3IFUA

The crystal structure of porcine reproductive and respiratory syndrome virus (prrsv) leader protease nsp1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
175
structure length
175
Chain Sequence
DRCTCTPNARVFVAEGQVYCTRCLSARSLLPLNLQVPELGVLGLFYRPEEPLRWTLPRAFPTVECSPAGACWLSAIFPIARMTSGNLNFQQRMVRVAAEIYRAGQLTPTVLKTLQVYERGCRWYPIVGPVPGVGVYANSLHVSDKPFPGATHVLTNLPLPQRPKPEDFCPFECAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of porcine reproductive and respiratory syndrome virus leader protease Nsp1alpha
pubmed doi rcsb
source organism Porcine reproductive and respiratory syndrome virus
molecule tags Transcription
molecule keywords Non-structural protein
total genus 37
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2009-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05410 Peptidase_C31 Porcine arterivirus-type cysteine proteinase alpha
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.250 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ifuA01
3.90.70.60 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3ifuA02
3IFUA
chains in the Genus database with same CATH superfamily
1JJ2Z 1YJNZ 2G6DA 1K9M1 2I3CA 4W5CA 4BS6A 3VMGA 3LXSA 3CCUZ 2OOYB 3S3QA 3O65A 1ITOA 5E6JA 1RLYA 2OOXB 3NH8A 3QWUA 1KC81 1EWPA 1EWOA 9PAPA 3G6E1 3RZDI 3CCSZ 2BJOA 1YITZ 1NJI2 1U9WA 2AIMA 4CZWA 3HOUI 2OTJ1 3G4S1 2DE6A 4E2ZA 2V45A 1YI2Z 5CVMA 3BG0B 5D1OB 2Q4ZA 2DC8A 1NB5A 4OELA 2JRIA 3PO2I 1K732 4CDCB 1YUAA 1Z01A 5FLXf 1MIRA 1NQCA 4BOSA 3D2LA 3OISA 1SFOI 4OW0A 4W4UA 5PADA 1WJ2A 1GECE 2YJ9A 1TU6A 3KSEA 2B63I 4QRVA 3N4CA 1VQ4Z 1F2BA 2HH5A 1JWHC 3MORA 3PDFA 3NHEA 1PVJA 3PO3S 1AYVA 4QRGA 5A24A 3PRMA 3RNVA 2QA41 1S7MA 3CPWZ 3CC71 2R9NA 2Y0SA 3J80f 2ARYA 3ZNHA 1AA6A 4CL1A 2ACTA 1Q862 1TL9A 2GTHA 4BXXI 3IOQA 2GTIA 1RO0A 2DC7A 2QREB 2VPYA 4NBHA 3D6SA 1PCIA 3H6SA 4DMXA 4YYQA 1Z03A 2W03A 4ZUXU 4E33A 3CCMZ 2PK7A 4BBSI 4M0WA 3GTPI 1I50I 4X6JA 1DF0A 4N4ZA 1Q7Y1 1S721 2M48A 4HXDB 1AYWA 3VMHA 3O1GA 1QXPA 4HGYA 1VQ41 3HOVI 3CCVZ 3IEJA 2VUMI 2JS4A 1Y1VS 2FTDA 3I3TA 4K7CA 3PBHA 2R7ZI 3K7AI 1Q861 3CMAZ 1KD12 3U50C 1A6RA 3TNXA 2AUXA 5JZEA 1EWMA 3CD61 1R9TI 2GHUA 1VSNA 4BOQA 3TDHB 2WBFX 1Q812 2PBHA 2JNYA 1Q821 1VQ61 3KIFA 3IR7A 3GTOI 2AGAA 2IZ3A 3W30A 4OEMA 3MJ5A 2CIOA 4XUIA 1YI21 4NBBA 3WXFA 2XU3A 4KLBA 3CMEZ 4A3JI 3OW2Y 2R9CA 1QVGZ 3H3VJ 3H0GI 4P16A 2HF1A 2JQFR 2R9FA 3CPWY 1VQK1 3V6EA 2IPPB 2DE7A 2E03A 1JJ2Y 1NLJA 2DC9A 1CTEA 4NBAA 3PSEA 2DOSA 4XZXA 1VQM1 3E1ZB 3QT4A 4YVAA 1QVFY 3JAMb 3H89A 1M6DA 3LFYA 3D6WA 4CDFB 2EGTA 1ZB9A 3S3RA 3CCE1 1JQPA 4RVHA 4A3MI 1PADA 1S4VA 4A3II 4E32A 2QEXZ 3G711 3P5VA 4NBDA 3CCQ1 2F7DA 3FQMA 3H8CA 1AU0A 3QJ3A 1NPZA 1TWGI 2P3YA 1K8A1 1YJ91 1PPNA 2JUBA 2IV2X 2JIRA 2B1MA 1VLAA 1X3ZA 1KHQA 4NBFA 1M1K2 3F75A 1ZCMA 3RZOI 4X6HA 3CCJZ 2V8KA 4XR7A 2GU2A 3PRPA 3HOZI 4G54A 3ESWA 3LUSA 2NVQI 3GTQI 2H7JA 5FLXb 3CBJA 3IHPA 1YK7A 4N8WA 2P28A 1YUKA 2PNSA 1KHPA 2OZ2A 1Y1WI 3I4MI 4AYBA 1RNIA 2Z84A 4WA6A 3CME1 2DE5A 2G8EA 3USVA 3K24A 5AN9F 1DKIA 4YYWA 