3IFUA

The crystal structure of porcine reproductive and respiratory syndrome virus (prrsv) leader protease nsp1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
175
structure length
175
Chain Sequence
DRCTCTPNARVFVAEGQVYCTRCLSARSLLPLNLQVPELGVLGLFYRPEEPLRWTLPRAFPTVECSPAGACWLSAIFPIARMTSGNLNFQQRMVRVAAEIYRAGQLTPTVLKTLQVYERGCRWYPIVGPVPGVGVYANSLHVSDKPFPGATHVLTNLPLPQRPKPEDFCPFECAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Non-structural protein
publication title Crystal structure of porcine reproductive and respiratory syndrome virus leader protease Nsp1alpha
pubmed doi rcsb
source organism Porcine reproductive and respiratory syndrome virus
total genus 37
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2009-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05410 Peptidase_C31 Porcine arterivirus-type cysteine proteinase alpha
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.250 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ifuA01
3.90.70.60 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3ifuA02
3IFUA
chains in the Genus database with same CATH superfamily
1CTEA 3S17I 4YVAA 2I3CA 1QF8A 5LL6f 3P5VA 2V3VA 1SNKA 1YK8A 1KC81 2QREB 4PP1A 4RVFA 4MD9A 3WXFA 1PIPA 2RT9A 1HUCB 3CBKA 2XU5A 1RO2A 4OW0A 3PW3A 4QRGA 2VUMI 2C0YA 4REZA 2K5RA 4PT5A 1RQFA 1MIRA 2DCCA 3K7AI 1NB5A 2OULA 1XKGA 1S7MA 4MI7A 4YYWA 3N4CA 3VMIA 3I4MI 1PPOA 1RNIA 2JMOA 3GTJI 4DQYB 2JA6I 1BP4A 3NH4A 3S1RI 3CC71 2M6NA 1ZCMA 4FIPA 1R9TI 3BOWA 3T4NB 3PHWA 4YYUA 2DC9A 1S72Z 3ZNHA 2F4OA 2DZYA 2RBLA 4NB8A 2KPIA 3IX0A 1RO0A 2LIYA 3LFYA 1X0TA 1K731 1TU6A 1U9WA 4P6GA 2AS8A 5FLXb 3GCFA 3HOWI 3PO3S 1QVGY 4NBHA 2OTLZ 2R7ZI 3MJ5A 1O0EA 4XUIA 2QRDB 3FKII 3CC7Z 1W2BY 5CM2M 2NVTI 2AUXA 1JJ2Z 2IPPB 4HGYA 4A3CI 5IP9I 1N8R2 1U9VA 2JUBA 2JTCA 1PFTA 2NQDB 3P5WA 2GHUA 1NQCA 4IP3A 1CSBB 1MDWA 2HH5A 4NBDA 1VQ81 2RHBA 2FTDA 1M901 3H0GI 1NJI1 3QJ3A 1A6RA 3GTOI 2R9NA 3KIFA 1VQ41 1PPPA 2BTWB 2HHNA 3H8BA 1GECE 3S3QA 1YZBA 2JIRA 1VLAA 4QRVA 1N2FA 4WURA 3G711 2JA8I 2YJCA 3CCJ1 3J80f 5CVMA 1ME4A 1AU4A 1Q7Y1 3GTKI 2J7QC 3I06A 2DC6A 4A93I 3NDJA 2BJOA 1QYPA 1ATKA 3EEDA 2F4MA 1PE6A 1TFIA 2G2KA 2E2II 1EF7A 2E01A 3ESWA 3KWBX 3PHXA 2IV2X 2JIMA 2LEXA 4CL1A 3W30A 4EWCA 4MRIA 3CC21 1YJ91 1VQ4Z 1VQPZ 1NLJA 6PADA 2CB5A 1BQIA 1Q16A 4CZWA 4RY2A 2DJFB 2CIOA 3G71Z 3MTVA 4NFRA 3TMPA 4E30A 3HOXI 2AU1A 2V8KA 4BBSI 4E2ZA 3O0UA 2QLVB 4BY1I 1Y1VS 3MONA 2JA7I 3S2HI 1KQSZ 1PADA 4MD7A 3PSEA 2R9CA 2IZ3A 4RNAA 1Y1VI 2YU9I 3NHEA 4AXLA 1STFE 3IOQA 1X3ZA 3CC2Z 1YJ9Z 1AU2A 5KO3A 4A3BI 3KSEA 1MEMA 3CD61 2R93I 2P86A 2NQIA 1PPDA 5FLMI 4A3DI 1TWFI 3D2LA 4HH4A 1USPB 2V45A 4DGLA 3HOVI 4GUAA 2QA41 1TWHI 3GTPI 2NQGA 5IT9b 3C9EA 1VQN1 3S1QI 3GCBA 3RVVA 2AYDA 2IBIA 2JQFR 3CMA1 1DKIA 3PHUA 1K8A1 3F75A 3H89A 4YYSA 2DC7A 2QRCB 1AYVA 1F29A 3RZDI 3PO2I 2G8JA 3B79A 3QWUA 4N79A 1YALA 4ZUXU 2B63I 3CD6Z 1QDQA 1LQLA 2E2JI 3CH2X 1KHQA 3VB9A 1NPZA 2ACTA 3FQMA 1RO4A 2YJ9A 4DMXA 2JIOA 4R3DA 4Y7NI 5A24A 3JAMf 3CME1 3H6SA 4N8WA 5EZQA 