU3A 1KC82 1YK8A 1PFTA 4X6JA 4QH6A 2JA5I 1WW9A 3RVWA 3C0RA 2GTIA 4E2ZA 3H7DA 2H85A 1AA6A 3CMAZ 1QVGZ 3CCM1 1VLAA 2VPXA 1VQ91 3S17I 1SP4B 3J7A4 4RY2A 5FLXf 3NDJA 1K9M1 2AYOA 1Z03A 4DGLA 2LFUA 1F2BA 2HH5A 1AU0A 2P0RA 1NB5A 4HGYA 2JMOA 1M1K2 4E2YA 3G6E1 1WIIA 3D9XA 3B21A 2BJOA 3VB9A 2UZJA 1MS6A 4DMYA 2OP3A 3G711 3HHAA 3TNXA 1VQPZ 2W03A 5CM2M 3CCUZ 1YUAA 2AS8A 4A93I 1Q7Y2 1Q811 4CZWA 2M48A 3ERVA 3CC4Z 1MIRA 2PADA 3J80b 1EWOA 3D6WA 2HF1A 3N3KA 2VHSA 3I4NI 2CB5A 1CVZA 4NB9A 1Q16A 1TL9A 4RVGA 3HHIA 4YYQA 1VQO1 1CJLA 3K8UA 3BBAA 3HOYI 2BDZA 1ME3A 1VSNA 1AU3A 2OZKA 4MM3B 2R9OA 1VQK1 1ITOA 1DEUA 1VQ41 1ML8A 4TNUA 2QEXZ 2P86A 5T67A 3CCR1 4PP1A 3PW3A 3KX1A 1QYPA 1GMYA 2F1GA 3H6SA 3PHXA 2Q4ZA 1RO2A 1Y8CA 3PHUA 3D6SA 2PREA 4FIPA 4BOUA 3CXCZ 2YJ9A 1I6HI 1PE6A 2XU3A 4N4ZA 3CCMZ 1VQOZ 3KIFA 3OF9A 1WZNA 1CS8A 1VQ7Z 4D8BA 1K732 3IR7A 4YVAA 4RNAA 4IUMA 3IHPA 4PADA 5CVMA 1W2BZ 1YVBA 5D1OA 3HOXI 2E01A 2YJBA 3P5UA 5K16A 2FTDA 3FKII 3MTVA 3BCNA 3Q87A 3P5VA
chains in the Genus database with same CATH topology
2GU2A 1L1OC 3CD6Z 4MXUA 2JA8I 3GTMS 3S1QI 2NVQI 4RF1A 4BOSA 5A2Qb 1Q7Y1 2Q51A 4BBSI 3GKQA 2R7ZI 3T4NB 4R3DA 2QREB 3IF8A 1Z02A 4X6AI 4PT5A 1ZH1A 3MP2A 3TRKA 1RO4A 3RZOI 4P16A 4RV9A 2RIQA 3S14I 3NH8A 3HOWI 2WB1A 1Q821 3GCFA 5E6JA 1M901 4A3JI 2AKLA 2VUGA 1PVJA 1Y1WI 5FLXb 4AYBA 4A5UA 2OTL1 1TFIA 3P5JB 2QA41 3OW2Y 4A3LI 2NVYI 2DE6A 3CC21 2OTJ1 1YIJZ 5T64A 1DL6A 1NUIA 3MZLB 2FE8A 3F3PC 3CQZI 1KQSY 2P28A 1ZB8A 1I50I 2K5RA 2NVTI 1YZBA 3OQCA 4E32A 1S72Z 2OOYB 1X0TA 1NJI1 2O53A 2E2II 2K3RA 1VQ6Z 4MI7A 3OW2Z 4E2WA 2BTWB 1M902 5D1PA 1ZB9A 3CXCY 2R92I 2QLVB 2AGAA 1KC81 1TWGI 4BXXI 3S16I 3CMA1 3CCQ1 3CCJ1 2B63I 3PO2I 1VQ4Z 2VF1A 4A3FI 4Y52I 2E2HI 4NBEA 5KO3A 4HGZA 1TWHI 3GTQI 5IP7I 4M0WA 4CL1A 5FLMI 4A3II 3CCVZ 2PK7A 2DOSA 3NFZA 1TWCI 1TWFI 1KD11 4HXDB 5EZQA 2J7QA 1X3WA 2V8JA 3TE5B 1K731 3G4S1 4BY7I 2YU9I 4NBFA 3CCSZ 1VQ61 1LQLA 2J6AA 4MD9A 3CCL1 2V8KA 4OVZB 1VQMZ 2P3YA 1VQ8Z 3RNVA 4D8EA 3E9SA 1Z01A 3CCS1 4D8IA 2PM9A 3G4SZ 3G71Z 4RKXA 2EGTA 3VTNA 3BG0B 3I56Z 3CCEZ 3PRMA 1KRLA 2VUMI 1UKFA 4NBCA 1YHQZ 3IFUA 2WAQA 2LIYA 5LL6f 3HOVI 3PRPA 3JAMf 3CCE1 3GTLI 3QWUA 3JAMb 3F3FC 2PMZA 1YI2Z 4IP3A 2IZ4A 3HOUI 3KIHA 3CC7Z 4NBDA 3GTMI 1QVFZ 4NB8A 2BTWA 4XX2A 2KPIA 4DK1A 5C4XI 