3IFUA

The crystal structure of porcine reproductive and respiratory syndrome virus (prrsv) leader protease nsp1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
175
structure length
175
Chain Sequence
DRCTCTPNARVFVAEGQVYCTRCLSARSLLPLNLQVPELGVLGLFYRPEEPLRWTLPRAFPTVECSPAGACWLSAIFPIARMTSGNLNFQQRMVRVAAEIYRAGQLTPTVLKTLQVYERGCRWYPIVGPVPGVGVYANSLHVSDKPFPGATHVLTNLPLPQRPKPEDFCPFECAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-structural protein
publication title Crystal structure of porcine reproductive and respiratory syndrome virus leader protease Nsp1alpha
pubmed doi rcsb
source organism Porcine reproductive and respiratory syndrome virus
molecule tags Transcription
total genus 37
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2009-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05410 Peptidase_C31 Porcine arterivirus-type cysteine proteinase alpha
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.250 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ifuA01
3.90.70.60 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3ifuA02
3IFUA
chains in the Genus database with same CATH superfamily
4BOQA 2YJBA 2CB5A 3FQQA 1TWGI 3NFZA 3IV2A 3H3VJ 5LL6f 4BOUA 2NQAA 2IBIA 2VUMI 4PADA 3H89A 1S4VA 4CDCB 4A3KI 2PK7A 4RV9A 2ARYA 1ZH1A 4YYQA 1NL6A 4YYRA 4NB9A 2R9FA 2YU9I 1TWFI 1CSBB 1MEMA 2AYDA 3F3PC 2Q4ZA 2XU3A 3LFYA 3DF0A 4OVZB 3I561 1KXRA 5FLMI 3CCJZ 4DQYB 3S15I 2ATOA 4YYUA 3CCJ1 5D1OB 4A3FI 4NBDA 1PCIA 4YYWA 1JQPA 1TFIA 1WCMI 2VPWA 3IHPA 4BS6A 3PRPA 1TWAI 4E33A 5EF4A 2DE6A 4NBHA 3IEJA 3N3KA 3PHWA 1ML8A 2OTL1 2DC7A 2Q51A 1VQPZ 3GTPI 4Y7NI 1PBHA 3OW2Z 3D6SA 3GTGI 2R9MA 3JAMf 1S72Z 2G7YA 3H8BA 1S721 1CQDA 2AU1A 2JA7I 2J7QA 4PI3A 2JRIA 2E02A 1YT7A 2AUZA 3KSEA 2DC9A 2FRQA 2HF1A 5CHTA 4W4UA 4QRGA 1EWPA 2YJCA 4NBCA 3D6WA 2BDLA 2HHNA 3RVXA 1RO4A 3P5VA 3P5JB 3S1NI 1K3BB 3W30A 4A5UA 1YUAA 1NQCA 3E1ZB 2JTCA 1KC81 1K732 3CC2Z 6PADA 1CVZA 1QVFZ 4RF0A 3CC21 1KHPA 1AIMA 3S2HI 2FUDA 3V6CA 3WXFA 3RZDI 2JA8I 1W2BY 1K9M1 3P5UA 1JJ2Y 3H6SA 3HOUI 4XUIA 3T4NB 2O53A 2JQFR 1USPB 3FQMA 2WB1A 2E2HI 2YJ2A 1RNIA 2DE5A 5IP7I 1FDIA 3K8UA 4A3MI 3J81f 4W5CA 4HXDB 1KRLA 5AN9F 1VQKZ 1ICFA 3BOWA 3OF8A 2B1NA 2K3RA 3D9XA 4FJCA 3HOVI 1PPDA 3I4NI 1VSNA 4PP1A 1Z01A 2K5RA 1VJVA 3S14I 4CDFB 4DK1A 3KX1A 3HOWI 3S16I 3USVA 3B21A 1VLAA 2PADA 2AS8A 1TLOA 2GFOA 2I3CA 4QBBA 3F3FC 1YI2Z 3IOQA 1STFE 3KIHA 1ZIVA 1YI21 2AYOA 1ITOA 2JIPA 1MDWA 5JH3A 1MHWA 2QREB 1Y4HA 1YITZ 3J81b 3I07A 4BBRI 1AU0A 1GMYA 4P6GA 1YIT1 3TMPA 3G71Z 2E01A 1NP6A 4GUAA 1PVJA 2QRCB 2ZAEB 3G711 3TDHB 2HU9A 1DEUA 3I06A 5JZEA 1NPZA 4RS4A 1I50I 1YHQ1 3BG0B 4NFRA 2GTHA 1Q7Y1 4BY7I 1I3QI 4X6JA 1NLJA 3U8EA 1WJ2A 1KC82 1KFXL 3K24A 3KW9A 1CB5A 4RVGA 2DC6A 3EEDA 3CXCY 3PO2I 2XU4A 4M0WA 4RF1A 3MTVA 3CCMZ 1AECA 2O6XA 2P3YA 1FDOA 3CCM1 5J94A 1Q821 3CCS1 3WXGA 2J7QC 4I04A 1Q811 1K9M2 5C4XI 1YZBA 4OELA 1SNKA 1A6RA 3S2DI 1QVGZ 3CMEZ 1POPA 2E03A 1Q861 1YUKA 3CME1 2VF1A 4KLBA 4ZTBA 3G6E1 3KWBX 1NUIA 5CM2M 4E32A 1VQ9Z 3W31A 