3IFUA

The crystal structure of porcine reproductive and respiratory syndrome virus (prrsv) leader protease nsp1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
175
structure length
175
Chain Sequence
b'DRCTCTPNARVFVAEGQVYCTRCLSARSLLPLNLQVPELGVLGLFYRPEEPLRWTLPRAFPTVECSPAGACWLSAIFPIARMTSGNLNFQQRMVRVAAEIYRAGQLTPTVLKTLQVYERGCRWYPIVGPVPGVGVYANSLHVSDKPFPGATHVLTNLPLPQRPKPEDFCPFECAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-structural protein
publication title Crystal structure of porcine reproductive and respiratory syndrome virus leader protease Nsp1alpha
pubmed doi rcsb
source organism Porcine reproductive and respiratory syndrome virus
molecule tags Transcription
total genus 37
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2009-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05410 Peptidase_C31 Porcine arterivirus-type cysteine proteinase alpha
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.250 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ifuA01
3.90.70.60 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3ifuA02
3IFUA
chains in the Genus database with same CATH superfamily
1CB5A 4D8BA 3VMGA 2PM9A 1AA6A 1PPNA 2RHBA 2YJBA 2HF1A 3G6E1 3S3RA 2RPRA 1UKFA 4A3DI 1TL9A 4N4ZA 1PPPA 3S14I 3S1RI 3G4S1 1AU2A 3F3PC 3CCVZ 1VQM1 2R92I 1AU0A 2FUDA 2K3RA 4NBHA 4CDFB 3JAMb 1VQ7Z 4Y52I 2F1GA 2NVQI 3MJ5A 3CXCZ 3CCUZ 2R9MA 2IPPB 4P16A 4BOPA 2M48A 1TWGI 2P86A 1TU6A 4MD7A 1IWDA 4G54A 4QBBA 3K7AI 3M4OI 5JZEA 1VQ6Z 2JIOA 4RKXA 3QT4A 4BY1I 4A93I 5C4JI 3OVZA 4IUMA 1FDOA 4BOQA 3NDIA 2R9OA 1U9WA 2OOYB 4Q8HA 2KI7B 1YVBA 2LIYA 2DZZA 2E2HI 2HWKA 1Z02A 1I3QI 3S1MI 1MS6A 1VQK1 1K3BB 1QVFZ 2V8JA 1PE6A 4YYUA 3I06A 2YU9I 3CME1 3J80f 3V6EA 1QF8A 4BQVA 2AGAA 5D1OA 1QVGZ 2IZ3A 2P28A 3OW2Z 3P5XA 3BG1B 1QYPA 1PFTA 1K731 2QRCB 3CXCY 4YYQA 3GTMS 3BC3A 1NJI1 3MORA 1TWFI 2E7ZA 3K8UA 1VJVA 2VHSA 1ATKA 3E9SA 1EWLA 4BPVA 4A3LI 2JQFR 3TRKA 4RVGA 1YZBA 3TNXA 4DMYA 3CCSZ 3VMHA 3CCE1 2DC9A 2IZ4A 5EZSA 4A3II 4AYBA 2F4MA 3FQQA 4NBDA 3PNRA 5LL6f 3LFYA 4CDDB 1Q861 1KD12 4A3JI 2RIQA 1TFIA 3USVA 2K5RA 4R3DA 2JA7I 4HGZA 1FH0A 5FLXf 1NB3A 2WB1A 3W31A 2JMOA 3B21A 4MD9A 1JJ2Z 4BOSA 1RO2A 5IP9I 1R9TI 1QVFY 5A24A 3S15I 3AI8A 3KWZA 1EWMA 3I561 3GTLI 1BGOA 1KFUL 4X6IA 2I3CA 3CC7Z 4FJCA 3MHSA 3OVXA 4BBSI 1QVGY 4NB9A 3N4CA 1AYWA 3E1ZB 3OW2Y 1DF0A 4NBBA 5EGWA 3CC41 1YHQZ 4NBEA 3GTGI 2FE8A 4NBCA 3CCJZ 1AYUA 1PPOA 2CB5A 3N3GA 1VQPZ 2DE5A 1KRLA 4MSXA 1DEUA 1AYVA 1YI2Z 1KHPA 2J7QA 4W5CA 3OF8A 2HHNA 3GCBA 3PHUA 2NQGA 5T64A 1S7MA 3ZUAA 4BOUA 1PADA 2VPZA 1PCIA 2XU5A 4REZA 5T67A 1CPJA 1YUKA 3IX0A 1NL6A 2ARYA 3CQZI 1JJ2Y 1RO0A 9PAPA 1BY8A 5J94A 1ME4A 4TNUA 2FO5A 1X3WA 2Y0SA 2NVYI 