2YJCA 1YT7A 2JR6A 3U8EA 2E00A 1M901 3B79A 3H7DA 2BTWA 3IMAA 4RY2A 1QXFA 1Q822 2WAQA 4MD8A 1YJ9Z 1I6HI 2RT9A 4BOUA 1SP4B 7PCKA 3HKZA 4CDDB 1F29A 5C44I 3CCL1 4YYUA 4OVZA 4BS5A 5C4XI 3MONA 2AYOA 2Y6EA 3TRKA 2E2II 1ME3A 1K8A2 5T67A 3CCEZ 2JA8I 3BBAA 4FJCA 3OF9A 1WCMI 5LL6f 5D1OA 5IT9b 1Y4HA 3RVWA 4RF1A 1VQ8Z 1CVZA 3KIHA 2K5RA 1BQIA 4MD7A 4HGZA 5EZQA 2FUDA 4NBGA 4A3CI 1KRLA 3D9XA 1HUCB 5IP7I 1YJW1 4BQVA 1W2BY 1PXVA 4PT5A 4A3DI 1YIJZ 3FKII 2OULA 2BDLA 3K8UA 3S16I 4D8BA 3KWZA 1FDIA 1CB5A 1NP6A 3BOWA 3PHWA 1XKGA 2DC6A 5T64A 3CCLZ 1VJVA 1YALA 1Q6KA 3PT2A 1AECA 2DJGB 4HH4A 1TWAI 2XU5A 1GCBA 3I55Z 1ZIVA 4E2XA 3E9SA 4I04A 2DCCA 4CDEB 2V8JA 2OZKA 3CC7Z 4DMYA 2O4HA 4A3LI 3KW9A 4FIPA 4FK5A 1USPA 2JIPA 3CQZI 3I4NI 1YVBA 1NL6A 1VQ81 4P6EA 3ZUAA 2BU3A 1VQMZ 3H8BA 1U9QX 3HWNA 3CH3X 3TMPA 3O0UA 1NB3A 3J81b 1CJLA 3VMIA 1BY8A 1POPA 2P86A 5CVNB 1BP4A 3S1QI 2IBIA 3J80b 1RQFA 1ME4A 1U9VA 3GTJI 3PHXA 4R3DA 2NVYI 4YYRA 2RBLA 4NB9A 3CC21 1AIMA 1M1K1 4QTUA 4MH4A 3NDIA 4Y52I 3M4OI 4A3FI 2HXZA 3W31A 4Y7NI 3GTMI 2E7ZA 2W04A 1BGOA 2AVWA 3Q87A 4NOZA 3WXGA 4BOZA 2JIOA 2OTL1 2B1NA 4DK1A 2J7QC 3BB7A 4MZSA 2G2KA 3KFQA 4RVFA 3P5XA 1GLOA 1YIJ1 2V8IA 1RO4A 1X3WA 2VF1A 4I07A 4N79A 4PP1A 3I561 1KQSZ 2R93I 1VQ51 1P9NA 4AXMA 2VPXA 3DF0A 2IZ4A 2ZAEB 2JA7I 2NVXI 3CCU1 2XU1A 3OVZA 3S14I 4NFRA 1WW9A 3CCV1 2VPWA 1MHWA 4OVZB 4P6GA 3S17I 1O0EA 1CPJA 4EWCA 3CH2X 4A5UA 1Q16A 3IUTA 3N3GA 3S1MI 1GMYA 1YZBA 3S2HI 1VQOZ 2DZYA 1PPPA 1UKFA 1VQNZ 3OQCA 2PADA 4MRIA 3CXCY 2FE8A 1QVFZ 1MEMA 4NBEA 4RS4A 2YJ2A 3M99A 4PI3A 4IP3A 1CQDA 5C3EI 3CCJ1 2YADA 2R9MA 3B21A 3MP2A 4GUAA 5F02A 2OTJZ 1FDOA 3K9MA 3HD3A 1ZH1A 1MS6A 1QMYA 3F5VA 3EERA 5T6BA 3RVVA 4MSXA 2R6MA 3P5JB 5A2Qf 3CC2Z 1KFUL 1VQ6Z 4A93I 5C4JI 2K3RA 2RPRA 5IT9f 1KQSY 1AU2A 2P0RA 1ATKA 4QBBA 4BY7I 1QOLA 1X0TA 3CCQZ 2JIMA 3J81f 2LFUA 2RHBA 1STFE 4MONA 2AUZA 4RVDA 3GTKI 5J94A 3BC3A 1RO2A 4NBCA 1MEGA 3GTMS 4BPVA 2KI7B 5CHTA 1VQ91 1S72Z 4PP2E 2HWKA 3S2DI 1WZNA 2PREA 2Y5BA 1L1OC 1NUIA 3I56Z 1VQKZ 1SNKA 4MM3B 1F2AA 3MTNA 2JIQA 2G7YA 3BWKA 4S1TA 3I06A 4BOPA 3CCM1 4MI7A 4IUMA 3I07A 1N2FA 3HOYI 2FRAA 3ERVA 1N8R1 4A3EI 1VQN1 3PNRA 2F4MA 3PHUA 2NQDB 2DJFB 1VQO1 2DCAA 2J7QA 3WXEA 2E9HA 4Q8HA 2QA4Z 1TFIA 4E2YA 2YU9I 1ML8A 1KC82 2HD5A 3KX1A 3MZKB 2QR1B 1YJWZ 2FO5A 2QLVB 1Q811 4D8EA 4A3KI 3M3YI 4QTTA 5CM2M 2FT2A 2BTWB 3S1RI 2OP3A 1Z02A 1YJN1 1KFXL 1PPOA 1QDQA 2KPIA 3I551 1MDWA 1VQP1 4ZTBA 1CSBB 1VQ7Z 3OVXA 3S1NI 3PO3I 5FPWA 3IF8A 1CS8A 1F2CA 1PPDA 1Y8CA 1AYUA 1K731 4RF0A 4E2WA 4E31A 2LEXA 3AI8A 3NFZA 2O6XA 4MZOA 1K83I 1Q7Y2 1QYPA 5EZSA 1K3BB 3MZLB 1VQLZ 2NVTI 4AXLA 2LIYA 3OW2Z 2AYDA 2R9OA 2AS8A 4D8IA 5A2Qb 2H85A 3FQQA 1YIT1 4X6IA 4MXUA 3MHHA 4W5BA 2GFOA 3G4SZ 5JA7A 4Q8GA 4DGLA 3G6EZ 4NH1C 2CB5A 3N3KA 2FRQA 2AYNA 2JA5I 1EWLA 2DCDA 1VQ71 1TWCI 4NB8A 1VQPZ 1TWFI 8PCHA 1KD11 1Y1VI 1QF8A 4YV8A 2JA6I 2E01A 4HWYA 4RKXA 2QRDB 2BDZA 3EEDA 1PFTA 1CV8A 3HOXI 1PIPA 2UZJA 4REZA 1VQL1 3BCNA 4BSQA 1THEA 1DL6A 3HOWI 5IP9I 2J6AA 3GCBA 4RNAA 4QRXA 2C0YA 3T4NB 3NDJA 3RVXA 4WURA 