4R3DA 2IZ3A 1VQ91 3BB7A 2VHSA 3N4CA 2DZYA 2G8EA 1AA6A 3F75A 3AI8A 3MORA 1TL9A 2VHFA 2QR1B 2JA6I 2HD5A 2V8JA 1YK7A 2FE8A 2NVXI 2W04A 1QXFA 3PBHA 2WBFX 4YVAA 1VQMZ 3EERA 4FK5A 1M901 1VQM1 2XU1A 3NH8A 3MHHA 4A3CI 3HKZA 3KIFA 2E7ZA 1AU3A 3GTMI 3B79A 4ZUXU 2JIRA 4HWYA 1AU4A 4MD7A 1X0TA 1RO2A 1WZNA 2RIQA 3M4OI 3M3YI 1BGOA 1ME3A 3MTNA 4CDDB 2VPXA 1TU6A 1QOLA 4A3BI 4I05A 2R9OA 2R9NA 4D8IA 2M6NA 4MXUA 3MZLB 3I56Z 3N3GA 1AYVA 2PBHA 4MZSA 2KPIA 2AUXA 3J7A4 3K7AI 2FYEA 3BWKA 5T67A 4YYSA 1VQ4Z 4YYVA 3GTLI 3MJ5A 1VQ41 2AIMA 4E2ZA 1Q7Y2 4NH1C 1PFTA 1N2FA 2JS4A 1VQ51 2OTLZ 4RY2A 3CCVZ 1M1K1 2P86A 3CCV1 2DE7A 1YJ9Z 2LEXA 1GLOA 2AYNA 1YJ91 1DL6A 1EF7A 3NDJA 4BPVA 3BG1B 3CMAZ 1Q822 1KQSZ 2OTJZ 1MIRA 3J80f 3CMA1 2OTJ1 1Q812 2R6NA 3CBJA 4G54A 4E31A 1EWMA 1CPJA 1PADA 3OW2Y 1Q862 3RVWA 2QEX1 2E2JI 3PDFA 5IP9I 2JR6A 2JMOA 4QRXA 3D2LA 4MM3B 3S1MI 3CH3X 3CBKA 1RQFA 5KO3A 1F2CA 1U9WA 4A3DI 2F1GA 2P7UA 2GTIA 1Y8CA 4A3JI 2RPRA 3HOZI 1Y1VS 1CV8A 2QLVB 4HH4A 3Q87A 2JIOA 5CVNB 3NDIA 1U9VA 1SIWA 7PCKA 3BPMA 4P16A 4I07A 5T64A 3PO3I 1M902 4BXXI 1U5IA 1YALA 2M48A 2RBLA 1L1OC 3U50C 1AYWA 4MI7A 4DMYA 1BQIA 3CPWZ 4NB8A 5IT9f 4MONA 4NOZA 2PMZA 3JAMb 1CS8A 1N8R1 3BC3A 1QVFY 1AYUA 5PADA 1GCBA 2O4HA 1ZCMA 4AXMA 3TNXA 2VPZA 9PAPA 4NBEA 4XR7A 1X3ZA 4HGZA 3CH2X 2BDZA 4P6EA 5T6BA 1BP4A 1MS6A 3WXEA 1ZB9A 1SFOI 3GTJI 4E2YA 1THEA 4BOSA 1YJWZ 5F02A 3QT4A 2IZ4A 1YJW1 2G6DA 2HH5A 3BBAA 2DJGB 2JUBA 5C4JI 3BPFA 2OULA 1ZB8A 2GU2A 2R93I 1M1K2 4CL1A 3HOYI 2YADA 2C0YA 1F2BA 4N8WA 2KI7B 2DCCA 3PT2A 3TRKA 3QJ3A 2DOSA 2R92I 4X6IA 1GECE 5FLXf 3CCL1 3H0GI 3S1RI 3GKQA 2BTWA 3CC4Z 1S7MA 3CC41 3PNRA 8PCHA 3RVVA 2QA4Z 1Y1WI 4PP2E 4YV8A 2QA41 3HOXI 4MRIA 3I3TA 3VTNA 1K8A1 1PXVA 1YHQZ 3S1QI 3NH4A 2FQ9A 1YJNZ 3O1GA 1YJN1 4EWCA 2IV2X 1RLYA 3GTOI 2F4OA 5K16A 3OISA 2PNSA 4A3LI 4X6AI 1HUCB 2FRAA 3BY4A 3IMAA 2R7ZI 2Y5BA 4MSXA 4E2XA 3CCSZ 5A2Qf 4TNUA 1VQO1 1AU2A 3MZKB 1JWHC 2R9CA 4BSQA 3OQCA 5CHVA 1KD11 4OEMA 4A3GI 1N8R2 2DC8A 2V45A 2G2KA 4S1TA 3G6EZ 2HWKA 5EZSA 3CCE1 3M99A 3C0RA 3P5XA 4E30A 3KWZA 3V6EA 4MD8A 1FH0A 2AVWA 3ZUAA 3BCNA 1SP4B 2FT2A 1QVGY 2V8IA 2OZ2A 2OP3A 1QF8A 4NBFA 2RHBA 1DKIA 1X9YA 2NVQI 2NAPA 4MH4A 3S3RA 4WA6A 4QTTA 2F7DA 3QSDA 1EWLA 2DCBA 2J6AA 1Y08A 3OVXA 3KKUA 3RNVA 5C3EI 4NBAA 3GCBA 3PHUA 2AKLA 3NH5A 1X3WA 4MZOA 3S3QA 2DCDA 1QXPA 1K8A2 2G8JA 1ATKA 3F5VA 2BJOA 1VQ5Z 3KFQA 4IP3A 1Z02A 3LUSA 1KHQA 2B63I 2HXZA 2NQDB 4NBGA 3IF8A 3H7DA 5CVOB 1NB5A 2JIMA 3CD6Z 1KD12 3CD61 2AGAA 2OOYB 1O0EA 3O65A 5C44I 1NJI1 2PREA 2QEXZ 4Y52I 3LXSA 2VPYA 1DF0A 4XX2A 1KQSY 1UKFA 3TE5B 1TWHI 2OOXB 3VB9A 3E9SA 4A3EI 2P28A 4OVZA 4RVHA 2JNYA 3G4SZ 2H85A 3CCQZ 1Z03A 4BY1I 3G4S1 3CCQ1 4CZWA 5D1OA 2QKDA 3GTKI 2NVYI 3O0UA 2V8KA 1VQP1 3PW3A 3K9MA 1QMYA 3IR7A 1CTEA 1WIIA 2W03A 2XU5A 3ESWA 4BOZA 1PPNA 1VQ7Z 3PSEA 1KFUL 1VQ71 3J80b 4NBBA 2NQGA 2DJFB 1Q16A 2FO5A 4BOPA 1K83I 3GTQI 4DMXA 3CPWY 2ACTA 1U9XA 1W2BZ 2IPPB 1JJ2Z 2E2II 2P0RA 3GCFA 1PIPA 4BBSI 2B1MA 1PPPA 1ME4A 4A3II 1P9NA 4QH6A 2BTWB 3QWUA 2F4MA 1YVBA 3C9EA 3ZNHA 4Q8GA 