3O65A 4BS5A 2Q51A 4BXXI 1LQLA 4GUAA 2VF1A 3CBJA 4NB8A 2C0YA 2J7QC 2ATOA 3I551 3GTOI 1Q6KA 1MDWA 3B79A 3KSEA 1JWHC 2JRIA 1SP4B 4YV8A 1M1K2 4QRXA 4N8WA 3CBKA 4D8IA 2V3VA 4RY2A 1S721 2DZYA 2YADA 2GFOA 3M99A 4I07A 3CCM1 4W4UA 4HH4A 4EWCA 2JQGR 1NPZA 1GLOA 3I3TA 4PADA 4DK1A 3CC21 2E2II 3QSDA 1YIJZ 2VUGA 2AU1A 2HXZA 4DQYB 1EWOA 1VQ81 2JIMA 3M3YI 1JQPA 2J6AA 3NHEA 4MZOA 1U9QX 3CD61 3S2HI 5EF4A 6PADA 1YALA 3H8BA 2FYEA 1ML8A 1YJ9Z 4BS6A 1NUIA 2G6DA 2YJ8A 3N3KA 5CHVA 1VQ9Z 5IT9b 1I50I 2DE7A 3D2LA 4NFRA 2W04A 2JA8I 1K8A2 2E01A 1VQP1 4E2YA 2FRQA 3H8CA 4A3KI 1PPDA 3W30A 4WA6A 3G71Z 1THEA 1KD11 3NH4A 3BB7A 4XR7A 3TE5B 2AIMA 2PADA 5PADA 3ESWA 3V6CA 2HU9A 1Y4HA 1PXVA 2E2JI 2OZKA 5A2Qf 4A3EI 1MEMA 3VB9A 3I4MI 4PP2E 2F4OA 3GCFA 3I4NI 3BCNA 1VQLZ 4FK5A 3LUSA 2O4HA 5KO3A 2FT2A 4A3MI 1TWCI 2JA6I 3OQCA 2RT9A 1YJNZ 1VQN1 4XZXA 1ZB8A 3I07A 2LEXA 3BPFA 4P6GA 4A5UA 3PT2A 3C0RA 1U5IA 1TWAI 2OTJZ 3CCL1 2JNYA 4MH4A 2NQDB 3P5VA 4HXDB 2P3YA 4CDCB 4D8EA 2JIRA 3KKUA 2QA41 2QRDB 3RZDI 2ZAEB 3HOZI 4OEMA 3J81b 2JIQA 2DC8A 2NQAA 2B1NA 1AECA 2OZ2A 1NB5A 1QDQA 3HOUI 5C4XI 2QEXZ 4PI3A 5JA7A 1KXRA 4A3FI 3BPMA 3IUTA 4OELA 3D9XA 4MD8A 1F2BA 3IFUA 1Q812 1Q7Y2 3D6WA 3KX1A 1YITZ 1CV8A 2DC7A 1EWPA 4OW0A 4NBAA 3H7DA 3D6SA 1POPA 2LFUA 1QXFA 4FIPA 2QREB 2B1MA 4MI7A 4RF0A 5CVNB 1Q16A 3CCV1 2GTHA 3IF8A 1O0EA 4YYWA 3KIHA 1Y1VI 1VQ4Z 3F5VA 3IMAA 5C3EI 3PW3A 2BTWA 2O53A 1VQ71 3FKII 2E03A 4QRVA 1GECE 3CCU1 3CCRZ 4E30A 1KQSY 3K9MA 4HGYA 2G2KA 1ME3A 4X6JA 1M1K1 4CZWA 1VQ61 3MZLB 3CMAZ 3PSEA 3WXEA 2PNSA 2RBLA 4XX2A 2VPXA 3HHAA 1Q822 2ACTA 3TDHB 1I6HI 1GMYA 3GKQA 2CIOA 1NP6A 1Y08A 1KFXL 1M902 1WZNA 1F2CA 3Q87A 4XUIA 2YJ9A 4BSQA 1W2BZ 1KHQA 2R6NA 4QRGA 4X6HA 3S16I 5A2Qb 3HOXI 4PT5A 4BOZA 2JA5I 3BWKA 3NH8A 1X9YA 2WBFX 5E6JA 3RVVA 3HKZA 4QTTA 1WCMI 4A3GI 3G6EZ 1K8A1 5AN9F 3MZKB 3VTNA 3MTNA 1QMYA 1YJWZ 5K16A 2Y5BA 2W03A 2V8KA 2PBHA 3NFZA 2BTWB 2O6XA 4QTUA 1TLOA 3IOQA 3G4SZ 3OF9A 3J80b 1VQMZ 3BG0B 3PO3I 2BDZA 2HD5A 2YJ2A 4OVZA 1YIT1 1YK8A 3F75A 2Y6EA 3CCS1 3EERA 4E33A 3BBAA 2R6MA 2FQ9A 4WURA 3WXFA 2AUXA 3GTPI 1CJLA 2FTDA 7PCKA 1WW9A 4RVDA 3PRMA 2AKLA 3FQMA 2DCCA 2PMZA 1W2BY 1YUAA 4MRIA 1RNIA 1MEGA 1FDIA 2XU1A 4RVHA 3CMA1 4E32A 3GTKI 4A3CI 2AYDA 3P5WA 3CC71 1L1OC 2V45A 1CVZA 1VQKZ 4P6EA 2NAPA 2IV2X 3WXGA 3H6SA 2Z84A 1SNKA 2YJCA 5FLXb 2DE6A 3S1NI 2G8JA 1Q811 1YHQ1 3BOWA 1BP4A 1Q7Y1 3RVWA 1AIMA 1HUCB 1RQFA 3CCJ1 3DF0A 3MHHA 3NH5A 1WIIA 5CVOB 5IP7I 2DJGB 2Q4ZA 1X0TA 3NDJA 1YI21 1WJ2A 2JS4A 4OVZB 3HOYI 2OOXB 1TWHI 1USPA 1VQ5Z 2PREA 2R7ZI 2AUZA 5FPWA 3H0GI 1ICFA 3HWNA 4DGLA 3P5JB 4E2ZA 2KPIA 1SIWA 4DMXA 1AU3A 1CS8A 3O1GA 1YJW1 2VUMI 2FRAA 4N79A 2OP3A 4I04A 3PDFA 2G7YA 3S2DI 3CCEZ 3RNVA 1ZCMA 5C44I 2XU4A 1KC82 4NH1C 