2VUGA 1FH0A 1IWDA 5JH3A 2XU4A 1EF7A 5EF4A 3CC4Z 3BPMA 4TNUA 1PBHA 3HHAA 2M6NA 3GCFA 2G8JA 2E02A 3QSDA 3C0RA 4RVGA 3JAMf 3NH5A 1PE6A 2NQAA 2ATOA 3CXCZ 1TLOA 2VHSA 2F1GA 1YHQZ 5EGWA 2R6NA 4I05A 2F4OA 1YHQ1 2P7UA 3MHSA 2FYEA 3KKUA 3VTNA 2VHFA 4A3GI 1NJI1 3PW3A 1SIWA 5FLMI 1YK8A 2YJ8A 3F3PC 2YJBA 3MTVA 1Y08A 2DZZA 3CBKA 3IV2A 1N8R2 3IFUA 4BY1I 3GTGI 5CVOB 3CCRZ 3TE5B 3P5UA 2E2JI 3HHIA 5CHVA 1QVGY 2VPZA 3C9EA 1LQLA 5KO3A 5D1PA 4PADA 2JTCA 1AU4A 1I3QI 1VQ9Z 4YYSA 3CCS1 2JQGR 2WB1A 5K16A 1KXRA 2R92I 2QRCB 2FQ9A 1AU3A 1VQ5Z 1ICFA 2DCBA 3G71Z 2PM9A 2O53A 2RIQA 3CMA1 4MD9A 3BG1B 2Q51A 2AKLA 2NQIA 1U5IA 1M902 3P5WA 4QH6A 3IX0A 2NQGA 2QKDA 4DQYB 2OTLZ 2HHNA 2HU9A 3CC41 2JMOA 2NAPA 2V3VA 1K9M2 1WIIA 4A3BI 3CCR1 3GKQA 1DEUA 1U9XA 4YYVA 1USPB 3V6CA 3BY4A 3GTLI 1TWHI 3J7A4 6PADA 3CD6Z 4XX2A 4E30A 3KWBX 1W2BZ 4X6AI 3VB9A 3OF8A 1ZB8A 2QEX1 3S15I 4RV9A 4BBRI 3NH4A 2AU1A 1X9YA 2PMZA 3BPFA 3F3FC 2E2HI
chains in the Genus database with same CATH topology
1JJ2Z 1YJNZ 1K9M1 2I3CA 3VMGA 3CCUZ 2OOYB 3O65A 5E6JA 1RLYA 2OOXB 3NH8A 3QWUA 1KC81 3G6E1 3RZDI 3CCSZ 2BJOA 1YITZ 1NJI2 3HOUI 2OTJ1 3G4S1 2DE6A 4E2ZA 1YI2Z 3BG0B 5D1OB 2Q4ZA 2JRIA 3PO2I 1K732 1YUAA 1Z01A 5FLXf 4BOSA 1SFOI 4OW0A 2B63I 1VQ4Z 1JWHC 1PVJA 3PO3S 3PRMA 3RNVA 2QA41 1S7MA 3CPWZ 3CC71 2Y0SA 3J80f 3ZNHA 4CL1A 1Q862 2GTHA 4BXXI 2GTIA 1RO0A 2QREB 4NBHA 1Z03A 2W03A 4E33A 3CCMZ 2PK7A 4BBSI 4M0WA 3GTPI 1I50I 1Q7Y1 1S721 2M48A 4HXDB 3VMHA 4HGYA 1VQ41 3HOVI 3CCVZ 2VUMI 2JS4A 1Y1VS 2R7ZI 3K7AI 1Q861 3CMAZ 1KD12 3U50C 5JZEA 3CD61 1R9TI 4BOQA 3TDHB 1Q812 2JNYA 1Q821 1VQ61 3KIFA 3GTOI 2AGAA 2IZ3A 3W30A 3MJ5A 1YI21 4NBBA 3CMEZ 4A3JI 3OW2Y 1QVGZ 3H3VJ 3H0GI 4P16A 2HF1A 3CPWY 1VQK1 2DE7A 1JJ2Y 4NBAA 3PSEA 2DOSA 4XZXA 1VQM1 1QVFY 3JAMb 3D6WA 2EGTA 1ZB9A 3CCE1 4RVHA 4A3MI 4A3II 4E32A 2QEXZ 3G711 4NBDA 3CCQ1 3FQMA 1TWGI 2P3YA 1K8A1 1YJ91 2JUBA 1VLAA 1X3ZA 4NBFA 1M1K2 3RZOI 3CCJZ 2V8KA 2GU2A 3PRPA 3HOZI 3ESWA 3LUSA 2NVQI 3GTQI 5FLXb 2P28A 1YUKA 1Y1WI 3I4MI 4AYBA 1RNIA 2Z84A 3CME1 2DE5A 5AN9F 1DKIA 2JR6A 1M901 2BTWA 1Q822 2WAQA 4MD8A 1YJ9Z 1I6HI 2RT9A 4BOUA 3HKZA 5C44I 3CCL1 4OVZA 5C4XI 3MONA 3TRKA 2E2II 1K8A2 5T67A 3CCEZ 2JA8I 3BBAA 1WCMI 5LL6f 5D1OA 5IT9b 4RF1A 1VQ8Z 3KIHA 2K5RA 4MD7A 4HGZA 5EZQA 4NBGA 4A3CI 1KRLA 3D9XA 5IP7I 1YJW1 1W2BY 4PT5A 4A3DI 1YIJZ 3FKII 3S16I 4D8BA 1NP6A 3PHWA 5T64A 3CCLZ 3PT2A 4HH4A 1TWAI 3I55Z 3E9SA 4E2XA 2V8JA 2OZKA 3CC7Z 2O4HA 4A3LI 1USPA 3CQZI 3I4NI 1VQ81 2BU3A 1VQMZ 3TMPA 3J81b 3VMIA 3S1QI 3J80b 1RQFA 3GTJI 3PHXA 4R3DA 2NVYI 2RBLA 4NB9A 3CC21 1M1K1 4QTUA 4MH4A 3NDIA 4Y52I 3M4OI 4A3FI 3W31A 4Y7NI 3GTMI 2W04A 3Q87A 4NOZA 4BOZA 2OTL1 4DK1A 2J7QC 3BB7A 2G2KA 4RVFA 1YIJ1 2V8IA 1RO4A 1X3WA 2VF1A 3I561 1KQSZ 2R93I 1VQ51 1P9NA 2IZ4A 2ZAEB 2JA7I 2NVXI 3CCU1 3S14I 4NFRA 1WW9A 3CCV1 4OVZB 3S17I 4EWCA 4A5UA 3S1MI 1YZBA 3S2HI 1VQOZ 1UKFA 1VQNZ 3OQCA 4MRIA 3CXCY 2FE8A 1QVFZ 4NBEA 4RS4A 4IP3A 5C3EI 3CCJ1 2YADA 3B21A 3MP2A 4GUAA 2OTJZ 1ZH1A 3EERA 5T6BA 2R6MA 3P5JB 5A2Qf 3CC2Z 1VQ6Z 4A93I 5C4JI 2K3RA 2RPRA 