4AXLA 1VQNZ 1I6HI 3VMGA 3CCLZ 1VQN1 5IT9b 1XKGA 3HHIA 4CDEB 4A93I 5D1PA 1BY8A 4RNAA 2Y6EA 4K7CA 3GTMS 4RVFA 2LIYA 1VQK1 2JIQA 3ERVA 4QRVA 1R9TI 1USPA 4D8BA 3FKII 1YK8A 1YIJZ 4FIPA 1YIJ1 1NJI2 3OF9A 5EZQA 5FPWA 4W5BA 3PHXA 4WURA 2GHUA 3CQZI 2E00A 4N79A 2CIOA 2YJ8A 3IX0A 2YJ9A 3OVZA 2PM9A 2LFUA 3MHSA 1LQLA 5JA7A 4OW0A 4X6HA 1M6DA 2VUGA 2Z84A 1MEGA 1VQOZ 2FTDA 1Q6KA 3VMHA 4D8EA 5FLXb 4RKXA 2OZKA 2V3VA 4N4ZA 2EGTA 2Y0SA 3IFUA 1VQ8Z 3MONA 4QTUA 3CXCZ 1NB3A 1Y1VI 3CCEZ 1VQ81 1PE6A 5EGWA 4BS5A 4Q8HA 3I4MI 1F29A 5E6JA 1QYPA 3PRMA 3MP2A 2R6MA 1IWDA 1PPOA 1RO0A 3HWNA 1VQ6Z 3CCRZ 2NQIA 1VQ61 3CCR1 1EWOA 2H7JA 3I55Z 1TWCI 3RZOI 2RT9A 3I551 1QDQA 4REZA 2WAQA 4HGYA 1U9QX 2DZZA 5A2Qb 2DCAA 4AYBA 2JQGR 3PO3S 4MD9A 3VMIA 3CCUZ 3CCU1 2E9HA 3HD3A 1CJLA 3NHEA 2QRDB 4E2WA 3S17I 2BU3A 1F2AA 4IUMA 2JA5I 3P5WA 3IUTA 3HHAA 4BQVA 2UZJA 3CC7Z 4PT5A 5CVMA 2NVTI 5A24A 3CC71 1VQLZ 4DGLA 3H8CA 1K731 4XZXA 1WW9A 1VQL1 4RVDA
chains in the Genus database with same CATH topology
4BOQA 3FQQA 1TWGI 3NFZA 3H3VJ 5LL6f 4BOUA 2VUMI 4A3KI 2PK7A 4RV9A 1ZH1A 4NB9A 2YU9I 1TWFI 3F3PC 2Q4ZA 4OVZB 3I561 5FLMI 3CCJZ 4DQYB 3S15I 3CCJ1 5D1OB 4A3FI 4NBDA 1TFIA 1WCMI 3PRPA 1TWAI 4E33A 2DE6A 4NBHA 3PHWA 1ML8A 2OTL1 2Q51A 1VQPZ 3GTPI 4Y7NI 3OW2Z 3GTGI 3JAMf 1S72Z 1S721 2JA7I 2J7QA 2JRIA 2HF1A 4NBCA 3D6WA 1RO4A 3W30A 3P5JB 3S1NI 4A5UA 1YUAA 2JTCA 1KC81 1K732 3CC2Z 4RF0A 1QVFZ 3CC21 3S2HI 3RZDI 2JA8I 1W2BY 1K9M1 1JJ2Y 3HOUI 3T4NB 2O53A 1USPB 3FQMA 2WB1A 2E2HI 1RNIA 2DE5A 5IP7I 4A3MI 3J81f 4HXDB 1KRLA 5AN9F 1VQKZ 2K3RA 3D9XA 3HOVI 3I4NI 1Z01A 2K5RA 3S14I 4DK1A 3HOWI 3S16I 3B21A 1VLAA 2I3CA 3F3FC 1YI2Z 3KIHA 1YI21 2QREB 1YITZ 3J81b 3I07A 4BBRI 3TMPA 1YIT1 3G71Z 1NP6A 4GUAA 1PVJA 2QRCB 2ZAEB 3G711 3TDHB 2HU9A 5JZEA 4RS4A 1I50I 1YHQ1 3BG0B 4NFRA 2GTHA 1Q7Y1 4BY7I 1I3QI 1KC82 4RVGA 3EEDA 3CXCY 3PO2I 4M0WA 4RF1A 3MTVA 3CCMZ 2P3YA 3CCM1 1Q821 3CCS1 2J7QC 1Q811 1K9M2 5C4XI 1YZBA 3S2DI 1QVGZ 3CMEZ 1Q861 1YUKA 3CME1 2VF1A 4ZTBA 3G6E1 3W31A 1NUIA 5CM2M 4E32A 1VQ9Z 4R3DA 2IZ3A 1VQ91 3BB7A 2QR1B 2JA6I 2V8JA 2FE8A 2NVXI 2W04A 1VQMZ 3EERA 1M901 1VQM1 3NH8A 4A3CI 3HKZA 3KIFA 3GTMI 4MD7A 1X0TA 1RO2A 2RIQA 3M4OI 3M3YI 4A3BI 4D8IA 2M6NA 4MXUA 3MZLB 3I56Z 2KPIA 3J7A4 3K7AI 5T67A 1VQ4Z 3GTLI 3MJ5A 1VQ41 4E2ZA 1Q7Y2 4NH1C 1PFTA 1N2FA 2JS4A 1VQ51 2OTLZ 3CCVZ 1M1K1 3CCV1 2DE7A 1YJ9Z 1YJ91 1DL6A 3NDJA 3BG1B 3CMAZ 1Q822 1KQSZ 2OTJZ 3J80f 3CMA1 2OTJ1 1Q812 4E31A 3OW2Y 1Q862 2QEX1 2E2JI 5IP9I 2JR6A 2JMOA 4MM3B 3S1MI 5KO3A 1RQFA 4A3DI 2GTIA 4A3JI 3HOZI 2RPRA 1Y1VS 2QLVB 4HH4A 3Q87A 3NDIA 4P16A 5T64A 3PO3I 1M902 4BXXI 4MI7A 2M48A 2RBLA 1L1OC 3U50C 3CPWZ 4NB8A 5IT9f 4MONA 4NOZA 2PMZA 3JAMb 1N8R1 1QVFY 2O4HA 4NBEA 1X3ZA 4HGZA 5T6BA 1ZB9A 1SFOI 3GTJI 4E2YA 4BOSA 1YJWZ 2IZ4A 1YJW1 3BBAA 2JUBA 5C4JI 1ZB8A 2GU2A 2R93I 1M1K2 4CL1A 3HOYI 2YADA 2KI7B 3PT2A 3TRKA 2DOSA 2R92I 5FLXf 3CCL1 3H0GI 3S1RI 3GKQA 2BTWA 3CC4Z 1S7MA 3CC41 2QA4Z 1Y1WI 2QA41 3HOXI 4MRIA 3VTNA 1K8A1 1YHQZ 3S1QI 3NH4A 1YJNZ 1YJN1 4EWCA 1RLYA 3GTOI 2F4OA 4A3LI 4X6AI 