1Y1VS 1N8R2 2H85A 1K9M2 2H7JA 1U9XA 3HHIA 1KQSZ 1F29A 2GHUA 3U8EA 1MIRA 3ZNHA 3MTVA 1VLAA 1Q821 3TMPA 1DKIA 4A3BI 3BY4A 1M901 4YYSA 3RZOI 4CDEB 2AYOA 2F7DA 2E9HA 3PO2I 4IP3A 4NBGA 3I56Z 4BBRI 3IHPA 3KW9A 4NOZA 1Y1WI 3GTQI 1STFE 4Y7NI 2VPWA 1GCBA 1YT7A 1MHWA 3IEJA 1VQOZ 1YIJ1 5EZQA 4S1TA 3CC4Z 3EEDA 2IBIA 2JTCA 4QH6A 1USPB 2UZJA 2XU3A 1PVJA 3QWUA 3OISA 2JR6A 1ZH1A 3LXSA 3CCQZ 1YJ91 3ERVA 2OTLZ 4K7CA 1VQ91 3PHWA 1EF7A 3HOWI 1QOLA 2QLVB 1A6RA 4E31A 3H89A 2DCBA 2WAQA 1SFOI 1ZB9A 1VSNA 3HOVI 2B63I 4BY7I 3G711 1VQ51 1RLYA 2DOSA 8PCHA 2G8EA 3GTJI 2JUBA 4MM3B 3QJ3A 3PO3S 2NVXI 2PK7A 1VQL1 4I05A 4KLBA 3J7A4 2BDLA 2DJFB 4YYRA 1YJN1 4RV9A 3I55Z 3PBHA 1ITOA 1CSBB 2DCAA 1K83I 1BQIA 2P0RA 5F02A 1M6DA 3S1QI 2OTJ1 1CQDA 2AYNA 1P9NA 3CPWZ 1S72Z 2GTIA 4PP1A 3CH3X 1N2FA 1RO4A 3CCMZ 1XKGA 3IV2A 4RF1A 1Z03A 3JAMf 5IT9f 1Y8CA 3CC2Z 5CHTA 5D1PA 2DCDA 2QEX1 1VQ8Z 3K24A 3MP2A 3HD3A 3CD6Z 3GTMI 2BU3A 5CVMA 5D1OB 3PRPA 2GU2A 1VQO1 3S3QA 5JH3A 3CH2X 2HH5A 4W5BA 2R93I 2VHFA 1F2AA 1NQCA 1ZIVA 4YVAA 3VMIA 1Z01A 3KFQA 2JIPA 2V8IA 4M0WA 4MZSA 3T4NB 4YYVA 3KWBX 4NBFA 3CCQ1 2R9FA 1CTEA 1K732 1KC81 2OTL1 1QXPA 1N8R1 1K9M1 1VQ41 2E02A 1DL6A 1NJI2 3PHXA 5FLMI 3C9EA 2BJOA 2NQIA 4ZUXU 1S4VA 3CCR1 2E00A 1AU4A 4MXUA 3F3FC 5T6BA 1PIPA 2DC6A 3MONA 2OULA 4ZTBA 3J81f 3KIFA 2EGTA 4RS4A 2AVWA 4RNAA 3CPWY 2QKDA 4MONA 4E2XA 3U50C 3H3VJ 1VQNZ 3IR7A 1Q862 1PBHA 4AXLA 2AS8A 3S17I 2M6NA 2R9NA 4AXMA 3CCLZ 2R9CA 2NVTI 3P5UA 3RVXA 4RVFA 2P7UA 3O0UA 2QA4Z 4HWYA 3CMEZ 1U9VA 2QR1B 5CM2M 1X3ZA 4X6AI 4CL1A 4Q8GA 1NLJA 4E2WA 1YK7A 2VPYA
chains in the Genus database with same CATH topology
4D8BA 3VMGA 2PM9A 2RHBA 2HF1A 3G6E1 2RPRA 1UKFA 4A3DI 3S14I 3S1RI 3G4S1 3F3PC 3CCVZ 1VQM1 2R92I 2K3RA 4NBHA 3JAMb 1VQ7Z 4Y52I 2NVQI 3MJ5A 3CXCZ 3CCUZ 4P16A 4BOPA 2M48A 1TWGI 4MD7A 3K7AI 3M4OI 5JZEA 1VQ6Z 4RKXA 4BY1I 4A93I 5C4JI 4IUMA 4BOQA 3NDIA 2OOYB 2KI7B 2LIYA 2E2HI 2HWKA 1Z02A 1I3QI 3S1MI 1VQK1 1QVFZ 2V8JA 2YU9I 3CME1 3J80f 1QF8A 2AGAA 5D1OA 1QVGZ 2IZ3A 2P28A 3OW2Z 3BG1B 1QYPA 1PFTA 1K731 2QRCB 3CXCY 3GTMS 1NJI1 1TWFI 3E9SA 4A3LI 3TRKA 4RVGA 1YZBA 3CCSZ 3VMHA 3CCE1 2IZ4A 5EZSA 4A3II 4AYBA 2F4MA 3FQQA 4NBDA 5LL6f 1Q861 1KD12 4A3JI 2RIQA 1TFIA 2K5RA 4R3DA 2JA7I 4HGZA 5FLXf 2WB1A 3W31A 2JMOA 3B21A 4MD9A 1JJ2Z 4BOSA 1RO2A 5IP9I 1R9TI 1QVFY 3S15I 3I561 3GTLI 2I3CA 3CC7Z 4BBSI 1QVGY 4NB9A 3OW2Y 4NBBA 3CC41 1YHQZ 4NBEA 3GTGI 2FE8A 4NBCA 3CCJZ 1VQPZ 2DE5A 1KRLA 1YI2Z 2J7QA 3PHUA 5T64A 1S7MA 4BOUA 4REZA 5T67A 1YUKA 3IX0A 3CQZI 1JJ2Y 1RO0A 4TNUA 1X3WA 2Y0SA 2NVYI 3O65A 2Q51A 4BXXI 1LQLA 4GUAA 2VF1A 4NB8A 2J7QC 3I551 3GTOI 1JWHC 2JRIA 1M1K2 4D8IA 1S721 2YADA 3CCM1 4HH4A 4EWCA 4DK1A 3CC21 2E2II 1YIJZ 2VUGA 4DQYB 1VQ81 3M3YI 2J6AA 