3VMHA 4NH1C 2QA4Z 2FT2A 3MORA 4E2YA 4D8BA 1WW9A 3D9XA 5D1PA 1VQNZ 4A3EI 2BDLA 2P7UA 3PT2A 3E9SA 3GTLI 3PDFA 1CPJA 4YYVA 3CMAZ 5CHVA 4RVGA 1VSNA 4A3GI 3I561 3NDIA 3NH8A 3IR7A 2NVXI 1SP4B 4BOPA 1CVZA 1VJVA 4BPVA 3CCV1 2V8IA 1EWLA 1FDIA 1QVFZ 2E02A 5IP7I 4A5UA 1F2CA 4K7CA 4CDEB 4AYBA 4XZXA 2O6XA 3CMEZ 3V6EA 3KWZA 3BB7A 4I04A 1DL6A 2B1MA 3P5XA 3HOUI 1VQM1 1X9YA 3OW2Y 4BOZA 4A3JI 3K24A 2YJ2A 1X3WA 1EWMA 3VMGA 3I56Z 4BOUA 2XU1A 2ZAEB 3OVZA 3S3RA 4NBAA 1KRLA 2NVQI 4WA6A 3RNVA 3D6WA 4FK5A 3U8EA 3J81b 4RF1A 5EF4A 3KW9A 2DCBA 4A3II 1VQ71 3BPMA 2OOYB 3W31A 4E2XA 1YJN1 1GCBA 2DCDA 1SFOI 1P9NA 4BOQA 5CVOB 1VQMZ 2PM9A 4A3KI 3IFUA 1K9M2 2G8EA 3ZUAA 1Q862 3CCR1 1DEUA 3F3PC 5FLXf 5C4JI 4W5BA 1Q811 4S1TA 4N4ZA 5JA7A 3USVA 2YJBA 4BQVA 3CCS1 1ICFA 1UKFA 2E03A 5EZSA 4Q8GA 8PCHA 2FO5A 1M1K2 1YIJ1 2HU9A 1VQ7Z 2DE5A 4NBBA 1VQO1 4NBCA 1IWDA 1YJNZ 3RZOI 1BY8A 4TNUA 2PADA 3S15I 1U9QX 2VPZA 4BXXI 4QTTA 3GTGI 2AYNA 3CCRZ 1JQPA 2DE7A 1RLYA 3MTNA 2NQAA 1CS8A 4MXUA 4RKXA 4W5CA 1AECA 1KFUL 1TL9A 3HKZA 1VQ8Z 1K3BB 2ATOA 1TLOA 3GTQI 3CCSZ 4E32A 4OEMA 3BPFA 4M0WA 3S1NI 1NP6A 2JNYA 2FUDA 1YIJZ 3HHAA 1VQOZ 4PP2E 3CH3X 1VQL1 3IF8A 3CXCZ 4QTUA 1WIIA 3PNRA 2YADA 2AGAA 2Z84A 1S4VA 1Z01A 3HOYI 2J7QA 5FPWA 3CCJZ 4DK1A 3G4S1 3M3YI 3BCNA 1SIWA 1KC82 1YUKA 5C3EI 2QEX1 1MHWA 1PPNA 2YJ8A 4BSQA 2AKLA 1WCMI 2VF1A 4FJCA 2FQ9A 1TWCI 2FRAA 4NBGA 5J94A 3PRPA 2PMZA 1MEGA 2VPWA 2R9OA 2Y0SA 1ZIVA 3I551 2OOXB 2WAQA 2JQGR 3IEJA 3MP2A 4HGZA 2E7ZA 4BBRI 1CV8A 3KIHA 3G4SZ 1YUAA 5JZEA 1QXPA 4NOZA 1K9M1 1N8R1 2HD5A 1GMYA 2P28A 2VUGA 1ME3A 4A3FI 3TDHB 3GTMI 3O1GA 2HXZA 1THEA 3MZKB 3HWNA 4OELA 1AYUA 2GFOA 3LUSA 4E33A 4E2WA 1Y08A 2V8JA 3B21A 3WXGA 2GTIA 1VQ91 2EGTA 1EWPA 3IV2A 5F02A 4Q8HA 3M4OI 1QMYA 3H8CA 1EWOA 3OVXA 2R9FA 4X6JA 5A2Qf 3I55Z 3CBJA 1NB3A 3PBHA 2PNSA 3E1ZB 3Q87A 5E6JA 4KLBA 3CC41 2OZ2A 3KFQA 2DE6A 1YVBA 1QVGZ 1Y4HA 4I05A 3BY4A 4MH4A 1AU0A 5T6BA 1KD12 4RVHA 1W2BZ 4MSXA 3JAMb 4RVDA 1VQ9Z 3F5VA 1KFXL 1BGOA 1M6DA 1NL6A 3J7A4 4X6HA 2Q51A 3DF0A 2OTJ1 3AI8A 3H3VJ 2P0RA 3EERA 3CPWY 2ARYA 4HWYA 3VTNA 3CC4Z 4BY7I 3QSDA 2OP3A 4IUMA 3TRKA 2RIQA 4CDDB 1VQ51 4YYRA 4QBBA 1M902 1NJI2 3WXEA 2AIMA 2DOSA 1AA6A 2F1GA 3N3GA 3OF9A 3I07A 4XX2A 4MONA 2G7YA 2RPRA 2M48A 1KHPA 2G6DA 2AYOA 1KQSY 4W4UA 4QH6A 3C0RA 4CDFB 4G54A 3KKUA 1Q7Y2 1S721 1KXRA 4AXMA 3QT4A 2OTJZ 3CCVZ 4E31A 4HXDB 2E2HI 4CDCB 1YJW1 4QRXA 2DZZA 2NVYI 2DJGB 1YHQ1 2OZKA 4X6IA 1VQ5Z 3BBAA 1AIMA 1CB5A 2W04A 4D8IA 3MHSA 3K8UA 5AN9F 1JWHC 2OTL1 4A3MI 3S1MI 3ERVA 3D6SA 3MHHA 2BDZA 1TWGI 2JS4A 2E9HA 2JRIA 3O65A 5T64A 1U5IA 2XU3A 3MZLB 5C44I 1ZH1A 4NBFA 2BTWA 4D8EA 3BG0B 4YV8A 1DF0A 1Q822 4P16A 3J81f 1YJWZ 3G6E1 2JR6A 4X6AI 2PREA 3OISA 4BS5A 1YHQZ 2QKDA 3CCE1 4NBEA 2WBFX 3PRMA 4YYQA 1PBHA 1I6HI 2GU2A 2FRQA 2DCAA 2PBHA 1GLOA 3OQCA 5K16A 1KD11 4RF0A 3PO3I 5EGWA 1F2BA 3M99A 2GTHA 3TNXA 2VPYA 1L1OC 5C4XI 3CCM1 1CQDA 2QR1B 1F2AA 3CQZI 1CJLA 4OVZA 2K3RA 1K83I 1FH0A 1PCIA 1ZB9A 3J80b 2E00A 3G6EZ 3CCL1 1YIT1 4I07A 1QVFY 3OF8A 3IHPA 4NB9A 2P3YA 3CCEZ 2W03A 1Z02A 