3BY4A 2R7ZI 4E2XA 3CCSZ 5A2Qf 4TNUA 1VQO1 3MZKB 1JWHC 3OQCA 1KD11 4A3GI 1N8R2 2G2KA 4S1TA 3G6EZ 2HWKA 5EZSA 3CCE1 3C0RA 4E30A 4MD8A 1QVGY 2V8IA 1QF8A 4NBFA 2RHBA 1DKIA 2NVQI 4MH4A 4QTTA 2J6AA 3RNVA 5C3EI 4NBAA 3PHUA 2AKLA 3NH5A 1X3WA 1K8A2 2BJOA 1VQ5Z 4IP3A 1Z02A 3LUSA 2B63I 4NBGA 3IF8A 3CD6Z 1KD12 3CD61 2AGAA 2OOYB 3O65A 5C44I 1NJI1 2QEXZ 4Y52I 1UKFA 4XX2A 1KQSY 3TE5B 1TWHI 2OOXB 3VB9A 3E9SA 4A3EI 2P28A 4OVZA 4RVHA 2JNYA 3G4SZ 2H85A 3CCQZ 1Z03A 4BY1I 3G4S1 3CCQ1 5D1OA 2QKDA 3GTKI 2NVYI 2V8KA 1VQP1 1WIIA 2W03A 3ESWA 4BOZA 1VQ7Z 3PSEA 1VQ71 3J80b 4NBBA 4BOPA 1K83I 3GTQI 3CPWY 1W2BZ 1JJ2Z 2E2II 3GCFA 4BBSI 4A3II 1P9NA 2BTWB 3QWUA 2F4MA 3ZNHA 1VQNZ 1I6HI 3VMGA 3CCLZ 1VQN1 5IT9b 4A93I 5D1PA 4RNAA 3GTMS 4RVFA 2LIYA 1VQK1 4D8BA 1R9TI 1USPA 3FKII 1YIJZ 1YIJ1 1NJI2 5EZQA 3PHXA 4WURA 3CQZI 3IX0A 2PM9A 2LFUA 1LQLA 4OW0A 2VUGA 2Z84A 1VQOZ 3VMHA 4D8EA 5FLXb 4RKXA 2OZKA 2EGTA 2Y0SA 3IFUA 1VQ8Z 3MONA 4QTUA 3CXCZ 1Y1VI 3CCEZ 1VQ81 3I4MI 5E6JA 1QYPA 3PRMA 3MP2A 2R6MA 1RO0A 1VQ6Z 3CCRZ 1VQ61 3CCR1 3I55Z 1TWCI 3RZOI 2RT9A 3I551 4REZA 2WAQA 4HGYA 5A2Qb 4AYBA 3PO3S 4MD9A 3VMIA 3CCUZ 3CCU1 2E9HA 4IUMA 2QRDB 4E2WA 3S17I 2BU3A 2JA5I 2UZJA 3CC7Z 4PT5A 2NVTI 3CC71 1VQLZ 4DGLA 4XZXA 1K731 1WW9A 1VQL1 4RVDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IFU A; 
#chains in the Genus database with same CATH topology
 4BOQ A;  2YJB A;  2CB5 A;  3FQQ A;  1TWG I;  3NFZ A;  3IV2 A;  3H3V J;  5LL6 f;  4BOU A;  2NQA A;  2IBI A;  2VUM I;  4PAD A;  3H89 A;  1S4V A;  4CDC B;  4A3K I;  2PK7 A;  4RV9 A;  2ARY A;  1ZH1 A;  4YYQ A;  1NL6 A;  4YYR A;  4NB9 A;  2R9F A;  2YU9 I;  1TWF I;  1CSB B;  1MEM A;  2AYD A;  3F3P C;  2Q4Z A;  2XU3 A;  3LFY A;  3DF0 A;  4OVZ B;  3I56 1;  1KXR A;  5FLM I;  3CCJ Z;  4DQY B;  3S15 I;  2ATO A;  4YYU A;  3CCJ 1;  5D1O B;  4A3F I;  4NBD A;  1PCI A;  4YYW A;  1JQP A;  1TFI A;  1WCM I;  2VPW A;  3IHP A;  4BS6 A;  3PRP A;  1TWA I;  4E33 A;  5EF4 A;  2DE6 A;  4NBH A;  3IEJ A;  3N3K A;  3PHW A;  1ML8 A;  2OTL 1;  2DC7 A;  2Q51 A;  1VQP Z;  3GTP I;  4Y7N I;  1PBH A;  3OW2 Z;  3D6S A;  3GTG I;  2R9M A;  3JAM f;  1S72 Z;  2G7Y A;  3H8B A;  1S72 1;  1CQD A;  2AU1 A;  2JA7 I;  2J7Q A;  4PI3 A;  2JRI A;  2E02 A;  1YT7 A;  2AUZ A;  3KSE A;  2DC9 A;  2FRQ A;  2HF1 A;  5CHT A;  4W4U A;  4QRG A;  1EWP A;  2YJC A;  4NBC A;  3D6W A;  2BDL A;  2HHN A;  3RVX A;  1RO4 A;  3P5V A;  3P5J B;  3S1N I;  1K3B B;  3W30 A;  4A5U A;  1YUA A;  1NQC A;  3E1Z B;  2JTC A;  1KC8 1;  1K73 2;  3CC2 Z;  6PAD A;  1CVZ A;  1QVF Z;  4RF0 A;  3CC2 1;  1KHP A;  1AIM A;  3S2H I;  2FUD A;  3V6C A;  3WXF A;  3RZD I;  2JA8 I;  1W2B Y;  1K9M 1;  3P5U A;  1JJ2 Y;  3H6S A;  3HOU I;  4XUI A;  3T4N B;  2O53 A;  2JQF R;  1USP B;  3FQM A;  2WB1 A;  2E2H I;  2YJ2 A;  1RNI A;  2DE5 A;  5IP7 I;  1FDI A;  3K8U A;  4A3M I;  3J81 f;  4W5C A;  4HXD B;  1KRL A;  5AN9 F;  1VQK Z;  1ICF A;  3BOW A;  3OF8 A;  2B1N A;  2K3R A;  3D9X A;  4FJC A;  3HOV I;  1PPD A;  3I4N I;  1VSN A;  4PP1 A;  1Z01 A;  2K5R A;  