4NBBA 2JA6I 1YITZ 1VQL1 5AN9F 4BBRI 2Z84A 3CCU1 2O4HA 2HU9A 3W31A 3GTKI 3NH4A 2KI7B 1Q812 2JA7I 3S15I 3G6EZ 3IX0A 3GTPI 3S2HI 4E31A 1W2BY 1YIT1 3S1NI 1USPA 4QTTA 1VQ9Z 1QVFY 3I551 3TDHB 3RZDI 1YJWZ 1RNIA 4A3KI 4RF0A 5C4JI 1QVGY 5IT9f 3I55Z 1VQN1 2JNYA 1YIJ1 3GTOI 4MH4A 2QRDB 2QRCB 1K83I 4HH4A 3I4MI 4BOZA 1K8A1 1YI21 3CCJZ 1DKIA 3MZKB 3GTGI 4RVDA 4MRIA 3I561 3NDIA 3BB7A 3CCRZ 2JTCA 1Q861 2QEX1 5T6BA 2RT9A 1QF8A 2M6NA 1YHQ1 3PSEA 4OVZA 3M4OI 3K7AI 1VQ81 3TMPA 3CD61 4BOPA 3LUSA 4MD7A 3CCLZ 2GTHA 4DQYB 2F4MA 4ZTBA 2F4OA 1VQM1 1YJ9Z 1SFOI 2R93I 4XZXA 4A3BI 3CPWY 3S1MI 4BY1I 3MJ5A 3HKZA 3FQMA 1JJ2Z 4NBGA 3W30A 3NH5A 1K8A2 4OW0A 1YUKA 5C44I 2DE5A 2E9HA 2QKDA 3EEDA 4NH1C 2JRIA 2OTLZ 3CCV1 4A3GI 2JR6A 3S2DI 1VQ71 3CPWZ 1JJ2Y 4MD8A 1VQNZ 3O65A 5IT9b 1Y1VI 1YJW1 4A3DI 4E33A 4Y7NI 3FQQA 1N2FA 1Q862 3J81b 3J81f 2YADA 4A3EI 1VQP1 3ZNHA 1WCMI 3PT2A 4A3MI 4NFRA 3VMIA 2J7QC 1JWHC 2JUBA 1Q822 4NBHA 3S1RI 1VQLZ 5EZSA 2RBLA 3BY4A 4WURA 3EERA 1R9TI 1USPB 4S1TA 2Y0SA 3PO3I 1S721 4RVFA 1VQ5Z 3J80f 4EWCA 2IZ3A 3CCQZ 1Y1VS 3H3VJ 1KQSZ 1RO0A 2ZAEB 4GUAA 3ESWA 5A2Qf 4NBAA 4RS4A 4BOQA 1S7MA 1I3QI 1RQFA 1RLYA 5C3EI 2RPRA 4RVHA 1K9M2 1VQKZ 2E2JI 4REZA 3CME1 2G2KA 1KD12 1M1K1 2QR1B 2HWKA 3H0GI 2RHBA 3CC41 4A3CI 1YJ91 4E2XA 4MONA 3CC71 3PO3S 3I07A 3CMEZ 5IP9I 2V8IA 1N8R2 5JZEA 1YJN1 2OOXB 1YJNZ 2QA4Z 3MONA 5D1OB 1NJI2 2I3CA 2R6MA 1X3ZA 3CC2Z 2OTJZ 4QTUA 3U50C 3GTJI 3HOZI 4E30A 3M3YI 1N8R1 2NVXI 3BG1B 1P9NA 2JS4A 4NOZA 2W04A 1NP6A 1VQ51 1TWAI 3VMGA 3VMHA 2DE7A 3PHWA 2BU3A 1KC82 1PFTA 2JA5I 1WW9A 3C0RA 2GTIA 4E2ZA 2H85A 3CMAZ 1QVGZ 3CCM1 1VLAA 1VQ91 3S17I 3J7A4 5FLXf 3NDJA 1K9M1 1Z03A 4DGLA 2LFUA 4HGYA 2JMOA 1M1K2 4E2YA 3G6E1 1WIIA 3D9XA 3B21A 2BJOA 3VB9A 2UZJA 3G711 1VQPZ 2W03A 5CM2M 3CCUZ 1YUAA 4A93I 1Q7Y2 1Q811 2M48A 3CC4Z 3J80b 3D6WA 2HF1A 3I4NI 4NB9A 4RVGA 1VQO1 3BBAA 3HOYI 2OZKA 4MM3B 1VQK1 1VQ41 1ML8A 4TNUA 2QEXZ 5T67A 3CCR1 1QYPA 3PHXA 2Q4ZA 1RO2A 3PHUA 4BOUA 3CXCZ 1I6HI 3CCMZ 1VQOZ 3KIFA 1VQ7Z 4D8BA 1K732 4RNAA 4IUMA 1W2BZ 5D1OA 3HOXI 3MTVA 3FKII 3Q87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IFU A; 
#chains in the Genus database with same CATH topology