5IT9f 1KQSY 4BY7I 1X0TA 3CCQZ 3J81f 2LFUA 2RHBA 4MONA 4RVDA 3GTKI 1RO2A 4NBCA 3GTMS 2KI7B 1VQ91 1S72Z 2HWKA 3S2DI 1L1OC 1NUIA 3I56Z 1VQKZ 4MM3B 4S1TA 4BOPA 3CCM1 4MI7A 4IUMA 3I07A 1N2FA 3HOYI 1N8R1 4A3EI 1VQN1 2F4MA 3PHUA 1VQO1 2J7QA 2E9HA 2QA4Z 1TFIA 4E2YA 2YU9I 1ML8A 1KC82 3MZKB 2QR1B 1YJWZ 2QLVB 1Q811 4D8EA 4A3KI 3M3YI 4QTTA 5CM2M 2BTWB 3S1RI 1Z02A 1YJN1 2KPIA 3I551 4ZTBA 1VQP1 1VQ7Z 3S1NI 3PO3I 3IF8A 1K731 4RF0A 4E2WA 4E31A 3NFZA 1K83I 1Q7Y2 1QYPA 5EZSA 3MZLB 1VQLZ 2NVTI 2LIYA 3OW2Z 4D8IA 5A2Qb 2H85A 3FQQA 1YIT1 4MXUA 3G4SZ 4DGLA 3G6EZ 4NH1C 2JA5I 1VQ71 1TWCI 4NB8A 1VQPZ 1TWFI 1KD11 1Y1VI 1QF8A 2JA6I 4RKXA 2QRDB 3EEDA 1PFTA 3HOXI 2UZJA 4REZA 1VQL1 1DL6A 3HOWI 5IP9I 2J6AA 4RNAA 3T4NB 3NDJA 4WURA 2VUGA 3CC4Z 4TNUA 2M6NA 3GCFA 3C0RA 4RVGA 3JAMf 3NH5A 3CXCZ 1YHQZ 2F4OA 1YHQ1 3VTNA 4A3GI 1NJI1 5FLMI 3F3PC 3MTVA 1N8R2 3IFUA 4BY1I 3GTGI 3CCRZ 3TE5B 2E2JI 1QVGY 1LQLA 5KO3A 5D1PA 2JTCA 1I3QI 1VQ9Z 3CCS1 2WB1A 2R92I 2QRCB 1VQ5Z 3G71Z 2PM9A 2O53A 2RIQA 3CMA1 4MD9A 3BG1B 2Q51A 2AKLA 1M902 3IX0A 2QKDA 4DQYB 2OTLZ 2HU9A 3CC41 2JMOA 1K9M2 1WIIA 4A3BI 3CCR1 3GKQA 1USPB 3BY4A 3GTLI 1TWHI 3J7A4 3CD6Z 4XX2A 4E30A 1W2BZ 4X6AI 3VB9A 1ZB8A 2QEX1 3S15I 4RV9A 4BBRI 3NH4A 2PMZA 3F3FC 2E2HI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IFU A; 
#chains in the Genus database with same CATH topology
 1JJ2 Z;  1YJN Z;  2G6D A;  1K9M 1;  2I3C A;  4W5C A;  4BS6 A;  3VMG A;  3LXS A;  3CCU Z;  2OOY B;  3S3Q A;  3O65 A;  1ITO A;  5E6J A;  1RLY A;  2OOX B;  3NH8 A;  3QWU A;  1KC8 1;  1EWP A;  1EWO A;  9PAP A;  3G6E 1;  3RZD I;  3CCS Z;  2BJO A;  1YIT Z;  1NJI 2;  1U9W A;  2AIM A;  4CZW A;  3HOU I;  2OTJ 1;  3G4S 1;  2DE6 A;  4E2Z A;  2V45 A;  1YI2 Z;  5CVM A;  3BG0 B;  5D1O B;  2Q4Z A;  2DC8 A;  1NB5 A;  4OEL A;  2JRI A;  3PO2 I;  1K73 2;  4CDC B;  1YUA A;  1Z01 A;  5FLX f;  1MIR A;  1NQC A;  4BOS A;  3D2L A;  3OIS A;  1SFO I;  4OW0 A;  4W4U A;  5PAD A;  1WJ2 A;  1GEC E;  2YJ9 A;  1TU6 A;  3KSE A;  2B63 I;  4QRV A;  3N4C A;  1VQ4 Z;  1F2B A;  2HH5 A;  1JWH C;  3MOR A;  3PDF A;  3NHE A;  1PVJ A;  3PO3 S;  1AYV A;  4QRG A;  5A24 A;  3PRM A;  3RNV A;  2QA4 1;  1S7M A;  3CPW Z;  3CC7 1;  2R9N A;  2Y0S A;  3J80 f;  2ARY A;  3ZNH A;  1AA6 A;  4CL1 A;  2ACT A;  1Q86 2;  1TL9 A;  2GTH A;  4BXX I;  3IOQ A;  2GTI A;  1RO0 A;  2DC7 A;  2QRE B;  2VPY A;  4NBH A;  3D6S A;  1PCI A;  3H6S A;  4DMX A;  4YYQ A;  1Z03 A;  2W03 A;  4ZUX U;  4E33 A;  3CCM Z;  2PK7 A;  4BBS I;  4M0W A;  3GTP I;  1I50 I;  4X6J A;  1DF0 A;  4N4Z A;  1Q7Y 1;  1S72 1;  2M48 A;  4HXD B;  1AYW A;  3VMH A;  3O1G A;  1QXP A;  4HGY A;  1VQ4 1;  3HOV I;  3CCV Z;  3IEJ A;  2VUM I;  2JS4 A;  1Y1V S;  2FTD A;  3I3T A;  4K7C A;  3PBH A;  2R7Z I;  3K7A I;  1Q86 1;  3CMA Z;  1KD1 2;  3U50 C;  1A6R A;  3TNX A;  2AUX A;  5JZE A;  1EWM A;  3CD6 1;  1R9T I;  2GHU A;  1VSN A;  4BOQ A;  3TDH B;  2WBF X;  1Q81 2;  2PBH A;  2JNY A;  1Q82 1;  1VQ6 1;  3KIF A;  3IR7 A;  3GTO I;  2AGA A;  2IZ3 A;  3W30 A;  4OEM A;  3MJ5 A;  