1K8A2 2AUZA 2F7DA 1MS6A 3P5UA 4MD8A 5JH3A 4Y52I 1Z03A 3HD3A 1I50I 2LFUA 1VQP1 3BG1B 3F3FC 3TE5B 3I4NI 9PAPA 1QOLA 3CCMZ 1YT7A 1QXFA 3RVWA 2B1NA 2KI7B 1YI21 1VQK1 1TWAI 4MZOA 3LXSA 3NH5A 3GKQA 5CVNB 3CCLZ 1ML8A 1YITZ 2R92I 4PI3A 2NAPA 2Q4ZA 3S2DI 1Q6KA 3FQQA 1NUIA 1ZB8A 1USPA 2IZ4A 4P6EA 1PXVA 3N3KA 3P5JB 5D1OA 1VQLZ 2DC8A 4BS6A 4A3LI 3BC3A 3H7DA 4OVZB 4RV9A 3I3TA 1JJ2Y 1FDOA 3CPWZ 3HOZI 3RVXA 3GTMS 7PCKA 3CCQ1 3CCU1 1YI2Z 2HF1A 1VQKZ 5CHTA 1Q861 5PADA 2QEXZ 1AU3A 4PADA 3IMAA 1Q821 2UZJA 1U9XA 2Y6EA 3S14I 3V6CA 1I3QI 1VQ61 3OW2Z 3BWKA 2FE8A 3U50C 2BU3A 1M1K1 2FYEA 3KX1A 1ITOA 4MM3B 4XR7A 3IUTA 1AYWA 1Y8CA 1K732 2PK7A 5A2Qb 3NFZA 3CCQZ 1WJ2A 1Y1WI 3CCUZ 5IT9f 4DMYA 2O4HA 3K9MA 2O53A 2VHSA 3S16I 1WZNA 2R6MA 2R9MA 2H85A 2WB1A 2XU4A 2JIPA 1PVJA 3HHIA 4ZTBA 2VPXA 2Y5BA 4MZSA 2VHFA 5D1OB 1YK7A 1VQ6Z 2JIQA 1POPA 2AVWA 2H7JA 2HWKA 3CXCY 2J6AA 4RS4A 1Q812 2JA5I 2R6NA 4BOSA 5T67A
chains in the Genus database with same CATH topology
3S17I 2I3CA 1QF8A 5LL6f 1KC81 2QREB 4RVFA 4MD9A 2RT9A 1RO2A 4OW0A 2VUMI 4REZA 2K5RA 4PT5A 1RQFA 3K7AI 1S7MA 4MI7A 3VMIA 3I4MI 1RNIA 2JMOA 3GTJI 4DQYB 2JA6I 3NH4A 3S1RI 3CC71 2M6NA 1R9TI 3T4NB 3PHWA 1S72Z 3ZNHA 2F4OA 2RBLA 4NB8A 2KPIA 3IX0A 1RO0A 2LIYA 1X0TA 1K731 5FLXb 3GCFA 3HOWI 3PO3S 1QVGY 4NBHA 2OTLZ 2R7ZI 3MJ5A 2QRDB 3FKII 3CC7Z 1W2BY 5CM2M 2NVTI 1JJ2Z 4HGYA 4A3CI 5IP9I 1N8R2 2JUBA 2JTCA 1PFTA 4IP3A 4NBDA 1VQ81 2RHBA 1M901 3H0GI 1NJI1 3GTOI 3KIFA 1VQ41 2BTWB 1YZBA 1VLAA 1N2FA 4WURA 3G711 2JA8I 3CCJ1 3J80f 1Q7Y1 3GTKI 2J7QC 4A93I 3NDJA 2BJOA 1QYPA 3EEDA 2F4MA 1TFIA 2G2KA 2E2II 3ESWA 3PHXA 4CL1A 3W30A 4EWCA 4MRIA 3CC21 1YJ91 1VQ4Z 1VQPZ 3G71Z 3MTVA 4NFRA 3TMPA 4E30A 3HOXI 2V8KA 4BBSI 4E2ZA 2QLVB 4BY1I 1Y1VS 3MONA 2JA7I 3S2HI 1KQSZ 4MD7A 3PSEA 2IZ3A 4RNAA 1Y1VI 2YU9I 1X3ZA 3CC2Z 1YJ9Z 5KO3A 4A3BI 3CD61 2R93I 5FLMI 4A3DI 1TWFI 4HH4A 1USPB 4DGLA 3HOVI 4GUAA 2QA41 1TWHI 3GTPI 5IT9b 1VQN1 3S1QI 3CMA1 1DKIA 3PHUA 1K8A1 2QRCB 3RZDI 3PO2I 3QWUA 2B63I 3CD6Z 1LQLA 2E2JI 3VB9A 3FQMA 1RO4A 4R3DA 4Y7NI 3JAMf 3CME1 5EZQA 3VMHA 4NH1C 2QA4Z 4E2YA 4D8BA 1WW9A 3D9XA 5D1PA 1VQNZ 4A3EI 3PT2A 3E9SA 3GTLI 3CMAZ 4RVGA 4BOPA 4A3GI 3I561 3NDIA 3NH8A 2NVXI 3CCV1 2V8IA 1QVFZ 5IP7I 4A5UA 4AYBA 4XZXA 3CMEZ 3BB7A 1DL6A 3HOUI 1VQM1 3OW2Y 4BOZA 4A3JI 1X3WA 3VMGA 3I56Z 4BOUA 2ZAEB 4NBAA 1KRLA 2NVQI 3RNVA 3D6WA 3J81b 4RF1A 4A3II 1VQ71 3W31A 2OOYB 4E2XA 1YJN1 1SFOI 1P9NA 4BOQA 1VQMZ 2PM9A 4A3KI 3IFUA 1K9M2 1Q862 3CCR1 3F3PC 5FLXf 5C4JI 1Q811 4S1TA 3CCS1 1UKFA 5EZSA 1M1K2 1YIJ1 2HU9A 1VQ7Z 2DE5A 4NBBA 1VQO1 4NBCA 1YJNZ 3RZOI 4TNUA 3S15I 4BXXI 4QTTA 3GTGI 3CCRZ 2DE7A 1RLYA 4MXUA 4RKXA 3HKZA 1VQ8Z 3GTQI 3CCSZ 4E32A 4M0WA 3S1NI 1NP6A 2JNYA 1YIJZ 1VQOZ 1VQL1 3IF8A 3CXCZ 4QTUA 1WIIA 2YADA 2AGAA 2Z84A 1Z01A 3HOYI 2J7QA 3CCJZ 4DK1A 3G4S1 3M3YI 1KC82 1YUKA 5C3EI 2QEX1 2AKLA 1WCMI 2VF1A 1TWCI 4NBGA 3PRPA 2PMZA 2Y0SA 3I551 2OOXB 2WAQA 3MP2A 4HGZA 4BBRI 5JZEA 3KIHA 3G4SZ 1YUAA 4NOZA 1K9M1 1N8R1 2P28A 2VUGA 4A3FI 3TDHB 3GTMI 3MZKB 3B21A 3LUSA 4E33A 4E2WA 2V8JA 