 2GU2 A;  1L1O C;  1PIP A;  3CD6 Z;  2DJF B;  4MXU A;  2JA8 I;  3GTM S;  3WXF A;  4BQV A;  3IOQ A;  5CHT A;  3AI8 A;  5CHV A;  3S1Q I;  3BPF A;  1XKG A;  1Y08 A;  1AYW A;  3USV A;  2NVQ I;  4RF1 A;  4BOS A;  3U8E A;  5A2Q b;  3BC3 A;  3O0U A;  3BOW A;  3S3R A;  1Q7Y 1;  1POP A;  2Q51 A;  4BBS I;  1QMY A;  3GKQ A;  2R7Z I;  3T4N B;  4R3D A;  5FPW A;  2HD5 A;  2QRE B;  3QSD A;  4ZUX U;  3IF8 A;  3D2L A;  4QRV A;  1U9W A;  1Z02 A;  4X6A I;  4PT5 A;  1NB3 A;  1ZH1 A;  3MP2 A;  3TRK A;  1RO4 A;  3RZO I;  4P16 A;  4RV9 A;  1PPP A;  4MZO A;  5JH3 A;  2RIQ A;  3S14 I;  3NH8 A;  3HOW I;  4I07 A;  2WB1 A;  1O0E A;  1Q82 1;  3GCF A;  5E6J A;  5J94 A;  1M90 1;  2FYE A;  4A3J I;  1VJV A;  2AKL A;  2VUG A;  2IPP B;  1PVJ A;  1Y1W I;  5FLX b;  1PAD A;  2E02 A;  4AYB A;  2E00 A;  3OVZ A;  4A5U A;  2OTL 1;  2DJG B;  1TFI A;  3S3Q A;  3P5J B;  3B79 A;  3OW2 Y;  2QA4 1;  3P5W A;  4A3L I;  2NVY I;  1F2A A;  2DE6 A;  2DC7 A;  1X9Y A;  3CC2 1;  2OTJ 1;  1YIJ Z;  5T64 A;  1DL6 A;  1NUI A;  3MZL B;  2FE8 A;  2AIM A;  1FDO A;  3OF8 A;  3F3P C;  3CQZ I;  1AU2 A;  1KQS Y;  2P28 A;  2JIR A;  1ZB8 A;  1I50 I;  2K5R A;  2NVT I;  1EF7 A;  1YZB A;  4E32 A;  3OQC A;  2AVW A;  4AXL A;  1S72 Z;  2OOY B;  1X0T A;  1STF E;  1NJI 1;  4N79 A;  2VPZ A;  2O53 A;  2E2I I;  2JQG R;  4DMX A;  2K3R A;  2JQF R;  1VQ6 Z;  4MI7 A;  1AU4 A;  3OW2 Z;  1FH0 A;  3H8B A;  4X6H A;  1ZCM A;  3H8C A;  4E2W A;  1KHQ A;  2BTW B;  4HWY A;  1M90 2;  3C9E A;  5D1P A;  1MEM A;  1ZB9 A;  4N8W A;  1BP4 A;  3CXC Y;  2R92 I;  2QLV B;  2AGA A;  1KC8 1;  1TWG I;  4BXX I;  3LXS A;  3S16 I;  1NQC A;  1IWD A;  3CMA 1;  1KFU L;  3CCQ 1;  3CCJ 1;  2B63 I;  3PO2 I;  1NL6 A;  1VQ4 Z;  2VF1 A;  4A3F I;  4Y52 I;  2E2H I;  4NBE A;  5KO3 A;  4HGZ A;  1DF0 A;  1HUC B;  1TWH I;  1ICF A;  3GTQ I;  5IP7 I;  2O6X A;  4YYV A;  4M0W A;  3V6E A;  4YV8 A;  4CL1 A;  1MHW A;  5FLM I;  4A3I I;  3CCV Z;  3M99 A;  2PK7 A;  2V45 A;  2DOS A;  3NFZ A;  1TWC I;  4QBB A;  2XU1 A;  1TWF I;  2YJC A;  1KD1 1;  4HXD B;  4OEM A;  5EZQ A;  2J7Q A;  3BPM A;  1X3W A;  2V8J A;  3TE5 B;  2Y5B A;  1K73 1;  3MTN A;  1NPZ A;  3G4S 1;  4BY7 I;  1AYV A;  2YU9 I;  4NBF A;  3CCS Z;  1VQ6 1;  2YJ8 A;  1LQL A;  2J6A A;  4MD9 A;  2WBF X;  1SIW A;  1SNK A;  1THE A;  2FT2 A;  1ME4 A;  3CCL 1;  2V8K A;  4OVZ B;  1PBH A;  1QXF A;  2JIO A;  3KFQ A;  