3CD61 3S2HI 1ML8A 1YJ9Z 1NUIA 1VQ9Z 5IT9b 1I50I 2DE7A 2JA8I 4NFRA 2W04A 1K8A2 1VQP1 4E2YA 4A3KI 3W30A 3G71Z 1KD11 3NH4A 3BB7A 3TE5B 3ESWA 2HU9A 2E2JI 2OZKA 5A2Qf 4A3EI 3VB9A 3I4MI 2F4OA 3GCFA 3I4NI 1VQLZ 3LUSA 2O4HA 5KO3A 4A3MI 1TWCI 2JA6I 3OQCA 2RT9A 1YJNZ 1VQN1 4XZXA 1ZB8A 3I07A 4A5UA 3PT2A 3C0RA 1TWAI 2OTJZ 3CCL1 2JNYA 4MH4A 4HXDB 4D8EA 2P3YA 2QA41 2QRDB 3RZDI 2ZAEB 3HOZI 3J81b 3HOUI 5C4XI 2QEXZ 4A3FI 3D9XA 4MD8A 3IFUA 1Q812 1Q7Y2 3D6WA 1YITZ 4OW0A 4NBAA 2LFUA 2QREB 4MI7A 4RF0A 3CCV1 2GTHA 3IF8A 3KIHA 1Y1VI 1VQ4Z 5C3EI 2BTWA 2O53A 1VQ71 3FKII 3CCU1 3CCRZ 4E30A 1KQSY 4HGYA 2G2KA 1M1K1 1VQ61 3MZLB 3CMAZ 3PSEA 2RBLA 4XX2A 1Q822 3TDHB 1I6HI 3GKQA 1NP6A 1M902 3Q87A 1W2BZ 3S16I 5A2Qb 3HOXI 4PT5A 4BOZA 2JA5I 3NH8A 5E6JA 3HKZA 4QTTA 1WCMI 4A3GI 3G6EZ 1K8A1 5AN9F 3MZKB 3VTNA 1YJWZ 2W03A 2V8KA 3NFZA 2BTWB 4QTUA 3G4SZ 3J80b 1VQMZ 3BG0B 3PO3I 4OVZA 1YIT1 3CCS1 3EERA 4E33A 3BBAA 2R6MA 4WURA 3GTPI 1WW9A 4RVDA 3PRMA 2AKLA 3FQMA 2PMZA 1W2BY 1YUAA 4MRIA 1RNIA 4RVHA 3CMA1 4E32A 3GTKI 4A3CI 3CC71 1L1OC 1VQKZ 2Z84A 5FLXb 2DE6A 3S1NI 1Q811 1YHQ1 1Q7Y1 1RQFA 3CCJ1 3NH5A 1WIIA 5IP7I 2Q4ZA 1X0TA 3NDJA 1YI21 2JS4A 4OVZB 3HOYI 2OOXB 1TWHI 1USPA 1VQ5Z 2R7ZI 3H0GI 4DGLA 3P5JB 4E2ZA 2KPIA 1YJW1 2VUMI 3S2DI 3CCEZ 3RNVA 5C44I 1KC82 4NH1C 1Y1VS 1N8R2 2H85A 1K9M2 3ZNHA 1KQSZ 3MTVA 1VLAA 1Q821 3TMPA 1DKIA 4A3BI 3BY4A 1M901 3RZOI 2E9HA 3PO2I 4IP3A 4NBGA 3I56Z 4BBRI 4NOZA 1Y1WI 3GTQI 4Y7NI 5EZQA 1VQOZ 1YIJ1 4S1TA 3CC4Z 3EEDA 2JTCA 1USPB 2UZJA 1PVJA 3QWUA 2JR6A 1ZH1A 3CCQZ 1YJ91 2OTLZ 1VQ91 3PHWA 3HOWI 2QLVB 4E31A 2WAQA 1SFOI 1ZB9A 3HOVI 2B63I 4BY7I 3G711 1VQ51 1RLYA 2DOSA 3GTJI 2JUBA 4MM3B 3PO3S 2NVXI 2PK7A 1VQL1 3J7A4 1YJN1 4RV9A 3I55Z 1K83I 3S1QI 2OTJ1 1P9NA 3CPWZ 1S72Z 2GTIA 1N2FA 1RO4A 3CCMZ 4RF1A 1Z03A 3JAMf 5IT9f 3CC2Z 5D1PA 2QEX1 1VQ8Z 3MP2A 3CD6Z 3GTMI 2BU3A 5D1OB 3PRPA 2GU2A 1VQO1 2R93I 3VMIA 1Z01A 2V8IA 4M0WA 3T4NB 4NBFA 3CCQ1 1K732 1KC81 2OTL1 1N8R1 1K9M1 1VQ41 1DL6A 1NJI2 3PHXA 5FLMI 2BJOA 3CCR1 4MXUA 3F3FC 5T6BA 3MONA 4ZTBA 3J81f 3KIFA 2EGTA 4RS4A 4RNAA 3CPWY 2QKDA 4MONA 4E2XA 3U50C 3H3VJ 1VQNZ 1Q862 3S17I 2M6NA 3CCLZ 2NVTI 4RVFA 2QA4Z 3CMEZ 2QR1B 5CM2M 1X3ZA 4X6AI 4CL1A 4E2WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IFU A; 
#chains in the Genus database with same CATH topology