2GTIA 1VQ91 2EGTA 3M4OI 5A2Qf 3I55Z 3Q87A 5E6JA 3CC41 2DE6A 1QVGZ 3BY4A 4MH4A 5T6BA 1KD12 4RVHA 1W2BZ 3JAMb 4RVDA 1VQ9Z 3J7A4 2Q51A 2OTJ1 3H3VJ 3EERA 3CPWY 3VTNA 3CC4Z 4BY7I 4IUMA 3TRKA 2RIQA 1VQ51 1M902 1NJI2 2DOSA 3I07A 4XX2A 4MONA 2RPRA 2M48A 1KQSY 3C0RA 1Q7Y2 1S721 2OTJZ 3CCVZ 4E31A 4HXDB 2E2HI 1YJW1 2NVYI 1YHQ1 2OZKA 1VQ5Z 3BBAA 2W04A 4D8IA 5AN9F 1JWHC 2OTL1 4A3MI 3S1MI 1TWGI 2JS4A 2E9HA 2JRIA 3O65A 5T64A 3MZLB 5C44I 1ZH1A 4NBFA 2BTWA 4D8EA 3BG0B 1Q822 4P16A 3J81f 1YJWZ 3G6E1 2JR6A 4X6AI 1YHQZ 2QKDA 3CCE1 4NBEA 3PRMA 1I6HI 2GU2A 3OQCA 1KD11 4RF0A 3PO3I 2GTHA 1L1OC 5C4XI 3CCM1 2QR1B 3CQZI 4OVZA 2K3RA 1K83I 1ZB9A 3J80b 3G6EZ 3CCL1 1YIT1 1QVFY 4NB9A 2P3YA 3CCEZ 2W03A 1Z02A 1K8A2 4MD8A 4Y52I 1Z03A 1I50I 2LFUA 1VQP1 3BG1B 3F3FC 3TE5B 3I4NI 3CCMZ 2KI7B 1YI21 1VQK1 1TWAI 3NH5A 3GKQA 3CCLZ 1ML8A 1YITZ 2R92I 2Q4ZA 3S2DI 3FQQA 1NUIA 1ZB8A 1USPA 2IZ4A 3P5JB 5D1OA 1VQLZ 4A3LI 4OVZB 4RV9A 1JJ2Y 3CPWZ 3HOZI 3GTMS 3CCQ1 3CCU1 1YI2Z 2HF1A 1VQKZ 1Q861 2QEXZ 1Q821 2UZJA 3S14I 1I3QI 1VQ61 3OW2Z 2FE8A 3U50C 2BU3A 1M1K1 4MM3B 1K732 2PK7A 5A2Qb 3NFZA 3CCQZ 1Y1WI 3CCUZ 5IT9f 2O4HA 2O53A 3S16I 2R6MA 2H85A 2WB1A 1PVJA 4ZTBA 5D1OB 1VQ6Z 2HWKA 3CXCY 2J6AA 4RS4A 1Q812 2JA5I 4BOSA 5T67A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IFU A; 
#chains in the Genus database with same CATH topology
 1CTE A;  3S17 I;  4YVA A;  2I3C A;  1QF8 A;  5LL6 f;  3P5V A;  2V3V A;  1SNK A;  1YK8 A;  1KC8 1;  2QRE B;  4PP1 A;  4RVF A;  4MD9 A;  3WXF A;  1PIP A;  2RT9 A;  1HUC B;  3CBK A;  2XU5 A;  1RO2 A;  4OW0 A;  3PW3 A;  4QRG A;  2VUM I;  2C0Y A;  4REZ A;  2K5R A;  4PT5 A;  1RQF A;  1MIR A;  2DCC A;  3K7A I;  1NB5 A;  2OUL A;  1XKG A;  1S7M A;  4MI7 A;  4YYW A;  3N4C A;  3VMI A;  3I4M I;  1PPO A;  1RNI A;  2JMO A;  3GTJ I;  4DQY B;  2JA6 I;  1BP4 A;  3NH4 A;  3S1R I;  3CC7 1;  2M6N A;  1ZCM A;  4FIP A;  1R9T I;  3BOW A;  3T4N B;  3PHW A;  4YYU A;  2DC9 A;  1S72 Z;  3ZNH A;  2F4O A;  2DZY A;  2RBL A;  4NB8 A;  2KPI A;  3IX0 A;  1RO0 A;  2LIY A;  3LFY A;  1X0T A;  1K73 1;  1TU6 A;  1U9W A;  4P6G A;  2AS8 A;  5FLX b;  3GCF A;  3HOW I;  3PO3 S;  1QVG Y;  4NBH A;  2OTL Z;  2R7Z I;  3MJ5 A;  1O0E A;  4XUI A;  2QRD B;  3FKI I;  3CC7 Z;  1W2B Y;  5CM2 M;  2NVT I;  2AUX A;  1JJ2 Z;  2IPP B;  4HGY A;  4A3C I;  5IP9 I;  1N8R 2;  1U9V A;  2JUB A;  2JTC A;  1PFT A;  2NQD B;  3P5W A;  2GHU A;  1NQC A;  4IP3 A;  1CSB B;  1MDW A;  2HH5 A;  4NBD A;  1VQ8 1;  2RHB A;  2FTD A;  1M90 1;  3H0G I;  1NJI 1;  3QJ3 A;  1A6R A;  3GTO I;  2R9N A;  3KIF A;  1VQ4 1;  1PPP A;  2BTW B;  2HHN A;  3H8B A;  1GEC E;  3S3Q A;  1YZB A;  2JIR A;  1VLA A;  4QRV A;  1N2F A;  4WUR A;  3G71 1;  2JA8 I;  2YJC A;  3CCJ 1;  3J80 f;  5CVM A;  1ME4 A;  1AU4 A;  1Q7Y 1;  3GTK I;  2J7Q C;  3I06 A;  2DC6 A;  4A93 I;  3NDJ A;  2BJO A;  1QYP A;  1ATK A;  3EED A;  2F4M A;  1PE6 A;  1TFI A;  2G2K A;  2E2I I;  1EF7 A;  2E01 A;  3ESW A;  3KWB X;  3PHX A;  2IV2 X;  2JIM A;  2LEX A;  4CL1 A;  3W30 A;  4EWC A;  4MRI A;  3CC2 