4FK5 A;  1VQM Z;  1AIM A;  2DC6 A;  2P3Y A;  1VQ8 Z;  3PBH A;  2AU1 A;  3E9S A;  3RNV A;  1EWM A;  1Z01 A;  3CCS 1;  4D8E A;  4D8I A;  2PM9 A;  3G4S Z;  3G71 Z;  4RKX A;  1PCI A;  2EGT A;  3VTN A;  4MZS A;  3BG0 B;  3I56 Z;  2IV2 X;  3CCE Z;  3PRM A;  1KRL A;  2VUM I;  1KHP A;  2DCA A;  2BDL A;  1UKF A;  2NQI A;  4NBC A;  1YHQ Z;  3IFU A;  2WAQ A;  3KWB X;  3KW9 A;  3DF0 A;  4OEL A;  4FJC A;  2LIY A;  5LL6 f;  3HOV I;  1CB5 A;  3PRP A;  3F75 A;  3JAM f;  3CCE 1;  3GTL I;  3QWU A;  3JAM b;  3F3F C;  2PMZ A;  1YI2 Z;  4IP3 A;  2G6D A;  1PPD A;  2IZ4 A;  3HOU I;  2AYN A;  4QRG A;  3KIH A;  4PP2 E;  4WA6 A;  4BS6 A;  3CC7 Z;  4BPV A;  1NLJ A;  3WXE A;  4YYU A;  1ATK A;  4NBD A;  3GTM I;  1QVF Z;  4NB8 A;  2BTW A;  3MOR A;  4XX2 A;  2KPI A;  4DK1 A;  5C4X I;  1JQP A;  4CDD B;  4NBB A;  2JA6 I;  1YIT Z;  1VQL 1;  3OVX A;  3PNR A;  5AN9 F;  4BBR I;  1U9Q X;  2Z84 A;  3CCU 1;  4BSQ A;  3RVV A;  4W5B A;  4XR7 A;  2O4H A;  2HU9 A;  3W31 A;  3GTK I;  2B1M A;  3NH4 A;  2KI7 B;  3CBJ A;  1Q81 2;  2LEX A;  2JA7 I;  3G6E Z;  3S15 I;  4I04 A;  3IX0 A;  2V3V A;  2FRQ A;  3KKU A;  4BS5 A;  2NQD B;  3BWK A;  1TU6 A;  1CPJ A;  5F02 A;  3GTP I;  3S2H I;  2GHU A;  4E31 A;  1W2B Y;  1YIT 1;  3S1N I;  1USP A;  4QTT A;  1VQ9 Z;  2ATO A;  1QVF Y;  3I55 1;  1S4V A;  3TDH B;  3RZD I;  1YJW Z;  1RNI A;  4A3K I;  1F29 A;  5C4J I;  1QVG Y;  1ZIV A;  5IT9 f;  1FDI A;  3I55 Z;  2C0Y A;  1VQN 1;  1YAL A;  3P5X A;  1BQI A;  5CVN B;  1AEC A;  4AXM A;  2JNY A;  3F5V A;  3QT4 A;  1YIJ 1;  3GTO I;  1GLO A;  4MH4 A;  2QRD B;  2QRC B;  1K83 I;  4HH4 A;  3GCB A;  3I4M I;  4BOZ A;  1K8A 1;  1YI2 1;  3CCJ Z;  4QRX A;  1DKI A;  3MZK B;  3GTG I;  3OIS A;  4RVD A;  4PI3 A;  4K7C A;  4MRI A;  3I56 1;  3NDI A;  3BB7 A;  3CCR Z;  2E03 A;  1Q86 1;  2JTC A;  2QEX 1;  5T6B A;  3I06 A;  2RT9 A;  1QF8 A;  2M6N A;  1YHQ 1;  1F2C A;  2AYD A;  3PSE A;  4OVZ A;  4KLB A;  4RF0 A;  3M4O I;  3K7A I;  2G8E A;  2XU5 A;  1VQ8 1;  2NQG A;  3MHS A;  3TMP A;  5EGW A;  1Y4H A;  3CD6 1;  3IV2 A;  4BOP A;  3LUS A;  4MD7 A;  3PDF A;  3CCL Z;  5EF4 A;  4X6I A;  2GTH A;  4DQY B;  2F4M A;  4ZTB A;  2VHF A;  1QDQ A;  2F4O A;  1VQM 1;  1YJ9 Z;  1SFO I;  2R93 I;  4XZX A;  3LFY A;  4A3B I;  6PAD A;  3CPW Y;  2R9C