 1CB5 A;  4D8B A;  3VMG A;  2PM9 A;  1AA6 A;  1PPN A;  2RHB A;  2YJB A;  2HF1 A;  3G6E 1;  3S3R A;  2RPR A;  1UKF A;  4A3D I;  1TL9 A;  4N4Z A;  1PPP A;  3S14 I;  3S1R I;  3G4S 1;  1AU2 A;  3F3P C;  3CCV Z;  1VQM 1;  2R92 I;  1AU0 A;  2FUD A;  2K3R A;  4NBH A;  4CDF B;  3JAM b;  1VQ7 Z;  4Y52 I;  2F1G A;  2NVQ I;  3MJ5 A;  3CXC Z;  3CCU Z;  2R9M A;  2IPP B;  4P16 A;  4BOP A;  2M48 A;  1TWG I;  2P86 A;  1TU6 A;  4MD7 A;  1IWD A;  4G54 A;  4QBB A;  3K7A I;  3M4O I;  5JZE A;  1VQ6 Z;  2JIO A;  4RKX A;  3QT4 A;  4BY1 I;  4A93 I;  5C4J I;  3OVZ A;  4IUM A;  1FDO A;  4BOQ A;  3NDI A;  2R9O A;  1U9W A;  2OOY B;  4Q8H A;  2KI7 B;  1YVB A;  2LIY A;  2DZZ A;  2E2H I;  2HWK A;  1Z02 A;  1I3Q I;  3S1M I;  1MS6 A;  1VQK 1;  1K3B B;  1QVF Z;  2V8J A;  1PE6 A;  4YYU A;  3I06 A;  2YU9 I;  3CME 1;  3J80 f;  3V6E A;  1QF8 A;  4BQV A;  2AGA A;  5D1O A;  1QVG Z;  2IZ3 A;  2P28 A;  3OW2 Z;  3P5X A;  3BG1 B;  1QYP A;  1PFT A;  1K73 1;  2QRC B;  3CXC Y;  4YYQ A;  3GTM S;  3BC3 A;  1NJI 1;  3MOR A;  1TWF I;  2E7Z A;  3K8U A;  1VJV A;  2VHS A;  1ATK A;  3E9S A;  1EWL A;  4BPV A;  4A3L I;  2JQF R;  3TRK A;  4RVG A;  1YZB A;  3TNX A;  4DMY A;  3CCS Z;  3VMH A;  3CCE 1;  2DC9 A;  2IZ4 A;  5EZS A;  4A3I I;  4AYB A;  2F4M A;  3FQQ A;  4NBD A;  3PNR A;  5LL6 f;  3LFY A;  4CDD B;  1Q86 1;  1KD1 2;  4A3J I;  2RIQ A;  1TFI A;  3USV A;  2K5R A;  4R3D A;  2JA7 I;  4HGZ A;  1FH0 A;  5FLX f;  1NB3 A;  2WB1 A;  3W31 A;  2JMO A;  3B21 A;  4MD9 A;  1JJ2 Z;  4BOS A;  1RO2 A;  5IP9 I;  1R9T I;  1QVF Y;  5A24 A;  3S15 I;  3AI8 A;  3KWZ A;  1EWM A;  3I56 1;  3GTL I;  1BGO A;  1KFU L;  4X6I A;  2I3C A;  3CC7 Z;  4FJC A;  3MHS A;  3OVX A;  4BBS I;  1QVG Y;  4NB9 A;  3N4C A;  1AYW A;  3E1Z B;  3OW2 Y;  1DF0 A;  4NBB A;  5EGW A;  3CC4 1;  1YHQ Z;  4NBE A;  3GTG I;  2FE8 A;  4NBC A;  3CCJ Z;  1AYU A;  1PPO A;  2CB5 A;  3N3G A;  1VQP Z;  2DE5 A;  1KRL A;  4MSX A;  1DEU A;  1AYV A;  1YI2 Z;  1KHP A;  2J7Q A;  4W5C A;  3OF8 A;  2HHN A;  3GCB A;  3PHU A;  2NQG A;  5T64 A;  1S7M A;  3ZUA A;  4BOU A;  1PAD A;  2VPZ A;  1PCI A;  2XU5 A;  4REZ A;  5T67 A;  1CPJ A;  1YUK A;  3IX0 A;  1NL6 A;  2ARY A;  3CQZ I;  1JJ2 Y;  1RO0 A;  9PAP A;  1BY8 A;  5J94 A;  1ME4 A;  4TNU A;  2FO5 A;  1X3W A;  2Y0S A;  2NVY I;  3O65 A;  4BS5 A;  2Q51 A;  4BXX I;  1LQL A;  4GUA A;  2VF1 A;  3CBJ A;  4NB8 A;  2C0Y A;  2J7Q C;  2ATO A;  3I55 1;  3GTO I;  1Q6K A;  1MDW A;  3B79 A;  3KSE A;  1JWH C;  2JRI A;  1SP4 B;  4YV8 A;  1M1K 2;  4QRX A;  4N8W A;  3CBK A;  4D8I A;  2V3V A;  4RY2 A;  1S72 1;  2DZY A;  2YAD A;  2GFO A;  3M99 A;  4I07 A;  3CCM 1;  4W4U A;  4HH4 A;  4EWC A;  2JQG R;  1NPZ A;  1GLO A;  3I3T A;  4PAD A;  4DK1 A;  3CC2 1;  2E2I I;  3QSD A;  1YIJ Z;  2VUG A;  2AU1 A;  2HXZ A;  4DQY B;  1EWO A;  1VQ8 1;  2JIM A;  3M3Y I;  1JQP A;  2J6A A;  3NHE A;  4MZO A;  1U9Q X;  3CD6 1;  3S2H I;  5EF4 A;  6PAD A;  1YAL A;  3H8B A;  2FYE A;  1ML8 A;  1YJ9 Z;  4BS6 A;  1NUI A;  2G6D A;  2YJ8 A;  3N3K A;  5CHV A;  1VQ9 Z;  5IT9 b;  1I50 I;  2DE7 A;  3D2L A;  4NFR A;  2W04 A;  2JA8 I;  1K8A 2;  2E01 A;  