1;  1YJ9 1;  1VQ4 Z;  1VQP Z;  1NLJ A;  6PAD A;  2CB5 A;  1BQI A;  1Q16 A;  4CZW A;  4RY2 A;  2DJF B;  2CIO A;  3G71 Z;  3MTV A;  4NFR A;  3TMP A;  4E30 A;  3HOX I;  2AU1 A;  2V8K A;  4BBS I;  4E2Z A;  3O0U A;  2QLV B;  4BY1 I;  1Y1V S;  3MON A;  2JA7 I;  3S2H I;  1KQS Z;  1PAD A;  4MD7 A;  3PSE A;  2R9C A;  2IZ3 A;  4RNA A;  1Y1V I;  2YU9 I;  3NHE A;  4AXL A;  1STF E;  3IOQ A;  1X3Z A;  3CC2 Z;  1YJ9 Z;  1AU2 A;  5KO3 A;  4A3B I;  3KSE A;  1MEM A;  3CD6 1;  2R93 I;  2P86 A;  2NQI A;  1PPD A;  5FLM I;  4A3D I;  1TWF I;  3D2L A;  4HH4 A;  1USP B;  2V45 A;  4DGL A;  3HOV I;  4GUA A;  2QA4 1;  1TWH I;  3GTP I;  2NQG A;  5IT9 b;  3C9E A;  1VQN 1;  3S1Q I;  3GCB A;  3RVV A;  2AYD A;  2IBI A;  2JQF R;  3CMA 1;  1DKI A;  3PHU A;  1K8A 1;  3F75 A;  3H89 A;  4YYS A;  2DC7 A;  2QRC B;  1AYV A;  1F29 A;  3RZD I;  3PO2 I;  2G8J A;  3B79 A;  3QWU A;  4N79 A;  1YAL A;  4ZUX U;  2B63 I;  3CD6 Z;  1QDQ A;  1LQL A;  2E2J I;  3CH2 X;  1KHQ A;  3VB9 A;  1NPZ A;  2ACT A;  3FQM A;  1RO4 A;  2YJ9 A;  4DMX A;  2JIO A;  4R3D A;  4Y7N I;  5A24 A;  3JAM f;  3CME 1;  3H6S A;  4N8W A;  5EZQ A;  3VMH A;  4NH1 C;  2QA4 Z;  2FT2 A;  3MOR A;  4E2Y A;  4D8B A;  1WW9 A;  3D9X A;  5D1P A;  1VQN Z;  4A3E I;  2BDL A;  2P7U A;  3PT2 A;  3E9S A;  3GTL I;  3PDF A;  1CPJ A;  4YYV A;  3CMA Z;  5CHV A;  4RVG A;  1VSN A;  4A3G I;  3I56 1;  3NDI A;  3NH8 A;  3IR7 A;  2NVX I;  1SP4 B;  4BOP A;  1CVZ A;  1VJV A;  4BPV A;  3CCV 1;  2V8I A;  1EWL A;  1FDI A;  1QVF Z;  2E02 A;  5IP7 I;  4A5U A;  1F2C A;  4K7C A;  4CDE B;  4AYB A;  4XZX A;  2O6X A;  3CME Z;  3V6E A;  3KWZ A;  3BB7 A;  4I04 A;  1DL6 A;  2B1M A;  3P5X A;  3HOU I;  1VQM 1;  1X9Y A;  3OW2 Y;  4BOZ A;  4A3J I;  3K24 A;  2YJ2 A;  1X3W A;  1EWM A;  3VMG A;  3I56 Z;  4BOU A;  2XU1 A;  2ZAE B;  3OVZ A;  3S3R A;  4NBA A;  1KRL A;  2NVQ I;  4WA6 A;  3RNV A;  3D6W A;  4FK5 A;  3U8E A;  3J81 b;  4RF1 A;  5EF4 A;  3KW9 A;  2DCB A;  4A3I I;  1VQ7 1;  3BPM A;  2OOY B;  3W31 A;  4E2X A;  1YJN 1;  1GCB A;  2DCD A;  1SFO I;  1P9N A;  4BOQ A;  5CVO B;  1VQM Z;  2PM9 A;  4A3K I;  3IFU A;  1K9M 2;  2G8E A;  3ZUA A;  1Q86 2;  3CCR 1;  1DEU A;  3F3P C;  5FLX f;  5C4J I;  4W5B A;  1Q81 1;  4S1T A;  4N4Z A;  5JA7 A;  3USV A;  2YJB A;  4BQV A;  3CCS 1;  1ICF A;  1UKF A;  2E03 A;  5EZS A;  4Q8G A;  8PCH A;  2FO5 A;  1M1K 2;  1YIJ 1;  2HU9 A;  1VQ7 Z;  2DE5 A;  4NBB A;  1VQO 1;  4NBC A;  1IWD A;  1YJN Z;  3RZO I;  1BY8 A;  4TNU A;  2PAD A;  3S15 I;  1U9Q X;  2VPZ A;  4BXX I;  4QTT A;  3GTG I;  2AYN A;  3CCR Z;  1JQP A;  2DE7 A;  1RLY A;  3MTN A;  2NQA A;  1CS8 A;  4MXU A;  4RKX A;  4W5C A;  1AEC A;  1KFU L;  1TL9 A;  3HKZ A;  1VQ8 Z;  1K3B B;  2ATO A;  1TLO A;  3GTQ I;  3CCS Z;  4E32 A;  4OEM A;  3BPF A;  4M0W A;  3S1N I;  1NP6 A;  2JNY A;  2FUD A;  1YIJ Z;  3HHA A;  1VQO Z;  4PP2 E;  3CH3 X;  1VQL 1;  3IF8 A;  3CXC Z;  4QTU A;  1WII A;  3PNR A;  2YAD A;  2AGA A;  2Z84 A;  1S4V A;  1Z01 A;  3HOY I;  2J7Q A;  5FPW A;  3CCJ Z;  4DK1 A;  3G4S 1;  