1VJV A;  3S14 I;  4CDF B;  4DK1 A;  3KX1 A;  3HOW I;  3S16 I;  3USV A;  3B21 A;  1VLA A;  2PAD A;  2AS8 A;  1TLO A;  2GFO A;  2I3C A;  4QBB A;  3F3F C;  1YI2 Z;  3IOQ A;  1STF E;  3KIH A;  1ZIV A;  1YI2 1;  2AYO A;  1ITO A;  2JIP A;  1MDW A;  5JH3 A;  1MHW A;  2QRE B;  1Y4H A;  1YIT Z;  3J81 b;  3I07 A;  4BBR I;  1AU0 A;  1GMY A;  4P6G A;  1YIT 1;  3TMP A;  3G71 Z;  2E01 A;  1NP6 A;  4GUA A;  1PVJ A;  2QRC B;  2ZAE B;  3G71 1;  3TDH B;  2HU9 A;  1DEU A;  3I06 A;  5JZE A;  1NPZ A;  4RS4 A;  1I50 I;  1YHQ 1;  3BG0 B;  4NFR A;  2GTH A;  1Q7Y 1;  4BY7 I;  1I3Q I;  4X6J A;  1NLJ A;  3U8E A;  1WJ2 A;  1KC8 2;  1KFX L;  3K24 A;  3KW9 A;  1CB5 A;  4RVG A;  2DC6 A;  3EED A;  3CXC Y;  3PO2 I;  2XU4 A;  4M0W A;  4RF1 A;  3MTV A;  3CCM Z;  1AEC A;  2O6X A;  2P3Y A;  1FDO A;  3CCM 1;  5J94 A;  1Q82 1;  3CCS 1;  3WXG A;  2J7Q C;  4I04 A;  1Q81 1;  1K9M 2;  5C4X I;  1YZB A;  4OEL A;  1SNK A;  1A6R A;  3S2D I;  1QVG Z;  3CME Z;  1POP A;  2E03 A;  1Q86 1;  1YUK A;  3CME 1;  2VF1 A;  4KLB A;  4ZTB A;  3G6E 1;  3KWB X;  1NUI A;  5CM2 M;  4E32 A;  1VQ9 Z;  3W31 A;  4R3D A;  2IZ3 A;  1VQ9 1;  3BB7 A;  2VHS A;  3N4C A;  2DZY A;  2G8E A;  1AA6 A;  3F75 A;  3AI8 A;  3MOR A;  1TL9 A;  2VHF A;  2QR1 B;  2JA6 I;  2HD5 A;  2V8J A;  1YK7 A;  2FE8 A;  2NVX I;  2W04 A;  1QXF A;  3PBH A;  2WBF X;  4YVA A;  1VQM Z;  3EER A;  4FK5 A;  1M90 1;  1VQM 1;  2XU1 A;  3NH8 A;  3MHH A;  4A3C I;  3HKZ A;  3KIF A;  2E7Z A;  1AU3 A;  3GTM I;  3B79 A;  4ZUX U;  2JIR A;  4HWY A;  1AU4 A;  4MD7 A;  1X0T A;  1RO2 A;  1WZN A;  2RIQ A;  3M4O I;  3M3Y I;  1BGO A;  1ME3 A;  3MTN A;  4CDD B;  2VPX A;  1TU6 A;  1QOL A;  4A3B I;  4I05 A;  2R9O A;  2R9N A;  4D8I A;  2M6N A;  4MXU A;  3MZL B;  3I56 Z;  3N3G A;  1AYV A;  2PBH A;  4MZS A;  2KPI A;  2AUX A;  3J7A 4;  3K7A I;  2FYE A;  3BWK A;  5T67 A;  4YYS A;  1VQ4 Z;  4YYV A;  3GTL I;  3MJ5 A;  1VQ4 1;  2AIM A;  4E2Z A;  1Q7Y 2;  4NH1 C;  1PFT A;  1N2F A;  2JS4 A;  1VQ5 1;  2OTL Z;  4RY2 A;  3CCV Z;  1M1K 1;  2P86 A;  3CCV 1;  2DE7 A;  1YJ9 Z;  2LEX A;  1GLO A;  2AYN A;  1YJ9 1;  1DL6 A;  1EF7 A;  3NDJ A;  4BPV A;  3BG1 B;  3CMA Z;  1Q82 2;  1KQS Z;  2OTJ Z;  1MIR A;  3J80 f;  3CMA 1;  2OTJ 1;  1Q81 2;  2R6N A;  3CBJ A;  4G54 A;  4E31 A;  1EWM A;  1CPJ A;  1PAD A;  3OW2 Y;  1Q86 2;  3RVW A;  2QEX 1;  2E2J I;  3PDF A;  5IP9 I;  2JR6 A;  2JMO A;  4QRX A;  3D2L A;  4MM3 B;  3S1M I;  3CH3 X;  3CBK A;  1RQF A;  5KO3 A;  1F2C A;  1U9W A;  4A3D I;  2F1G A;  2P7U A;  2GTI A;  1Y8C A;  4A3J I;  2RPR A;  3HOZ I;  1Y1V S;  1CV8 A;  2QLV B;  4HH4 A;  3Q87 A;  2JIO A;  5CVN B;  3NDI A;  1U9V A;  1SIW A;  7PCK A;  3BPM A;  4P16 A;  4I07 A;  5T64 A;  3PO3 I;  1M90 2;  4BXX I;  1U5I A;  1YAL A;  2M48 A;  2RBL A;  1L1O C;  3U50 C;  1AYW A;  4MI7 A;  4DMY A;  1BQI A;  3CPW Z;  4NB8 A;  5IT9 f;  4MON A;  4NOZ A;  2PMZ A;  3JAM b;  1CS8 A;  1N8R 1;  3BC3 A;  1QVF Y;  1AYU A;  5PAD A;  1GCB A;  2O4H A;  1ZCM A;  4AXM A;  3TNX A;  2VPZ A;  9PAP A;  4NBE A;  4XR7 A;  