1VQP 1;  4E2Y A;  2FRQ A;  3H8C A;  4A3K I;  1PPD A;  3W30 A;  4WA6 A;  3G71 Z;  1THE A;  1KD1 1;  3NH4 A;  3BB7 A;  4XR7 A;  3TE5 B;  2AIM A;  2PAD A;  5PAD A;  3ESW A;  3V6C A;  2HU9 A;  1Y4H A;  1PXV A;  2E2J I;  2OZK A;  5A2Q f;  4A3E I;  1MEM A;  3VB9 A;  3I4M I;  4PP2 E;  2F4O A;  3GCF A;  3I4N I;  3BCN A;  1VQL Z;  4FK5 A;  3LUS A;  2O4H A;  5KO3 A;  2FT2 A;  4A3M I;  1TWC I;  2JA6 I;  3OQC A;  2RT9 A;  1YJN Z;  1VQN 1;  4XZX A;  1ZB8 A;  3I07 A;  2LEX A;  3BPF A;  4P6G A;  4A5U A;  3PT2 A;  3C0R A;  1U5I A;  1TWA I;  2OTJ Z;  3CCL 1;  2JNY A;  4MH4 A;  2NQD B;  3P5V A;  4HXD B;  2P3Y A;  4CDC B;  4D8E A;  2JIR A;  3KKU A;  2QA4 1;  2QRD B;  3RZD I;  2ZAE B;  3HOZ I;  4OEM A;  3J81 b;  2JIQ A;  2DC8 A;  2NQA A;  2B1N A;  1AEC A;  2OZ2 A;  1NB5 A;  1QDQ A;  3HOU I;  5C4X I;  2QEX Z;  4PI3 A;  5JA7 A;  1KXR A;  4A3F I;  3BPM A;  3IUT A;  4OEL A;  3D9X A;  4MD8 A;  1F2B A;  3IFU A;  1Q81 2;  1Q7Y 2;  3D6W A;  3KX1 A;  1YIT Z;  1CV8 A;  2DC7 A;  1EWP A;  4OW0 A;  4NBA A;  3H7D A;  3D6S A;  1POP A;  2LFU A;  1QXF A;  4FIP A;  2QRE B;  2B1M A;  4MI7 A;  4RF0 A;  5CVN B;  1Q16 A;  3CCV 1;  2GTH A;  3IF8 A;  1O0E A;  4YYW A;  3KIH A;  1Y1V I;  1VQ4 Z;  3F5V A;  3IMA A;  5C3E I;  3PW3 A;  2BTW A;  2O53 A;  1VQ7 1;  3FKI I;  2E03 A;  4QRV A;  1GEC E;  3CCU 1;  3CCR Z;  4E30 A;  1KQS Y;  3K9M A;  4HGY A;  2G2K A;  1ME3 A;  4X6J A;  1M1K 1;  4CZW A;  1VQ6 1;  3MZL B;  3CMA Z;  3PSE A;  3WXE A;  2PNS A;  2RBL A;  4XX2 A;  2VPX A;  3HHA A;  1Q82 2;  2ACT A;  3TDH B;  1I6H I;  1GMY A;  3GKQ A;  2CIO A;  1NP6 A;  1Y08 A;  1KFX L;  1M90 2;  1WZN A;  1F2C A;  3Q87 A;  4XUI A;  2YJ9 A;  4BSQ A;  1W2B Z;  1KHQ A;  2R6N A;  4QRG A;  4X6H A;  3S16 I;  5A2Q b;  3HOX I;  4PT5 A;  4BOZ A;  2JA5 I;  3BWK A;  3NH8 A;  1X9Y A;  2WBF X;  5E6J A;  3RVV A;  3HKZ A;  4QTT A;  1WCM I;  4A3G I;  3G6E Z;  1K8A 1;  5AN9 F;  3MZK B;  3VTN A;  3MTN A;  1QMY A;  1YJW Z;  5K16 A;  2Y5B A;  2W03 A;  2V8K A;  2PBH A;  3NFZ A;  2BTW B;  2O6X A;  4QTU A;  1TLO A;  3IOQ A;  3G4S Z;  3OF9 A;  3J80 b;  1VQM Z;  3BG0 B;  3PO3 I;  2BDZ A;  2HD5 A;  2YJ2 A;  4OVZ A;  1YIT 1;  1YK8 A;  3F75 A;  2Y6E A;  3CCS 1;  3EER A;  4E33 A;  3BBA A;  2R6M A;  2FQ9 A;  4WUR A;  3WXF A;  2AUX A;  3GTP I;  1CJL A;  2FTD A;  7PCK A;  1WW9 A;  4RVD A;  3PRM A;  2AKL A;  3FQM A;  2DCC A;  2PMZ A;  1W2B Y;  1YUA A;  4MRI A;  1RNI A;  1MEG A;  1FDI A;  2XU1 A;  4RVH A;  3CMA 1;  4E32 A;  3GTK I;  4A3C I;  2AYD A;  3P5W A;  3CC7 1;  1L1O C;  2V45 A;  1CVZ A;  1VQK Z;  4P6E A;  2NAP A;  2IV2 X;  3WXG A;  3H6S A;  2Z84 A;  1SNK A;  2YJC A;  5FLX b;  2DE6 A;  3S1N I;  2G8J A;  1Q81 1;  1YHQ 1;  3BOW A;  1BP4 A;  