3M3Y I;  3BCN A;  1SIW A;  1KC8 2;  1YUK A;  5C3E I;  2QEX 1;  1MHW A;  1PPN A;  2YJ8 A;  4BSQ A;  2AKL A;  1WCM I;  2VF1 A;  4FJC A;  2FQ9 A;  1TWC I;  2FRA A;  4NBG A;  5J94 A;  3PRP A;  2PMZ A;  1MEG A;  2VPW A;  2R9O A;  2Y0S A;  1ZIV A;  3I55 1;  2OOX B;  2WAQ A;  2JQG R;  3IEJ A;  3MP2 A;  4HGZ A;  2E7Z A;  4BBR I;  1CV8 A;  3KIH A;  3G4S Z;  1YUA A;  5JZE A;  1QXP A;  4NOZ A;  1K9M 1;  1N8R 1;  2HD5 A;  1GMY A;  2P28 A;  2VUG A;  1ME3 A;  4A3F I;  3TDH B;  3GTM I;  3O1G A;  2HXZ A;  1THE A;  3MZK B;  3HWN A;  4OEL A;  1AYU A;  2GFO A;  3LUS A;  4E33 A;  4E2W A;  1Y08 A;  2V8J A;  3B21 A;  3WXG A;  2GTI A;  1VQ9 1;  2EGT A;  1EWP A;  3IV2 A;  5F02 A;  4Q8H A;  3M4O I;  1QMY A;  3H8C A;  1EWO A;  3OVX A;  2R9F A;  4X6J A;  5A2Q f;  3I55 Z;  3CBJ A;  1NB3 A;  3PBH A;  2PNS A;  3E1Z B;  3Q87 A;  5E6J A;  4KLB A;  3CC4 1;  2OZ2 A;  3KFQ A;  2DE6 A;  1YVB A;  1QVG Z;  1Y4H A;  4I05 A;  3BY4 A;  4MH4 A;  1AU0 A;  5T6B A;  1KD1 2;  4RVH A;  1W2B Z;  4MSX A;  3JAM b;  4RVD A;  1VQ9 Z;  3F5V A;  1KFX L;  1BGO A;  1M6D A;  1NL6 A;  3J7A 4;  4X6H A;  2Q51 A;  3DF0 A;  2OTJ 1;  3AI8 A;  3H3V J;  2P0R A;  3EER A;  3CPW Y;  2ARY A;  4HWY A;  3VTN A;  3CC4 Z;  4BY7 I;  3QSD A;  2OP3 A;  4IUM A;  3TRK A;  2RIQ A;  4CDD B;  1VQ5 1;  4YYR A;  4QBB A;  1M90 2;  1NJI 2;  3WXE A;  2AIM A;  2DOS A;  1AA6 A;  2F1G A;  3N3G A;  3OF9 A;  3I07 A;  4XX2 A;  4MON A;  2G7Y A;  2RPR A;  2M48 A;  1KHP A;  2G6D A;  2AYO A;  1KQS Y;  4W4U A;  4QH6 A;  3C0R A;  4CDF B;  4G54 A;  3KKU A;  1Q7Y 2;  1S72 1;  1KXR A;  4AXM A;  3QT4 A;  2OTJ Z;  3CCV Z;  4E31 A;  4HXD B;  2E2H I;  4CDC B;  1YJW 1;  4QRX A;  2DZZ A;  2NVY I;  2DJG B;  1YHQ 1;  2OZK A;  4X6I A;  1VQ5 Z;  3BBA A;  1AIM A;  1CB5 A;  2W04 A;  4D8I A;  3MHS A;  3K8U A;  5AN9 F;  1JWH C;  2OTL 1;  4A3M I;  3S1M I;  3ERV A;  3D6S A;  3MHH A;  2BDZ A;  1TWG I;  2JS4 A;  2E9H A;  2JRI A;  3O65 A;  5T64 A;  1U5I A;  2XU3 A;  3MZL B;  5C44 I;  1ZH1 A;  4NBF A;  2BTW A;  4D8E A;  3BG0 B;  4YV8 A;  1DF0 A;  1Q82 2;  4P16 A;  3J81 f;  1YJW Z;  3G6E 1;  2JR6 A;  4X6A I;  2PRE A;  3OIS A;  4BS5 A;  1YHQ Z;  2QKD A;  3CCE 1;  4NBE A;  2WBF X;  3PRM A;  4YYQ A;  1PBH A;  1I6H I;  2GU2 A;  2FRQ A;  2DCA A;  2PBH A;  1GLO A;  3OQC A;  5K16 A;  1KD1 1;  4RF0 A;  3PO3 I;  5EGW A;  1F2B A;  3M99 A;  2GTH A;  3TNX A;  2VPY A;  1L1O C;  5C4X I;  3CCM 1;  1CQD A;  2QR1 B;  1F2A A;  3CQZ I;  1CJL A;  4OVZ A;  2K3R A;  1K83 I;  1FH0 A;  1PCI A;  1ZB9 A;  3J80 b;  2E00 A;  3G6E Z;  3CCL 1;  1YIT 1;  4I07 A;  1QVF Y;  3OF8 A;  3IHP A;  4NB9 A;  2P3Y A;  3CCE Z;  2W03 A;  1Z02 A;  1K8A 2;  2AUZ A;  2F7D A;  1MS6 A;  3P5U A;  4MD8 A;  5JH3 A;  4Y52 I;  1Z03 A;  3HD3 A;  1I50 I;  2LFU A;  1VQP 1;  3BG1 B;  3F3F C;  3TE5 B;  3I4N I;  9PAP A;  1QOL A;  3CCM Z;  1YT7 A;  1QXF A;  3RVW A;  2B1N A;  2KI7 B;  1YI2 1;  1VQK 1;  1TWA I;  4MZO A;  3LXS A;  3NH5 A;  3GKQ A;  5CVN B;  3CCL Z;  1ML8 A;  1YIT Z;  2R92 I;  4PI3 A;  2NAP A;  2Q4Z