1X3Z A;  4HGZ A;  3CH2 X;  2BDZ A;  4P6E A;  5T6B A;  1BP4 A;  1MS6 A;  3WXE A;  1ZB9 A;  1SFO I;  3GTJ I;  4E2Y A;  1THE A;  4BOS A;  1YJW Z;  5F02 A;  3QT4 A;  2IZ4 A;  1YJW 1;  2G6D A;  2HH5 A;  3BBA A;  2DJG B;  2JUB A;  5C4J I;  3BPF A;  2OUL A;  1ZB8 A;  2GU2 A;  2R93 I;  1M1K 2;  4CL1 A;  3HOY I;  2YAD A;  2C0Y A;  1F2B A;  4N8W A;  2KI7 B;  2DCC A;  3PT2 A;  3TRK A;  3QJ3 A;  2DOS A;  2R92 I;  4X6I A;  1GEC E;  5FLX f;  3CCL 1;  3H0G I;  3S1R I;  3GKQ A;  2BTW A;  3CC4 Z;  1S7M A;  3CC4 1;  3PNR A;  8PCH A;  3RVV A;  2QA4 Z;  1Y1W I;  4PP2 E;  4YV8 A;  2QA4 1;  3HOX I;  4MRI A;  3I3T A;  3VTN A;  1K8A 1;  1PXV A;  1YHQ Z;  3S1Q I;  3NH4 A;  2FQ9 A;  1YJN Z;  3O1G A;  1YJN 1;  4EWC A;  2IV2 X;  1RLY A;  3GTO I;  2F4O A;  5K16 A;  3OIS A;  2PNS A;  4A3L I;  4X6A I;  1HUC B;  2FRA A;  3BY4 A;  3IMA A;  2R7Z I;  2Y5B A;  4MSX A;  4E2X A;  3CCS Z;  5A2Q f;  4TNU A;  1VQO 1;  1AU2 A;  3MZK B;  1JWH C;  2R9C A;  4BSQ A;  3OQC A;  5CHV A;  1KD1 1;  4OEM A;  4A3G I;  1N8R 2;  2DC8 A;  2V45 A;  2G2K A;  4S1T A;  3G6E Z;  2HWK A;  5EZS A;  3CCE 1;  3M99 A;  3C0R A;  3P5X A;  4E30 A;  3KWZ A;  3V6E A;  4MD8 A;  1FH0 A;  2AVW A;  3ZUA A;  3BCN A;  1SP4 B;  2FT2 A;  1QVG Y;  2V8I A;  2OZ2 A;  2OP3 A;  1QF8 A;  4NBF A;  2RHB A;  1DKI A;  1X9Y A;  2NVQ I;  2NAP A;  4MH4 A;  3S3R A;  4WA6 A;  4QTT A;  2F7D A;  3QSD A;  1EWL A;  2DCB A;  2J6A A;  1Y08 A;  3OVX A;  3KKU A;  3RNV A;  5C3E I;  4NBA A;  3GCB A;  3PHU A;  2AKL A;  3NH5 A;  1X3W A;  4MZO A;  3S3Q A;  2DCD A;  1QXP A;  1K8A 2;  2G8J A;  1ATK A;  3F5V A;  2BJO A;  1VQ5 Z;  3KFQ A;  4IP3 A;  1Z02 A;  3LUS A;  1KHQ A;  2B63 I;  2HXZ A;  2NQD B;  4NBG A;  3IF8 A;  3H7D A;  5CVO B;  1NB5 A;  2JIM A;  3CD6 Z;  1KD1 2;  3CD6 1;  2AGA A;  2OOY B;  1O0E A;  3O65 A;  5C44 I;  1NJI 1;  2PRE A;  2QEX Z;  4Y52 I;  3LXS A;  2VPY A;  1DF0 A;  4XX2 A;  1KQS Y;  1UKF A;  3TE5 B;  1TWH I;  2OOX B;  3VB9 A;  3E9S A;  4A3E I;  2P28 A;  4OVZ A;  4RVH A;  2JNY A;  3G4S Z;  2H85 A;  3CCQ Z;  1Z03 A;  4BY1 I;  3G4S 1;  3CCQ 1;  4CZW A;  5D1O A;  2QKD A;  3GTK I;  2NVY I;  3O0U A;  2V8K A;  1VQP 1;  3PW3 A;  3K9M A;  1QMY A;  3IR7 A;  1CTE A;  1WII A;  2W03 A;  2XU5 A;  3ESW A;  4BOZ A;  1PPN A;  1VQ7 Z;  3PSE A;  1KFU L;  1VQ7 1;  3J80 b;  4NBB A;  2NQG A;  2DJF B;  1Q16 A;  2FO5 A;  4BOP A;  1K83 I;  3GTQ I;  4DMX A;  3CPW Y;  2ACT A;  1U9X A;  1W2B Z;  2IPP B;  1JJ2 Z;  2E2I I;  2P0R A;  3GCF A;  1PIP A;  4BBS I;  2B1M A;  1PPP A;  1ME4 A;  4A3I I;  1P9N A;  4QH6 A;  2BTW B;  3QWU A;  2F4M A;  1YVB A;  3C9E A;  3ZNH A;  4Q8G A;  4AXL A;  1VQN Z;  1I6H I;  3VMG A;  3CCL Z;  1VQN 1;  5IT9 b;  1XKG A;  3HHI A;  4CDE B;  4A93 I;  5D1P A;  1BY8 A;  4RNA A;  2Y6E A;  4K7C A;  3GTM S;  4RVF A;  2LIY A;  1VQK 1;  2JIQ A;  3ERV A;  4QRV A;  1R9T I;  1USP A;  4D8B A;  3FKI I;  1YK8 A;  1YIJ Z;  4FIP A;  1YIJ 1;  1NJI 2;  3OF9 A;  5EZQ A;  5FPW A;  4W5B A;  3PHX A;  4WUR A;  2GHU A;  3CQZ I;  2E00 A;  4N79 A;  2CIO A;  