A;  3S1M I;  4BY1 I;  3MJ5 A;  3HKZ A;  2R6N A;  3FQM A;  2PBH A;  3N4C A;  2P7U A;  3CH3 X;  1A6R A;  1JJ2 Z;  1MEG A;  4NBG A;  1M6D A;  2DZZ A;  2F7D A;  3W30 A;  4G54 A;  1K3B B;  1BY8 A;  3NH5 A;  1K8A 2;  4OW0 A;  1YUK A;  3HD3 A;  2JIP A;  2OUL A;  1GEC E;  3K9M A;  2AUX A;  5C44 I;  2DE5 A;  2Y6E A;  3IEJ A;  2E9H A;  1PXV A;  4W4U A;  2DCD A;  2QKD A;  3EED A;  4NH1 C;  1CSB B;  2OTL Z;  1U9V A;  3CCV 1;  4A3G I;  2JRI A;  4I05 A;  2JR6 A;  4P6G A;  5CVO B;  2IBI A;  3S2D I;  1VQ7 1;  3CPW Z;  1JJ2 Y;  4MD8 A;  1VQN Z;  3O65 A;  3IMA A;  3RVX A;  5IT9 b;  1Y1V I;  2XU4 A;  1YJW 1;  4A3D I;  3N3G A;  3H89 A;  4E33 A;  4Y7N I;  3FQQ A;  1N2F A;  1Q86 2;  3J81 b;  3NHE A;  1AYU A;  3J81 f;  4YYR A;  1VQP 1;  2YAD A;  4A3E I;  2AUZ A;  5JA7 A;  3ZNH A;  1WCM I;  3PT2 A;  4A3M I;  3KSE A;  4NFR A;  2FRA A;  3VMI A;  2J7Q C;  1JWH C;  2ARY A;  2CIO A;  2JUB A;  1BGO A;  5PAD A;  1Q82 2;  1YT7 A;  1PPN A;  2JIQ A;  4NBH A;  4CDC B;  8PCH A;  3S1R I;  1VQL Z;  5EZS A;  4CDE B;  3CH2 X;  1TLO A;  2RBL A;  1YK7 A;  3BY4 A;  1MDW A;  7PCK A;  2FO5 A;  4WUR A;  3EER A;  2NAP A;  3KWZ A;  1CTE A;  1R9T I;  1QXP A;  1USP B;  4S1T A;  2JIM A;  3IUT A;  4YYS A;  1U9X A;  2Y0S A;  3K24 A;  4Q8H A;  3PO3 I;  2FQ9 A;  1S72 1;  2GFO A;  4RVF A;  1VQ5 Z;  3MHH A;  2G8J A;  3J80 f;  4W5C A;  4EWC A;  2IZ3 A;  3CCQ Z;  1Y1V S;  3H3V J;  4MSX A;  1CQD A;  1KQS Z;  9PAP A;  1RO0 A;  2ZAE B;  4GUA A;  4Q8G A;  2DC8 A;  1WJ2 A;  3ESW A;  1QOL A;  4YYW A;  2NQA A;  4XUI A;  5A2Q f;  4P6E A;  4NBA A;  4RS4 A;  4BOQ A;  1S7M A;  1I3Q I;  2VPW A;  1RQF A;  1RLY A;  5C3E I;  2RPR A;  4RVH A;  1EWL A;  2PNS A;  1K9M 2;  1CV8 A;  1Q6K A;  1VQK Z;  2E2J I;  4REZ A;  3CME 1;  2G2K A;  1KXR A;  1KD1 2;  2YJ2 A;  1M1K 1;  2R9F A;  2QR1 B;  2HWK A;  3H0G I;  3ZUA A;  3E1Z B;  2VPY A;  2R9M A;  2RHB A;  3CC4 1;  4A3C I;  1YJ9 1;  4E2X A;  4MON A;  2B1N A;  4CDF B;  2HXZ A;  3CC7 1;  3WXG A;  3PO3 S;  3I07 A;  3CME Z;  5IP9 I;  2DZY A;  3CBK A;  2R9N A;  2V8I A;  1N8R 2;  5JZE A;  1YJN 1;  1KFX L;  3O1G A;  2OOX B;  1YJN Z;  2QA4 Z;  2FUD A;  1PPO A;  3MON A;  5D1O B;  1NJI 2;  2H7J A;  5A24 A;  3QJ3 A;  1GCB A;  2I3C A;  2R6M A;  2ACT A;  3V6C A;  2G7Y A;  1X3Z A;  