2CIO A;  4XUI A;  1YI2 1;  4NBB A;  3WXF A;  2XU3 A;  4KLB A;  3CME Z;  4A3J I;  3OW2 Y;  2R9C A;  1QVG Z;  3H3V J;  3H0G I;  4P16 A;  2HF1 A;  2JQF R;  2R9F A;  3CPW Y;  1VQK 1;  3V6E A;  2IPP B;  2DE7 A;  2E03 A;  1JJ2 Y;  1NLJ A;  2DC9 A;  1CTE A;  4NBA A;  3PSE A;  2DOS A;  4XZX A;  1VQM 1;  3E1Z B;  3QT4 A;  4YVA A;  1QVF Y;  3JAM b;  3H89 A;  1M6D A;  3LFY A;  3D6W A;  4CDF B;  2EGT A;  1ZB9 A;  3S3R A;  3CCE 1;  1JQP A;  4RVH A;  4A3M I;  1PAD A;  1S4V A;  4A3I I;  4E32 A;  2QEX Z;  3G71 1;  3P5V A;  4NBD A;  3CCQ 1;  2F7D A;  3FQM A;  3H8C A;  1AU0 A;  3QJ3 A;  1NPZ A;  1TWG I;  2P3Y A;  1K8A 1;  1YJ9 1;  1PPN A;  2JUB A;  2IV2 X;  2JIR A;  2B1M A;  1VLA A;  1X3Z A;  1KHQ A;  4NBF A;  1M1K 2;  3F75 A;  1ZCM A;  3RZO I;  4X6H A;  3CCJ Z;  2V8K A;  4XR7 A;  2GU2 A;  3PRP A;  3HOZ I;  4G54 A;  3ESW A;  3LUS A;  2NVQ I;  3GTQ I;  2H7J A;  5FLX b;  3CBJ A;  3IHP A;  1YK7 A;  4N8W A;  2P28 A;  1YUK A;  2PNS A;  1KHP A;  2OZ2 A;  1Y1W I;  3I4M I;  4AYB A;  1RNI A;  2Z84 A;  4WA6 A;  3CME 1;  2DE5 A;  2G8E A;  3USV A;  3K24 A;  5AN9 F;  1DKI A;  4YYW A;  2YJC A;  1YT7 A;  2JR6 A;  3U8E A;  2E00 A;  1M90 1;  3B79 A;  3H7D A;  2BTW A;  3IMA A;  4RY2 A;  1QXF A;  1Q82 2;  2WAQ A;  4MD8 A;  1YJ9 Z;  1I6H I;  2RT9 A;  4BOU A;  1SP4 B;  7PCK A;  3HKZ A;  4CDD B;  1F29 A;  5C44 I;  3CCL 1;  4YYU A;  4OVZ A;  4BS5 A;  5C4X I;  3MON A;  2AYO A;  2Y6E A;  3TRK A;  2E2I I;  1ME3 A;  1K8A 2;  5T67 A;  3CCE Z;  2JA8 I;  3BBA A;  4FJC A;  3OF9 A;  1WCM I;  5LL6 f;  5D1O A;  5IT9 b;  1Y4H A;  3RVW A;  4RF1 A;  1VQ8 Z;  1CVZ A;  3KIH A;  2K5R A;  1BQI A;  4MD7 A;  4HGZ A;  5EZQ A;  2FUD A;  4NBG A;  4A3C I;  1KRL A;  3D9X A;  1HUC B;  5IP7 I;  1YJW 1;  4BQV A;  1W2B Y;  1PXV A;  4PT5 A;  4A3D I;  1YIJ Z;  3FKI I;  2OUL A;  2BDL A;  3K8U A;  3S16 I;  4D8B A;  3KWZ A;  1FDI A;  1CB5 A;  1NP6 A;  3BOW A;  3PHW A;  1XKG A;  2DC6 A;  5T64 A;  3CCL Z;  1VJV A;  1YAL A;  1Q6K A;  3PT2 A;  1AEC A;  2DJG B;  4HH4 A;  1TWA I;  2XU5 A;  1GCB A;  3I55 Z;  1ZIV A;  4E2X A;  3E9S A;  4I04 A;  2DCC A;  4CDE B;  2V8J A;  2OZK A;  3CC7 Z;  4DMY A;  2O4H A;  4A3L I;  3KW9 A;  4FIP A;  4FK5 A;  1USP A;  2JIP A;  3CQZ I;  3I4N I;  1YVB A;  1NL6 A;  1VQ8 1;  4P6E A;  3ZUA A;  2BU3 A;  1VQM Z;  3H8B A;  1U9Q X;  3HWN A;  3CH3 X;  3TMP A;  3O0U A;  1NB3 A;  3J81 b;  1CJL A;  3VMI A;  1BY8 A;  1POP A;  2P86 A;  5CVN B;  1BP4 A;  3S1Q I;  2IBI A;  3J80 b;  1RQF A;  1ME4 A;  1U9V A;  3GTJ I;  3PHX A;  4R3D A;  2NVY I;  4YYR A;  2RBL A;  4NB9 A;  3CC2 1;  1AIM A;  1M1K 1;  4QTU A;  4MH4 A;  3NDI A;  4Y52 I;  3M4O I;  4A3F I;  2HXZ A;  3W31 A;  4Y7N I;  3GTM I;  2E7Z A;  2W04 A;  1BGO A;  2AVW A;  3Q87 A;  4NOZ A;  3WXG A;  4BOZ A;  2JIO A;  2OTL 1;  2B1N A;  4DK1 A;  2J7Q C;  3BB7 A;  4MZS A;  2G2K A;  3KFQ A;  4RVF A;  3P5X A;  1GLO A;  1YIJ 1;  2V8I A;  1RO4 A;  1X3W A;  2VF1 A;  4I07 A;  4N79 A;  4PP1 A;  3I56 1;  1KQS Z;  2R93 I;  1VQ5 1;  1P9N A;  4AXM A;  2VPX A;  3DF0 