2YJ8 A;  3IX0 A;  2YJ9 A;  3OVZ A;  2PM9 A;  2LFU A;  3MHS A;  1LQL A;  5JA7 A;  4OW0 A;  4X6H A;  1M6D A;  2VUG A;  2Z84 A;  1MEG A;  1VQO Z;  2FTD A;  1Q6K A;  3VMH A;  4D8E A;  5FLX b;  4RKX A;  2OZK A;  2V3V A;  4N4Z A;  2EGT A;  2Y0S A;  3IFU A;  1VQ8 Z;  3MON A;  4QTU A;  3CXC Z;  1NB3 A;  1Y1V I;  3CCE Z;  1VQ8 1;  1PE6 A;  5EGW A;  4BS5 A;  4Q8H A;  3I4M I;  1F29 A;  5E6J A;  1QYP A;  3PRM A;  3MP2 A;  2R6M A;  1IWD A;  1PPO A;  1RO0 A;  3HWN A;  1VQ6 Z;  3CCR Z;  2NQI A;  1VQ6 1;  3CCR 1;  1EWO A;  2H7J A;  3I55 Z;  1TWC I;  3RZO I;  2RT9 A;  3I55 1;  1QDQ A;  4REZ A;  2WAQ A;  4HGY A;  1U9Q X;  2DZZ A;  5A2Q b;  2DCA A;  4AYB A;  2JQG R;  3PO3 S;  4MD9 A;  3VMI A;  3CCU Z;  3CCU 1;  2E9H A;  3HD3 A;  1CJL A;  3NHE A;  2QRD B;  4E2W A;  3S17 I;  2BU3 A;  1F2A A;  4IUM A;  2JA5 I;  3P5W A;  3IUT A;  3HHA A;  4BQV A;  2UZJ A;  3CC7 Z;  4PT5 A;  5CVM A;  2NVT I;  5A24 A;  3CC7 1;  1VQL Z;  4DGL A;  3H8C A;  1K73 1;  4XZX A;  1WW9 A;  1VQL 1;  4RVD A; 
#chains in the Genus database with same CATH homology
 4BOQ A;  3FQQ A;  1TWG I;  3NFZ A;  3H3V J;  5LL6 f;  4BOU A;  2VUM I;  4A3K I;  2PK7 A;  4RV9 A;  1ZH1 A;  4NB9 A;  2YU9 I;  1TWF I;  3F3P C;  2Q4Z A;  4OVZ B;  3I56 1;  5FLM I;  3CCJ Z;  4DQY B;  3S15 I;  3CCJ 1;  5D1O B;  4A3F I;  4NBD A;  1TFI A;  1WCM I;  3PRP A;  1TWA I;  4E33 A;  2DE6 A;  4NBH A;  3PHW A;  1ML8 A;  2OTL 1;  2Q51 A;  1VQP Z;  3GTP I;  4Y7N I;  3OW2 Z;  3GTG I;  3JAM f;  1S72 Z;  1S72 1;  2JA7 I;  2J7Q A;  2JRI A;  2HF1 A;  4NBC A;  3D6W A;  1RO4 A;  3W30 A;  3P5J B;  3S1N I;  4A5U A;  1YUA A;  2JTC A;  1KC8 1;  1K73 2;  3CC2 Z;  4RF0 A;  1QVF Z;  3CC2 1;  3S2H I;  3RZD I;  2JA8 I;  1W2B Y;  1K9M 1;  1JJ2 Y;  3HOU I;  3T4N B;  2O53 A;  1USP B;  3FQM A;  2WB1 A;  2E2H I;  1RNI A;  2DE5 A;  5IP7 I;  4A3M I;  3J81 f;  4HXD B;  1KRL A;  5AN9 F;  1VQK Z;  2K3R A;  3D9X A;  3HOV I;  3I4N I;  1Z01 A;  2K5R A;  3S14 I;  4DK1 A;  3HOW I;  3S16 I;  3B21 A;  1VLA A;  2I3C A;  3F3F C;  1YI2 Z;  3KIH A;  1YI2 1;  2QRE B;  1YIT Z;  3J81 b;  3I07 A;  4BBR I;  3TMP A;  1YIT 1;  3G71 Z;  1NP6 A;  4GUA A;  1PVJ A;  2QRC B;  2ZAE B;  3G71 1;  3TDH B;  2HU9 A;  5JZE A;  4RS4 A;  1I50 I;  1YHQ 1;  3BG0 B;  4NFR A;  2GTH A;  1Q7Y 1;  4BY7 I;  1I3Q I;  1KC8 2;  4RVG A;  3EED A;  3CXC Y;  3PO2 I;  4M0W A;  4RF1 A;  3MTV A;  3CCM Z;  2P3Y A;  3CCM 1;  1Q82 1;  3CCS 1;  2J7Q C;  1Q81 1;  1K9M 2;  5C4X I;  1YZB A;  3S2D I;  1QVG Z;  3CME Z;  1Q86 1;  1YUK A;  3CME 1;  2VF1 A;  4ZTB A;  3G6E 1;  3W31 A;  1NUI A;  5CM2 M;  4E32 A;  1VQ9 Z;  4R3D A;  2IZ3 A;  1VQ9 1;  3BB7 A;  2QR1 B;  2JA6 I;  2V8J A;  2FE8 A;  2NVX I;  2W04 A;  1VQM Z;  3EER A;  1M90 1;  1VQM 1;  3NH8 A;  4A3C I;  3HKZ A;  3KIF A;  3GTM I;  4MD7 A;  1X0T A;  1RO2 A;  2RIQ A;  3M4O I;  3M3Y I;  4A3B I;  4D8I A;  2M6N A;  4MXU A;  3MZL B;  3I56 Z;  2KPI A;  3J7A 4;  3K7A I;  5T67 A;  1VQ4 Z;  3GTL I;  3MJ5 A;  1VQ4 1;  4E2Z A;  1Q7Y 2;  4NH1 C;  1PFT A;  1N2F A;  2JS4 