A;  3S2D I;  1Q6K A;  3FQQ A;  1NUI A;  1ZB8 A;  1USP A;  2IZ4 A;  4P6E A;  1PXV A;  3N3K A;  3P5J B;  5D1O A;  1VQL Z;  2DC8 A;  4BS6 A;  4A3L I;  3BC3 A;  3H7D A;  4OVZ B;  4RV9 A;  3I3T A;  1JJ2 Y;  1FDO A;  3CPW Z;  3HOZ I;  3RVX A;  3GTM S;  7PCK A;  3CCQ 1;  3CCU 1;  1YI2 Z;  2HF1 A;  1VQK Z;  5CHT A;  1Q86 1;  5PAD A;  2QEX Z;  1AU3 A;  4PAD A;  3IMA A;  1Q82 1;  2UZJ A;  1U9X A;  2Y6E A;  3S14 I;  3V6C A;  1I3Q I;  1VQ6 1;  3OW2 Z;  3BWK A;  2FE8 A;  3U50 C;  2BU3 A;  1M1K 1;  2FYE A;  3KX1 A;  1ITO A;  4MM3 B;  4XR7 A;  3IUT A;  1AYW A;  1Y8C A;  1K73 2;  2PK7 A;  5A2Q b;  3NFZ A;  3CCQ Z;  1WJ2 A;  1Y1W I;  3CCU Z;  5IT9 f;  4DMY A;  2O4H A;  3K9M A;  2O53 A;  2VHS A;  3S16 I;  1WZN A;  2R6M A;  2R9M A;  2H85 A;  2WB1 A;  2XU4 A;  2JIP A;  1PVJ A;  3HHI A;  4ZTB A;  2VPX A;  2Y5B A;  4MZS A;  2VHF A;  5D1O B;  1YK7 A;  1VQ6 Z;  2JIQ A;  1POP A;  2AVW A;  2H7J A;  2HWK A;  3CXC Y;  2J6A A;  4RS4 A;  1Q81 2;  2JA5 I;  2R6N A;  4BOS A;  5T67 A; 
#chains in the Genus database with same CATH homology
 3S17 I;  2I3C A;  1QF8 A;  5LL6 f;  1KC8 1;  2QRE B;  4RVF A;  4MD9 A;  2RT9 A;  1RO2 A;  4OW0 A;  2VUM I;  4REZ A;  2K5R A;  4PT5 A;  1RQF A;  3K7A I;  1S7M A;  4MI7 A;  3VMI A;  3I4M I;  1RNI A;  2JMO A;  3GTJ I;  4DQY B;  2JA6 I;  3NH4 A;  3S1R I;  3CC7 1;  2M6N A;  1R9T I;  3T4N B;  3PHW A;  1S72 Z;  3ZNH A;  2F4O A;  2RBL A;  4NB8 A;  2KPI A;  3IX0 A;  1RO0 A;  2LIY A;  1X0T A;  1K73 1;  5FLX b;  3GCF A;  3HOW I;  3PO3 S;  1QVG Y;  4NBH A;  2OTL Z;  2R7Z I;  3MJ5 A;  2QRD B;  3FKI I;  3CC7 Z;  1W2B Y;  5CM2 M;  2NVT I;  1JJ2 Z;  4HGY A;  4A3C I;  5IP9 I;  1N8R 2;  2JUB A;  2JTC A;  1PFT A;  4IP3 A;  4NBD A;  1VQ8 1;  2RHB A;  1M90 1;  3H0G I;  1NJI 1;  3GTO I;  3KIF A;  1VQ4 1;  2BTW B;  1YZB A;  1VLA A;  1N2F A;  4WUR A;  3G71 1;  2JA8 I;  3CCJ 1;  3J80 f;  1Q7Y 1;  3GTK I;  2J7Q C;  4A93 I;  3NDJ A;  2BJO A;  1QYP A;  3EED A;  2F4M A;  1TFI A;  2G2K A;  2E2I I;  3ESW A;  3PHX A;  4CL1 A;  3W30 A;  4EWC A;  4MRI A;  3CC2 1;  1YJ9 1;  1VQ4 Z;  1VQP Z;  3G71 Z;  3MTV A;  4NFR A;  3TMP A;  4E30 A;  3HOX I;  2V8K A;  4BBS I;  4E2Z A;  2QLV B;  4BY1 I;  1Y1V S;  3MON A;  2JA7 I;  3S2H I;  1KQS Z;  4MD7 A;  3PSE A;  2IZ3 A;  4RNA A;  1Y1V I;  2YU9 I;  1X3Z A;  3CC2 Z;  1YJ9 Z;  5KO3 A;  4A3B I;  3CD6 1;  2R93 I;  5FLM I;  4A3D I;  1TWF I;  4HH4 A;  1USP B;  4DGL A;  3HOV I;  4GUA A;  2QA4 1;  1TWH I;  3GTP I;  5IT9 b;  1VQN 1;  3S1Q I;  3CMA 1;  1DKI A;  3PHU A;  1K8A 1;  2QRC B;  3RZD I;  3PO2 I;  3QWU A;  2B63 I;  3CD6 Z;  1LQL A;  2E2J I;  3VB9 A;  3FQM A;  1RO4 A;  4R3D A;  4Y7N I;  3JAM f;  3CME 1;  5EZQ A;  3VMH A;  4NH1 C;  2QA4 Z;  4E2Y A;  4D8B A;  1WW9 A;  3D9X A;  5D1P A;  1VQN Z;  4A3E I;  3PT2 A;  3E9S A;  3GTL I;  3CMA Z;  4RVG A;  4BOP A;  4A3G I;  3I56 1;  3NDI A;  3NH8 A;  2NVX I;  3CCV 1;  2V8I A;  1QVF Z;  5IP7 I;  4A5U A;  4AYB A;  4XZX A;  3CME Z;  3BB7 A;  1DL6 A;  3HOU I;  1VQM 1;  3OW2 Y;  4BOZ A;  4A3J I;  