A;  2IZ4 A;  2ZAE B;  2JA7 I;  2NVX I;  3CCU 1;  2XU1 A;  3OVZ A;  3S14 I;  4NFR A;  1WW9 A;  3CCV 1;  2VPW A;  1MHW A;  4OVZ B;  4P6G A;  3S17 I;  1O0E A;  1CPJ A;  4EWC A;  3CH2 X;  4A5U A;  1Q16 A;  3IUT A;  3N3G A;  3S1M I;  1GMY A;  1YZB A;  3S2H I;  1VQO Z;  2DZY A;  1PPP A;  1UKF A;  1VQN Z;  3OQC A;  2PAD A;  4MRI A;  3CXC Y;  2FE8 A;  1QVF Z;  1MEM A;  4NBE A;  4RS4 A;  2YJ2 A;  3M99 A;  4PI3 A;  4IP3 A;  1CQD A;  5C3E I;  3CCJ 1;  2YAD A;  2R9M A;  3B21 A;  3MP2 A;  4GUA A;  5F02 A;  2OTJ Z;  1FDO A;  3K9M A;  3HD3 A;  1ZH1 A;  1MS6 A;  1QMY A;  3F5V A;  3EER A;  5T6B A;  3RVV A;  4MSX A;  2R6M A;  3P5J B;  5A2Q f;  3CC2 Z;  1KFU L;  1VQ6 Z;  4A93 I;  5C4J I;  2K3R A;  2RPR A;  5IT9 f;  1KQS Y;  1AU2 A;  2P0R A;  1ATK A;  4QBB A;  4BY7 I;  1QOL A;  1X0T A;  3CCQ Z;  2JIM A;  3J81 f;  2LFU A;  2RHB A;  1STF E;  4MON A;  2AUZ A;  4RVD A;  3GTK I;  5J94 A;  3BC3 A;  1RO2 A;  4NBC A;  1MEG A;  3GTM S;  4BPV A;  2KI7 B;  5CHT A;  1VQ9 1;  1S72 Z;  4PP2 E;  2HWK A;  3S2D I;  1WZN A;  2PRE A;  2Y5B A;  1L1O C;  1NUI A;  3I56 Z;  1VQK Z;  1SNK A;  4MM3 B;  1F2A A;  3MTN A;  2JIQ A;  2G7Y A;  3BWK A;  4S1T A;  3I06 A;  4BOP A;  3CCM 1;  4MI7 A;  4IUM A;  3I07 A;  1N2F A;  3HOY I;  2FRA A;  3ERV A;  1N8R 1;  4A3E I;  1VQN 1;  3PNR A;  2F4M A;  3PHU A;  2NQD B;  2DJF B;  1VQO 1;  2DCA A;  2J7Q A;  3WXE A;  2E9H A;  4Q8H A;  2QA4 Z;  1TFI A;  4E2Y A;  2YU9 I;  1ML8 A;  1KC8 2;  2HD5 A;  3KX1 A;  3MZK B;  2QR1 B;  1YJW Z;  2FO5 A;  2QLV B;  1Q81 1;  4D8E A;  4A3K I;  3M3Y I;  4QTT A;  5CM2 M;  2FT2 A;  2BTW B;  3S1R I;  2OP3 A;  1Z02 A;  1YJN 1;  1KFX L;  1PPO A;  1QDQ A;  2KPI A;  3I55 1;  1MDW A;  1VQP 1;  4ZTB A;  1CSB B;  1VQ7 Z;  3OVX A;  3S1N I;  3PO3 I;  5FPW A;  3IF8 A;  1CS8 A;  1F2C A;  1PPD A;  1Y8C A;  1AYU A;  1K73 1;  4RF0 A;  4E2W A;  4E31 A;  2LEX A;  3AI8 A;  3NFZ A;  2O6X A;  4MZO A;  1K83 I;  1Q7Y 2;  1QYP A;  5EZS A;  1K3B B;  3MZL B;  1VQL Z;  2NVT I;  4AXL A;  2LIY A;  3OW2 Z;  2AYD A;  2R9O A;  2AS8 A;  4D8I A;  5A2Q b;  2H85 A;  3FQQ A;  1YIT 1;  4X6I A;  4MXU A;  3MHH A;  4W5B A;  2GFO A;  3G4S Z;  5JA7 A;  4Q8G A;  4DGL A;  3G6E Z;  4NH1 C;  2CB5 A;  3N3K A;  2FRQ A;  2AYN A;  2JA5 I;  1EWL A;  2DCD A;  1VQ7 1;  1TWC I;  4NB8 A;  1VQP Z;  1TWF I;  8PCH A;  1KD1 1;  1Y1V I;  1QF8 A;  4YV8 A;  2JA6 I;  2E01 A;  4HWY A;  4RKX A;  2QRD B;  2BDZ A;  3EED A;  1PFT A;  1CV8 A;  3HOX I;  1PIP A;  2UZJ A;  4REZ A;  1VQL 1;  3BCN A;  4BSQ A;  1THE A;  1DL6 A;  3HOW I;  5IP9 I;  2J6A A;  3GCB A;  4RNA A;  4QRX A;  2C0Y A;  3T4N B;  3NDJ A;  3RVX A;  4WUR A;  2VUG A;  1FH0 A;  1IWD A;  5JH3 A;  2XU4 A;  1EF7 A;  5EF4 A;  3CC4 Z;  3BPM A;  4TNU A;  1PBH A;  3HHA A;  2M6N A;  3GCF A;  2G8J A;  2E02 A;  3QSD A;  3C0R A;  4RVG A;  3JAM f;  3NH5 A;  1PE6 A;  2NQA A;  2ATO A;  3CXC Z;  1TLO A;  2VHS A;  2F1G A;  1YHQ Z;  5EGW A;  2R6N A;  4I05 A;  2F4O A;  1YHQ 1;  2P7U A;  3MHS A;  2FYE A;  3KKU A;  3VTN A;  2VHF A;  4A3G I;  1NJI 