3CC2 Z;  2OTJ Z;  4QTU A;  2E7Z A;  3U50 C;  1U5I A;  1EWP A;  3GTJ I;  3HOZ I;  4E30 A;  3M3Y I;  1N8R 1;  2NVX I;  3BG1 B;  3HWN A;  1P9N A;  2DCC A;  3I3T A;  2JS4 A;  4NOZ A;  2W04 A;  2DCB A;  2DC9 A;  1NP6 A;  1VQ5 1;  1TWA I;  3VMG A;  3VMH A;  2DE7 A;  2OZ2 A;  3PHW A;  2HHN A;  2BU3 A;  1KC8 2;  1YK8 A;  1PFT A;  4X6J A;  4QH6 A;  2JA5 I;  1WW9 A;  3RVW A;  3C0R A;  2GTI A;  4E2Z A;  3H7D A;  2H85 A;  1AA6 A;  3CMA Z;  1QVG Z;  3CCM 1;  1VLA A;  2VPX A;  1VQ9 1;  3S17 I;  1SP4 B;  3J7A 4;  4RY2 A;  5FLX f;  3NDJ A;  1K9M 1;  2AYO A;  1Z03 A;  4DGL A;  2LFU A;  1F2B A;  2HH5 A;  1AU0 A;  2P0R A;  1NB5 A;  4HGY A;  2JMO A;  1M1K 2;  4E2Y A;  3G6E 1;  1WII A;  3D9X A;  3B21 A;  2BJO A;  3VB9 A;  2UZJ A;  1MS6 A;  4DMY A;  2OP3 A;  3G71 1;  3HHA A;  3TNX A;  1VQP Z;  2W03 A;  5CM2 M;  3CCU Z;  1YUA A;  2AS8 A;  4A93 I;  1Q7Y 2;  1Q81 1;  4CZW A;  2M48 A;  3ERV A;  3CC4 Z;  1MIR A;  2PAD A;  3J80 b;  1EWO A;  3D6W A;  2HF1 A;  3N3K A;  2VHS A;  3I4N I;  2CB5 A;  1CVZ A;  4NB9 A;  1Q16 A;  1TL9 A;  4RVG A;  3HHI A;  4YYQ A;  1VQO 1;  1CJL A;  3K8U A;  3BBA A;  3HOY I;  2BDZ A;  1ME3 A;  1VSN A;  1AU3 A;  2OZK A;  4MM3 B;  2R9O A;  1VQK 1;  1ITO A;  1DEU A;  1VQ4 1;  1ML8 A;  4TNU A;  2QEX Z;  2P86 A;  5T67 A;  3CCR 1;  4PP1 A;  3PW3 A;  3KX1 A;  1QYP A;  1GMY A;  2F1G A;  3H6S A;  3PHX A;  2Q4Z A;  1RO2 A;  1Y8C A;  3PHU A;  3D6S A;  2PRE A;  4FIP A;  4BOU A;  3CXC Z;  2YJ9 A;  1I6H I;  1PE6 A;  2XU3 A;  4N4Z A;  3CCM Z;  1VQO Z;  3KIF A;  3OF9 A;  1WZN A;  1CS8 A;  1VQ7 Z;  4D8B A;  1K73 2;  3IR7 A;  4YVA A;  4RNA A;  4IUM A;  3IHP A;  4PAD A;  5CVM A;  1W2B Z;  1YVB A;  5D1O A;  3HOX I;  2E01 A;  2YJB A;  3P5U A;  5K16 A;  2FTD A;  3FKI I;  3MTV A;  3BCN A;  3Q87 A;  3P5V A; 
#chains in the Genus database with same CATH homology
 2GU2 A;  1L1O C;  3CD6 Z;  4MXU A;  2JA8 I;  3GTM S;  3S1Q I;  2NVQ I;  4RF1 A;  4BOS A;  5A2Q b;  1Q7Y 1;  2Q51 A;  4BBS I;  3GKQ A;  2R7Z I;  3T4N B;  4R3D A;  2QRE B;  3IF8 A;  1Z02 A;  4X6A I;  4PT5 A;  1ZH1 A;  3MP2 A;  3TRK A;  1RO4 A;  3RZO I;  4P16 A;  4RV9 A;  2RIQ A;  3S14 I;  3NH8 A;  3HOW I;  2WB1 A;  1Q82 1;  3GCF A;  5E6J A;  1M90 1;  4A3J I;  2AKL A;  2VUG A;  1PVJ A;  1Y1W I;  5FLX b;  