A;  1VQ5 1;  2OTL Z;  3CCV Z;  1M1K 1;  3CCV 1;  2DE7 A;  1YJ9 Z;  1YJ9 1;  1DL6 A;  3NDJ A;  3BG1 B;  3CMA Z;  1Q82 2;  1KQS Z;  2OTJ Z;  3J80 f;  3CMA 1;  2OTJ 1;  1Q81 2;  4E31 A;  3OW2 Y;  1Q86 2;  2QEX 1;  2E2J I;  5IP9 I;  2JR6 A;  2JMO A;  4MM3 B;  3S1M I;  5KO3 A;  1RQF A;  4A3D I;  2GTI A;  4A3J I;  3HOZ I;  2RPR A;  1Y1V S;  2QLV B;  4HH4 A;  3Q87 A;  3NDI A;  4P16 A;  5T64 A;  3PO3 I;  1M90 2;  4BXX I;  4MI7 A;  2M48 A;  2RBL A;  1L1O C;  3U50 C;  3CPW Z;  4NB8 A;  5IT9 f;  4MON A;  4NOZ A;  2PMZ A;  3JAM b;  1N8R 1;  1QVF Y;  2O4H A;  4NBE A;  1X3Z A;  4HGZ A;  5T6B A;  1ZB9 A;  1SFO I;  3GTJ I;  4E2Y A;  4BOS A;  1YJW Z;  2IZ4 A;  1YJW 1;  3BBA A;  2JUB A;  5C4J I;  1ZB8 A;  2GU2 A;  2R93 I;  1M1K 2;  4CL1 A;  3HOY I;  2YAD A;  2KI7 B;  3PT2 A;  3TRK A;  2DOS A;  2R92 I;  5FLX f;  3CCL 1;  3H0G I;  3S1R I;  3GKQ A;  2BTW A;  3CC4 Z;  1S7M A;  3CC4 1;  2QA4 Z;  1Y1W I;  2QA4 1;  3HOX I;  4MRI A;  3VTN A;  1K8A 1;  1YHQ Z;  3S1Q I;  3NH4 A;  1YJN Z;  1YJN 1;  4EWC A;  1RLY A;  3GTO I;  2F4O A;  4A3L I;  4X6A I;  3BY4 A;  2R7Z I;  4E2X A;  3CCS Z;  5A2Q f;  4TNU A;  1VQO 1;  3MZK B;  1JWH C;  3OQC A;  1KD1 1;  4A3G I;  1N8R 2;  2G2K A;  4S1T A;  3G6E Z;  2HWK A;  5EZS A;  3CCE 1;  3C0R A;  4E30 A;  4MD8 A;  1QVG Y;  2V8I A;  1QF8 A;  4NBF A;  2RHB A;  1DKI A;  2NVQ I;  4MH4 A;  4QTT A;  2J6A A;  3RNV A;  5C3E I;  4NBA A;  3PHU A;  2AKL A;  3NH5 A;  1X3W A;  1K8A 2;  2BJO A;  1VQ5 Z;  4IP3 A;  1Z02 A;  3LUS A;  2B63 I;  4NBG A;  3IF8 A;  3CD6 Z;  1KD1 2;  3CD6 1;  2AGA A;  2OOY B;  3O65 A;  5C44 I;  1NJI 1;  2QEX Z;  4Y52 I;  1UKF A;  4XX2 A;  1KQS Y;  3TE5 B;  1TWH I;  2OOX B;  3VB9 A;  3E9S A;  4A3E I;  2P28 A;  4OVZ A;  4RVH A;  2JNY A;  3G4S Z;  2H85 A;  3CCQ Z;  1Z03 A;  4BY1 I;  3G4S 1;  3CCQ 1;  5D1O A;  2QKD A;  3GTK I;  2NVY I;  2V8K A;  1VQP 1;  1WII A;  2W03 A;  3ESW A;  4BOZ A;  1VQ7 Z;  3PSE A;  1VQ7 1;  3J80 b;  4NBB A;  4BOP A;  1K83 I;  3GTQ I;  3CPW Y;  1W2B Z;  1JJ2 Z;  2E2I I;  3GCF A;  4BBS I;  4A3I I;  1P9N A;  2BTW B;  3QWU A;  2F4M A;  3ZNH A;  1VQN Z;  1I6H I;  3VMG A;  3CCL Z;  1VQN 1;  5IT9 b;  4A93 I;  5D1P A;  4RNA A;  3GTM S;  4RVF A;  2LIY A;  1VQK 1;  4D8B A;  1R9T I;  1USP A;  3FKI I;  1YIJ Z;  1YIJ 1;  1NJI 2;  5EZQ A;  3PHX A;  4WUR A;  3CQZ I;  3IX0 A;  2PM9 A;  2LFU A;  1LQL A;  4OW0 A;  2VUG A;  2Z84 A;  1VQO Z;  3VMH A;  4D8E A;  5FLX b;  4RKX A;  2OZK A;  2EGT A;  2Y0S A;  3IFU A;  1VQ8 Z;  3MON A;  4QTU A;  3CXC Z;  1Y1V I;  3CCE Z;  1VQ8 1;  3I4M I;  5E6J A;  1QYP A;  3PRM A;  3MP2 A;  2R6M A;  1RO0 A;  1VQ6 Z;  3CCR Z;  1VQ6 1;  3CCR 1;  3I55 Z;  1TWC I;  3RZO I;  2RT9 A;  3I55 1;  4REZ A;  2WAQ A;  4HGY A;  5A2Q b;  4AYB A;  3PO3 S;  4MD9 A;  3VMI A;  3CCU Z;  3CCU 1;  2E9H A;  4IUM A;  2QRD B;  4E2W A;  3S17 I;  2BU3 A;  2JA5 I;  2UZJ A;  3CC7 Z;  4PT5 A;  2NVT I;  3CC7 1;  1VQL Z;  4DGL A;  4XZX A;  1K73 1;  1WW9 A;  1VQL 1;  4RVD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...