1;  3PW3 A;  1SIW A;  5FLM I;  1YK8 A;  2YJ8 A;  3F3P C;  2YJB A;  3MTV A;  1Y08 A;  2DZZ A;  3CBK A;  3IV2 A;  1N8R 2;  3IFU A;  4BY1 I;  3GTG I;  5CVO B;  3CCR Z;  3TE5 B;  3P5U A;  2E2J I;  3HHI A;  5CHV A;  1QVG Y;  2VPZ A;  3C9E A;  1LQL A;  5KO3 A;  5D1P A;  4PAD A;  2JTC A;  1AU4 A;  1I3Q I;  1VQ9 Z;  4YYS A;  3CCS 1;  2JQG R;  2WB1 A;  5K16 A;  1KXR A;  2R92 I;  2QRC B;  2FQ9 A;  1AU3 A;  1VQ5 Z;  1ICF A;  2DCB A;  3G71 Z;  2PM9 A;  2O53 A;  2RIQ A;  3CMA 1;  4MD9 A;  3BG1 B;  2Q51 A;  2AKL A;  2NQI A;  1U5I A;  1M90 2;  3P5W A;  4QH6 A;  3IX0 A;  2NQG A;  2QKD A;  4DQY B;  2OTL Z;  2HHN A;  2HU9 A;  3CC4 1;  2JMO A;  2NAP A;  2V3V A;  1K9M 2;  1WII A;  4A3B I;  3CCR 1;  3GKQ A;  1DEU A;  1U9X A;  4YYV A;  1USP B;  3V6C A;  3BY4 A;  3GTL I;  1TWH I;  3J7A 4;  6PAD A;  3CD6 Z;  4XX2 A;  4E30 A;  3KWB X;  1W2B Z;  4X6A I;  3VB9 A;  3OF8 A;  1ZB8 A;  2QEX 1;  3S15 I;  4RV9 A;  4BBR I;  3NH4 A;  2AU1 A;  1X9Y A;  2PMZ A;  3BPF A;  3F3F C;  2E2H I; 
#chains in the Genus database with same CATH homology
 1JJ2 Z;  1YJN Z;  1K9M 1;  2I3C A;  3VMG A;  3CCU Z;  2OOY B;  3O65 A;  5E6J A;  1RLY A;  2OOX B;  3NH8 A;  3QWU A;  1KC8 1;  3G6E 1;  3RZD I;  3CCS Z;  2BJO A;  1YIT Z;  1NJI 2;  3HOU I;  2OTJ 1;  3G4S 1;  2DE6 A;  4E2Z A;  1YI2 Z;  3BG0 B;  5D1O B;  2Q4Z A;  2JRI A;  3PO2 I;  1K73 2;  1YUA A;  1Z01 A;  5FLX f;  4BOS A;  1SFO I;  4OW0 A;  2B63 I;  1VQ4 Z;  1JWH C;  1PVJ A;  3PO3 S;  3PRM A;  3RNV A;  2QA4 1;  1S7M A;  3CPW Z;  3CC7 1;  2Y0S A;  3J80 f;  3ZNH A;  4CL1 A;  1Q86 2;  2GTH A;  4BXX I;  2GTI A;  1RO0 A;  2QRE B;  4NBH A;  1Z03 A;  2W03 A;  4E33 A;  3CCM Z;  2PK7 A;  4BBS I;  4M0W A;  3GTP I;  1I50 I;  1Q7Y 1;  1S72 1;  2M48 A;  4HXD B;  3VMH A;  4HGY A;  1VQ4 1;  3HOV I;  3CCV Z;  2VUM I;  2JS4 A;  1Y1V S;  2R7Z I;  3K7A I;  1Q86 1;  3CMA Z;  1KD1 2;  3U50 C;  5JZE A;  3CD6 1;  1R9T I;  4BOQ A;  3TDH B;  1Q81 2;  2JNY A;  1Q82 1;  1VQ6 1;  3KIF A;  3GTO I;  2AGA A;  2IZ3 A;  3W30 A;  3MJ5 A;  1YI2 1;  4NBB A;  3CME Z;  4A3J I;  3OW2 Y;  1QVG Z;  3H3V J;  3H0G I;  4P16 A;  2HF1 A;  3CPW Y;  1VQK 1;  2DE7 A;  1JJ2 Y;  4NBA A;  3PSE A;  2DOS A;  4XZX A;  1VQM 1;  1QVF Y;  3JAM b;  3D6W A;  2EGT A;  1ZB9 A;  3CCE 1;  4RVH A;  4A3M I;  4A3I I;  4E32 A;  2QEX Z;  3G71 1;  4NBD A;  3CCQ 1;  3FQM A;  1TWG I;  2P3Y A;  1K8A 1;  1YJ9 1;  2JUB A;  1VLA A;  1X3Z A;  4NBF A;  1M1K 2;  3RZO I;  3CCJ Z;  2V8K A;  2GU2 A;  3PRP A;  3HOZ I;  3ESW A;  3LUS A;  2NVQ I;  3GTQ I;  5FLX b;  2P28 A;  1YUK A;  1Y1W I;  3I4M I;  4AYB A;  1RNI A;  2Z84 A;  3CME 1;  2DE5 A;  5AN9 F;  1DKI A;  2JR6 A;  1M90 1;  2BTW A;  1Q82 2;  2WAQ A;  4MD8 A;  1YJ9 Z;  1I6H I;  2RT9 A;  4BOU A;  3HKZ A;  5C44 I;  3CCL 1;  4OVZ A;  5C4X I;  3MON A;  3TRK A;  2E2I I;  1K8A 2;  5T67 A;  3CCE Z;  2JA8 I;  3BBA A;  1WCM I;  5LL6 f;  5D1O A;  5IT9 b;  4RF1 A;  1VQ8 Z;  3KIH A;  2K5R A;  4MD7 A;  4HGZ A;  5EZQ A;  4NBG A;  4A3C I;  1KRL A;  3D9X A;  5IP7 I;  1YJW 1;  