4AYB A;  4A5U A;  2OTL 1;  1TFI A;  3P5J B;  2QA4 1;  3OW2 Y;  4A3L I;  2NVY I;  2DE6 A;  3CC2 1;  2OTJ 1;  1YIJ Z;  5T64 A;  1DL6 A;  1NUI A;  3MZL B;  2FE8 A;  3F3P C;  3CQZ I;  1KQS Y;  2P28 A;  1ZB8 A;  1I50 I;  2K5R A;  2NVT I;  1YZB A;  3OQC A;  4E32 A;  1S72 Z;  2OOY B;  1X0T A;  1NJI 1;  2O53 A;  2E2I I;  2K3R A;  1VQ6 Z;  4MI7 A;  3OW2 Z;  4E2W A;  2BTW B;  1M90 2;  5D1P A;  1ZB9 A;  3CXC Y;  2R92 I;  2QLV B;  2AGA A;  1KC8 1;  1TWG I;  4BXX I;  3S16 I;  3CMA 1;  3CCQ 1;  3CCJ 1;  2B63 I;  3PO2 I;  1VQ4 Z;  2VF1 A;  4A3F I;  4Y52 I;  2E2H I;  4NBE A;  5KO3 A;  4HGZ A;  1TWH I;  3GTQ I;  5IP7 I;  4M0W A;  4CL1 A;  5FLM I;  4A3I I;  3CCV Z;  2PK7 A;  2DOS A;  3NFZ A;  1TWC I;  1TWF I;  1KD1 1;  4HXD B;  5EZQ A;  2J7Q A;  1X3W A;  2V8J A;  3TE5 B;  1K73 1;  3G4S 1;  4BY7 I;  2YU9 I;  4NBF A;  3CCS Z;  1VQ6 1;  1LQL A;  2J6A A;  4MD9 A;  3CCL 1;  2V8K A;  4OVZ B;  1VQM Z;  2P3Y A;  1VQ8 Z;  3RNV A;  4D8E A;  3E9S A;  1Z01 A;  3CCS 1;  4D8I A;  2PM9 A;  3G4S Z;  3G71 Z;  4RKX A;  2EGT A;  3VTN A;  3BG0 B;  3I56 Z;  3CCE Z;  3PRM A;  1KRL A;  2VUM I;  1UKF A;  4NBC A;  1YHQ Z;  3IFU A;  2WAQ A;  2LIY A;  5LL6 f;  3HOV I;  3PRP A;  3JAM f;  3CCE 1;  3GTL I;  3QWU A;  3JAM b;  3F3F C;  2PMZ A;  1YI2 Z;  4IP3 A;  2IZ4 A;  3HOU I;  3KIH A;  3CC7 Z;  4NBD A;  3GTM I;  1QVF Z;  4NB8 A;  2BTW A;  4XX2 A;  2KPI A;  4DK1 A;  5C4X I;  4NBB A;  2JA6 I;  1YIT Z;  1VQL 1;  5AN9 F;  4BBR I;  2Z84 A;  3CCU 1;  2O4H A;  2HU9 A;  3W31 A;  3GTK I;  3NH4 A;  2KI7 B;  1Q81 2;  2JA7 I;  3S15 I;  3G6E Z;  3IX0 A;  3GTP I;  3S2H I;  4E31 A;  1W2B Y;  1YIT 1;  3S1N I;  1USP A;  4QTT A;  1VQ9 Z;  1QVF Y;  3I55 1;  3TDH B;  3RZD I;  1YJW Z;  1RNI A;  4A3K I;  4RF0 A;  5C4J I;  1QVG Y;  5IT9 f;  3I55 Z;  1VQN 1;  2JNY A;  1YIJ 1;  3GTO I;  4MH4 A;  2QRD B;  2QRC B;  1K83 I;  4HH4 A;  3I4M I;  4BOZ A;  1K8A 1;  1YI2 1;  3CCJ Z;  1DKI A;  3MZK B;  3GTG I;  4RVD A;  4MRI A;  3I56 1;  3NDI A;  3BB7 A;  3CCR Z;  2JTC A;  1Q86 1;  2QEX 1;  5T6B A;  2RT9 A;  1QF8 A;  2M6N A;  1YHQ 1;  3PSE A;  4OVZ A;  3M4O I;  3K7A I;  1VQ8 1;  3TMP A;  3CD6 1;  4BOP A;  3LUS A;  4MD7 A;  3CCL Z;  2GTH A;  4DQY B;  2F4M A;  4ZTB A;  2F4O A;  1VQM 1;  1YJ9 Z;  1SFO I;  2R93 I;  4XZX