1X3W A;  3VMG A;  3I56 Z;  4BOU A;  2ZAE B;  4NBA A;  1KRL A;  2NVQ I;  3RNV A;  3D6W A;  3J81 b;  4RF1 A;  4A3I I;  1VQ7 1;  3W31 A;  2OOY B;  4E2X A;  1YJN 1;  1SFO I;  1P9N A;  4BOQ A;  1VQM Z;  2PM9 A;  4A3K I;  3IFU A;  1K9M 2;  1Q86 2;  3CCR 1;  3F3P C;  5FLX f;  5C4J I;  1Q81 1;  4S1T A;  3CCS 1;  1UKF A;  5EZS A;  1M1K 2;  1YIJ 1;  2HU9 A;  1VQ7 Z;  2DE5 A;  4NBB A;  1VQO 1;  4NBC A;  1YJN Z;  3RZO I;  4TNU A;  3S15 I;  4BXX I;  4QTT A;  3GTG I;  3CCR Z;  2DE7 A;  1RLY A;  4MXU A;  4RKX A;  3HKZ A;  1VQ8 Z;  3GTQ I;  3CCS Z;  4E32 A;  4M0W A;  3S1N I;  1NP6 A;  2JNY A;  1YIJ Z;  1VQO Z;  1VQL 1;  3IF8 A;  3CXC Z;  4QTU A;  1WII A;  2YAD A;  2AGA A;  2Z84 A;  1Z01 A;  3HOY I;  2J7Q A;  3CCJ Z;  4DK1 A;  3G4S 1;  3M3Y I;  1KC8 2;  1YUK A;  5C3E I;  2QEX 1;  2AKL A;  1WCM I;  2VF1 A;  1TWC I;  4NBG A;  3PRP A;  2PMZ A;  2Y0S A;  3I55 1;  2OOX B;  2WAQ A;  3MP2 A;  4HGZ A;  4BBR I;  5JZE A;  3KIH A;  3G4S Z;  1YUA A;  4NOZ A;  1K9M 1;  1N8R 1;  2P28 A;  2VUG A;  4A3F I;  3TDH B;  3GTM I;  3MZK B;  3B21 A;  3LUS A;  4E33 A;  4E2W A;  2V8J A;  2GTI A;  1VQ9 1;  2EGT A;  3M4O I;  5A2Q f;  3I55 Z;  3Q87 A;  5E6J A;  3CC4 1;  2DE6 A;  1QVG Z;  3BY4 A;  4MH4 A;  5T6B A;  1KD1 2;  4RVH A;  1W2B Z;  3JAM b;  4RVD A;  1VQ9 Z;  3J7A 4;  2Q51 A;  2OTJ 1;  3H3V J;  3EER A;  3CPW Y;  3VTN A;  3CC4 Z;  4BY7 I;  4IUM A;  3TRK A;  2RIQ A;  1VQ5 1;  1M90 2;  1NJI 2;  2DOS A;  3I07 A;  4XX2 A;  4MON A;  2RPR A;  2M48 A;  1KQS Y;  3C0R A;  1Q7Y 2;  1S72 1;  2OTJ Z;  3CCV Z;  4E31 A;  4HXD B;  2E2H I;  1YJW 1;  2NVY I;  1YHQ 1;  2OZK A;  1VQ5 Z;  3BBA A;  2W04 A;  4D8I A;  5AN9 F;  1JWH C;  2OTL 1;  4A3M I;  3S1M I;  1TWG I;  2JS4 A;  2E9H A;  2JRI A;  3O65 A;  5T64 A;  3MZL B;  5C44 I;  1ZH1 A;  4NBF A;  2BTW A;  4D8E A;  3BG0 B;  1Q82 2;  4P16 A;  3J81 f;  1YJW Z;  3G6E 1;  2JR6 A;  4X6A I;  1YHQ Z;  2QKD A;  3CCE 1;  4NBE A;  3PRM A;  1I6H I;  2GU2 A;  3OQC A;  1KD1 1;  4RF0 A;  3PO3 I;  2GTH A;  1L1O C;  5C4X I;  3CCM 1;  2QR1 B;  3CQZ I;  4OVZ A;  2K3R A;  1K83 I;  1ZB9 A;  3J80 b;  3G6E Z;  3CCL 1;  1YIT 1;  1QVF Y;  4NB9 A;  2P3Y A;  3CCE Z;  2W03 A;  1Z02 A;  1K8A 2;  4MD8 A;  4Y52 I;  1Z03 A;  1I50 I;  2LFU A;  1VQP 1;  3BG1 B;  3F3F C;  3TE5 B;  3I4N I;  3CCM Z;  2KI7 B;  1YI2 1;  1VQK 1;  1TWA I;  3NH5 A;  3GKQ A;  3CCL Z;  1ML8 A;  1YIT Z;  2R92 I;  2Q4Z A;  3S2D I;  3FQQ A;  1NUI A;  1ZB8 A;  1USP A;  2IZ4 A;  3P5J B;  5D1O A;  1VQL Z;  4A3L I;  4OVZ B;  4RV9 A;  1JJ2 Y;  3CPW Z;  3HOZ I;  3GTM S;  3CCQ 1;  3CCU 1;  1YI2 Z;  2HF1 A;  1VQK Z;  1Q86 1;  2QEX Z;  1Q82 1;  2UZJ A;  3S14 I;  1I3Q I;  1VQ6 1;  3OW2 Z;  2FE8 A;  3U50 C;  2BU3 A;  1M1K 1;  4MM3 B;  1K73 2;  2PK7 A;  5A2Q b;  3NFZ A;  3CCQ Z;  1Y1W I;  3CCU Z;  5IT9 f;  2O4H A;  2O53 A;  3S16 I;  2R6M A;  2H85 A;  2WB1 A;  1PVJ A;  4ZTB A;  5D1O B;  1VQ6 Z;  2HWK A;  3CXC Y;  2J6A A;  4RS4 A;  1Q81 2;  2JA5 I;  4BOS A;  5T67 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...