1W2B Y;  4PT5 A;  4A3D I;  1YIJ Z;  3FKI I;  3S16 I;  4D8B A;  1NP6 A;  3PHW A;  5T64 A;  3CCL Z;  3PT2 A;  4HH4 A;  1TWA I;  3I55 Z;  3E9S A;  4E2X A;  2V8J A;  2OZK A;  3CC7 Z;  2O4H A;  4A3L I;  1USP A;  3CQZ I;  3I4N I;  1VQ8 1;  2BU3 A;  1VQM Z;  3TMP A;  3J81 b;  3VMI A;  3S1Q I;  3J80 b;  1RQF A;  3GTJ I;  3PHX A;  4R3D A;  2NVY I;  2RBL A;  4NB9 A;  3CC2 1;  1M1K 1;  4QTU A;  4MH4 A;  3NDI A;  4Y52 I;  3M4O I;  4A3F I;  3W31 A;  4Y7N I;  3GTM I;  2W04 A;  3Q87 A;  4NOZ A;  4BOZ A;  2OTL 1;  4DK1 A;  2J7Q C;  3BB7 A;  2G2K A;  4RVF A;  1YIJ 1;  2V8I A;  1RO4 A;  1X3W A;  2VF1 A;  3I56 1;  1KQS Z;  2R93 I;  1VQ5 1;  1P9N A;  2IZ4 A;  2ZAE B;  2JA7 I;  2NVX I;  3CCU 1;  3S14 I;  4NFR A;  1WW9 A;  3CCV 1;  4OVZ B;  3S17 I;  4EWC A;  4A5U A;  3S1M I;  1YZB A;  3S2H I;  1VQO Z;  1UKF A;  1VQN Z;  3OQC A;  4MRI A;  3CXC Y;  2FE8 A;  1QVF Z;  4NBE A;  4RS4 A;  4IP3 A;  5C3E I;  3CCJ 1;  2YAD A;  3B21 A;  3MP2 A;  4GUA A;  2OTJ Z;  1ZH1 A;  3EER A;  5T6B A;  2R6M A;  3P5J B;  5A2Q f;  3CC2 Z;  1VQ6 Z;  4A93 I;  5C4J I;  2K3R A;  2RPR A;  5IT9 f;  1KQS Y;  4BY7 I;  1X0T A;  3CCQ Z;  3J81 f;  2LFU A;  2RHB A;  4MON A;  4RVD A;  3GTK I;  1RO2 A;  4NBC A;  3GTM S;  2KI7 B;  1VQ9 1;  1S72 Z;  2HWK A;  3S2D I;  1L1O C;  1NUI A;  3I56 Z;  1VQK Z;  4MM3 B;  4S1T A;  4BOP A;  3CCM 1;  4MI7 A;  4IUM A;  3I07 A;  1N2F A;  3HOY I;  1N8R 1;  4A3E I;  1VQN 1;  2F4M A;  3PHU A;  1VQO 1;  2J7Q A;  2E9H A;  2QA4 Z;  1TFI A;  4E2Y A;  2YU9 I;  1ML8 A;  1KC8 2;  3MZK B;  2QR1 B;  1YJW Z;  2QLV B;  1Q81 1;  4D8E A;  4A3K I;  3M3Y I;  4QTT A;  5CM2 M;  2BTW B;  3S1R I;  1Z02 A;  1YJN 1;  2KPI A;  3I55 1;  4ZTB A;  1VQP 1;  1VQ7 Z;  3S1N I;  3PO3 I;  3IF8 A;  1K73 1;  4RF0 A;  4E2W A;  4E31 A;  3NFZ A;  1K83 I;  1Q7Y 2;  1QYP A;  5EZS A;  3MZL B;  1VQL Z;  2NVT I;  2LIY A;  3OW2 Z;  4D8I A;  5A2Q b;  2H85 A;  3FQQ A;  1YIT 1;  4MXU A;  3G4S Z;  4DGL A;  3G6E Z;  4NH1 C;  2JA5 I;  1VQ7 1;  1TWC I;  4NB8 A;  1VQP Z;  1TWF I;  1KD1 1;  1Y1V I;  1QF8 A;  2JA6 I;  4RKX A;  2QRD B;  3EED A;  1PFT A;  3HOX I;  2UZJ A;  4REZ A;  1VQL 1;  1DL6 A;  3HOW I;  5IP9 I;  2J6A A;  4RNA A;  3T4N B;  3NDJ A;  4WUR A;  2VUG A;  3CC4 Z;  4TNU A;  2M6N A;  3GCF A;  3C0R A;  4RVG A;  3JAM f;  3NH5 A;  3CXC Z;  1YHQ Z;  2F4O A;  1YHQ 1;  3VTN A;  4A3G I;  1NJI 1;  5FLM I;  3F3P C;  3MTV A;  1N8R 2;  3IFU A;  4BY1 I;  3GTG I;  3CCR Z;  3TE5 B;  2E2J I;  1QVG Y;  1LQL A;  5KO3 A;  5D1P A;  2JTC A;  1I3Q I;  1VQ9 Z;  3CCS 1;  2WB1 A;  2R92 I;  2QRC B;  1VQ5 Z;  3G71 Z;  2PM9 A;  2O53 A;  2RIQ A;  3CMA 1;  4MD9 A;  3BG1 B;  2Q51 A;  2AKL A;  1M90 2;  3IX0 A;  2QKD A;  4DQY B;  2OTL Z;  2HU9 A;  3CC4 1;  2JMO A;  1K9M 2;  1WII A;  4A3B I;  3CCR 1;  3GKQ A;  1USP B;  3BY4 A;  3GTL I;  1TWH I;  3J7A 4;  3CD6 Z;  4XX2 A;  4E30 A;  1W2B Z;  4X6A I;  3VB9 A;  1ZB8 A;  2QEX 1;  3S15 I;  4RV9 A;  4BBR I;  3NH4 A;  2PMZ A;  3F3F C;  2E2H I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...