A;  4A3B I;  3CPW Y;  3S1M I;  4BY1 I;  3MJ5 A;  3HKZ A;  3FQM A;  1JJ2 Z;  4NBG A;  3W30 A;  3NH5 A;  1K8A 2;  4OW0 A;  1YUK A;  5C44 I;  2DE5 A;  2E9H A;  2QKD A;  3EED A;  4NH1 C;  2JRI A;  2OTL Z;  3CCV 1;  4A3G I;  2JR6 A;  3S2D I;  1VQ7 1;  3CPW Z;  1JJ2 Y;  4MD8 A;  1VQN Z;  3O65 A;  5IT9 b;  1Y1V I;  1YJW 1;  4A3D I;  4E33 A;  4Y7N I;  3FQQ A;  1N2F A;  1Q86 2;  3J81 b;  3J81 f;  2YAD A;  4A3E I;  1VQP 1;  3ZNH A;  1WCM I;  3PT2 A;  4A3M I;  4NFR A;  3VMI A;  2J7Q C;  1JWH C;  2JUB A;  1Q82 2;  4NBH A;  3S1R I;  1VQL Z;  5EZS A;  2RBL A;  3BY4 A;  4WUR A;  3EER A;  1R9T I;  1USP B;  4S1T A;  2Y0S A;  3PO3 I;  1S72 1;  4RVF A;  1VQ5 Z;  3J80 f;  4EWC A;  2IZ3 A;  3CCQ Z;  1Y1V S;  3H3V J;  1KQS Z;  1RO0 A;  2ZAE B;  4GUA A;  3ESW A;  5A2Q f;  4NBA A;  4RS4 A;  4BOQ A;  1S7M A;  1I3Q I;  1RQF A;  1RLY A;  5C3E I;  2RPR A;  4RVH A;  1K9M 2;  1VQK Z;  2E2J I;  4REZ A;  3CME 1;  2G2K A;  1KD1 2;  1M1K 1;  2QR1 B;  2HWK A;  3H0G I;  2RHB A;  3CC4 1;  4A3C I;  1YJ9 1;  4E2X A;  4MON A;  3CC7 1;  3PO3 S;  3I07 A;  3CME Z;  5IP9 I;  2V8I A;  1N8R 2;  5JZE A;  1YJN 1;  2OOX B;  1YJN Z;  2QA4 Z;  3MON A;  5D1O B;  1NJI 2;  2I3C A;  2R6M A;  1X3Z A;  3CC2 Z;  2OTJ Z;  4QTU A;  3U50 C;  3GTJ I;  3HOZ I;  4E30 A;  3M3Y I;  1N8R 1;  2NVX I;  3BG1 B;  1P9N A;  2JS4 A;  4NOZ A;  2W04 A;  1NP6 A;  1VQ5 1;  1TWA I;  3VMG A;  3VMH A;  2DE7 A;  3PHW A;  2BU3 A;  1KC8 2;  1PFT A;  2JA5 I;  1WW9 A;  3C0R A;  2GTI A;  4E2Z A;  2H85 A;  3CMA Z;  1QVG Z;  3CCM 1;  1VLA A;  1VQ9 1;  3S17 I;  3J7A 4;  5FLX f;  3NDJ A;  1K9M 1;  1Z03 A;  4DGL A;  2LFU A;  4HGY A;  2JMO A;  1M1K 2;  4E2Y A;  3G6E 1;  1WII A;  3D9X A;  3B21 A;  2BJO A;  3VB9 A;  2UZJ A;  3G71 1;  1VQP Z;  2W03 A;  5CM2 M;  3CCU Z;  1YUA A;  4A93 I;  1Q7Y 2;  1Q81 1;  2M48 A;  3CC4 Z;  3J80 b;  3D6W A;  2HF1 A;  3I4N I;  4NB9 A;  4RVG A;  1VQO 1;  3BBA A;  3HOY I;  2OZK A;  4MM3 B;  1VQK 1;  1VQ4 1;  1ML8 A;  4TNU A;  2QEX Z;  5T67 A;  3CCR 1;  1QYP A;  3PHX A;  2Q4Z A;  1RO2 A;  3PHU A;  4BOU A;  3CXC Z;  1I6H I;  3CCM Z;  1VQO Z;  3KIF A;  1VQ7 Z;  4D8B A;  1K73 2;  4RNA A;  4IUM A;  1W2B Z;  5D1O A;  3HOX I;  3MTV A;  3FKI I;  3Q87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...