1Q7Y 1;  3RVW A;  1AIM A;  1HUC B;  1RQF A;  3CCJ 1;  3DF0 A;  3MHH A;  3NH5 A;  1WII A;  5CVO B;  5IP7 I;  2DJG B;  2Q4Z A;  1X0T A;  3NDJ A;  1YI2 1;  1WJ2 A;  2JS4 A;  4OVZ B;  3HOY I;  2OOX B;  1TWH I;  1USP A;  1VQ5 Z;  2PRE A;  2R7Z I;  2AUZ A;  5FPW A;  3H0G I;  1ICF A;  3HWN A;  4DGL A;  3P5J B;  4E2Z A;  2KPI A;  1SIW A;  4DMX A;  1AU3 A;  1CS8 A;  3O1G A;  1YJW 1;  2VUM I;  2FRA A;  4N79 A;  2OP3 A;  4I04 A;  3PDF A;  2G7Y A;  3S2D I;  3CCE Z;  3RNV A;  1ZCM A;  5C44 I;  2XU4 A;  1KC8 2;  4NH1 C;  1Y1V S;  1N8R 2;  2H85 A;  1K9M 2;  2H7J A;  1U9X A;  3HHI A;  1KQS Z;  1F29 A;  2GHU A;  3U8E A;  1MIR A;  3ZNH A;  3MTV A;  1VLA A;  1Q82 1;  3TMP A;  1DKI A;  4A3B I;  3BY4 A;  1M90 1;  4YYS A;  3RZO I;  4CDE B;  2AYO A;  2F7D A;  2E9H A;  3PO2 I;  4IP3 A;  4NBG A;  3I56 Z;  4BBR I;  3IHP A;  3KW9 A;  4NOZ A;  1Y1W I;  3GTQ I;  1STF E;  4Y7N I;  2VPW A;  1GCB A;  1YT7 A;  1MHW A;  3IEJ A;  1VQO Z;  1YIJ 1;  5EZQ A;  4S1T A;  3CC4 Z;  3EED A;  2IBI A;  2JTC A;  4QH6 A;  1USP B;  2UZJ A;  2XU3 A;  1PVJ A;  3QWU A;  3OIS A;  2JR6 A;  1ZH1 A;  3LXS A;  3CCQ Z;  1YJ9 1;  3ERV A;  2OTL Z;  4K7C A;  1VQ9 1;  3PHW A;  1EF7 A;  3HOW I;  1QOL A;  2QLV B;  1A6R A;  4E31 A;  3H89 A;  2DCB A;  2WAQ A;  1SFO I;  1ZB9 A;  1VSN A;  3HOV I;  2B63 I;  4BY7 I;  3G71 1;  1VQ5 1;  1RLY A;  2DOS A;  8PCH A;  2G8E A;  3GTJ I;  2JUB A;  4MM3 B;  3QJ3 A;  3PO3 S;  2NVX I;  2PK7 A;  1VQL 1;  4I05 A;  4KLB A;  3J7A 4;  2BDL A;  2DJF B;  4YYR A;  1YJN 1;  4RV9 A;  3I55 Z;  3PBH A;  1ITO A;  1CSB B;  2DCA A;  1K83 I;  1BQI A;  2P0R A;  5F02 A;  1M6D A;  3S1Q I;  2OTJ 1;  1CQD A;  2AYN A;  1P9N A;  3CPW Z;  1S72 Z;  2GTI A;  4PP1 A;  3CH3 X;  1N2F A;  1RO4 A;  3CCM Z;  1XKG A;  3IV2 A;  4RF1 A;  1Z03 A;  3JAM f;  5IT9 f;  1Y8C A;  3CC2 Z;  5CHT A;  5D1P A;  2DCD A;  2QEX 1;  1VQ8 Z;  3K24 A;  3MP2 A;  3HD3 A;  3CD6 Z;  3GTM I;  2BU3 A;  5CVM A;  5D1O B;  3PRP A;  2GU2 A;  1VQO 1;  3S3Q A;  5JH3 A;  3CH2 X;  2HH5 A;  4W5B A;  2R93 I;  2VHF A;  1F2A A;  1NQC A;  1ZIV A;  4YVA A;  3VMI A;  1Z01 A;  3KFQ A;  2JIP A;  2V8I A;  4M0W A;  4MZS A;  3T4N B;  4YYV A;  3KWB X;  4NBF A;  3CCQ 1;  2R9F A;  1CTE A;  1K73 2;  1KC8 1;  2OTL 1;  1QXP A;  1N8R 1;  1K9M 1;  1VQ4 1;  2E02 A;  1DL6 A;  1NJI 2;  3PHX A;  5FLM I;  3C9E A;  2BJO A;  2NQI A;  4ZUX U;  1S4V A;  3CCR 1;  2E00 A;  1AU4 A;  4MXU A;  3F3F C;  5T6B A;  1PIP A;  2DC6 A;  3MON A;  2OUL A;  4ZTB A;  3J81 f;  3KIF A;  2EGT A;  4RS4 A;  2AVW A;  4RNA A;  3CPW Y;  2QKD A;  4MON A;  4E2X A;  3U50 C;  3H3V J;  1VQN Z;  3IR7 A;  1Q86 2;  1PBH A;  4AXL A;  2AS8 A;  3S17 I;  2M6N A;  2R9N A;  4AXM A;  3CCL Z;  2R9C A;  2NVT I;  3P5U A;  3RVX A;  4RVF A;  2P7U A;  3O0U A;  2QA4 Z;  4HWY A;  3CME Z;  1U9V A;  2QR1 B;  5CM2 M;  1X3Z A;  4X6A I;  4CL1 A;  4Q8G A;  1NLJ A;  4E2W A;  1YK7 A;  2VPY A; 
#chains in the Genus database with same CATH homology
 4D8B A;  3VMG A;  2PM9 A;  2RHB A;  2HF1 A;  3G6E 1;  2RPR A;  1UKF A;  4A3D I;  3S14 I;  3S1R I;  3G4S 1;  3F3P C;  3CCV Z;  1VQM 1;  2R92 I;  2K3R A;  4NBH A;  3JAM b;  1VQ7 Z;  4Y52 I;  2NVQ I;  3MJ5 A;  3CXC Z;  3CCU Z;  4P16 A;  4BOP A;  2M48 A;  1TWG I;  4MD7 A;  3K7A I;  3M4O I;  5JZE A;  1VQ6 Z;  4RKX A;  4BY1 I;  4A93 I;  5C4J I;  4IUM A;  4BOQ A;  3NDI A;  2OOY B;  2KI7 B;  2LIY A;  2E2H I;  2HWK A;  1Z02 A;  1I3Q I;  3S1M I;  1VQK 1;  1QVF Z;  2V8J A;  2YU9 I;  3CME 1;  3J80 f;  1QF8 A;  2AGA A;  5D1O A;  1QVG Z;  2IZ3 A;  2P28 A;  3OW2 Z;  3BG1 B;  1QYP A;  1PFT A;  1K73 1;  2QRC B;  3CXC Y;  3GTM S;  1NJI 1;  1TWF I;  3E9S A;  4A3L I;  3TRK A;  4RVG A;  1YZB A;  3CCS Z;  3VMH A;  3CCE 1;  2IZ4 A;  5EZS A;  4A3I I;  4AYB A;  2F4M A;  3FQQ A;  4NBD A;  5LL6 f;  1Q86 1;  1KD1 2;  4A3J I;  2RIQ A;  1TFI A;  2K5R A;  4R3D A;  2JA7 I;  4HGZ A;  5FLX f;  2WB1 A;  3W31 A;  2JMO A;  3B21 A;  4MD9 A;  1JJ2 Z;  4BOS A;  1RO2 A;  5IP9 I;  1R9T I;  1QVF Y;  3S15 I;  3I56 1;  3GTL I;  2I3C A;  3CC7 Z;  4BBS I;  1QVG Y;  4NB9 A;  3OW2 Y;  4NBB A;  3CC4 1;  1YHQ Z;  4NBE A;  3GTG I;  2FE8 A;  4NBC A;  3CCJ Z;  1VQP Z;  2DE5 A;  1KRL A;  1YI2 Z;  2J7Q A;  3PHU A;  5T64 A;  1S7M A;  4BOU A;  4REZ A;  5T67 A;  1YUK A;  3IX0 A;  3CQZ I;  1JJ2 Y;  1RO0 A;  4TNU A;  1X3W A;  2Y0S A;  2NVY I;  3O65 A;  2Q51 A;  4BXX I;  1LQL A;  4GUA A;  2VF1 A;  4NB8 A;  2J7Q C;  3I55 1;  3GTO I;  1JWH C;  2JRI A;  1M1K 2;  4D8I A;  1S72 1;  2YAD A;  3CCM 1;  4HH4 A;  4EWC A;  4DK1 A;  3CC2 1;  2E2I I;  1YIJ Z;  2VUG A;  4DQY B;  1VQ8 1;  3M3Y I;  2J6A A;  3CD6 1;  3S2H I;  1ML8 A;  1YJ9 Z;  1NUI A;  1VQ9 Z;  5IT9 b;  1I50 I;  2DE7 A;  2JA8 I;  4NFR A;  2W04 A;  1K8A 2;  1VQP 1;  4E2Y A;  4A3K I;  3W30 A;  3G71 Z;  1KD1 1;  3NH4 A;  3BB7 A;  3TE5 B;  3ESW A;  2HU9 A;  2E2J I;  2OZK A;  5A2Q f;  4A3E I;  3VB9 A;  3I4M I;  2F4O A;  3GCF A;  3I4N I;  1VQL Z;  3LUS A;  2O4H A;  5KO3 A;  4A3M I;  1TWC I;  2JA6 I;  3OQC A;  2RT9 A;  1YJN Z;  1VQN 1;  4XZX A;  1ZB8 A;  3I07 A;  4A5U A;  3PT2 A;  3C0R A;  1TWA I;  2OTJ Z;  3CCL 1;  2JNY A;  4MH4 A;  4HXD B;  4D8E A;  2P3Y A;  2QA4 1;  2QRD B;  3RZD I;  2ZAE B;  3HOZ I;  3J81 b;  3HOU I;  5C4X I;  2QEX Z;  4A3F I;  3D9X A;  4MD8 A;  3IFU A;  1Q81 2;  1Q7Y 2;  3D6W A;  1YIT Z;  4OW0 A;  4NBA A;  2LFU A;  2QRE B;  4MI7 A;  4RF0 A;  3CCV 1;  2GTH A;  3IF8 A;  3KIH A;  1Y1V I;  1VQ4 Z;  5C3E I;  2BTW A;  2O53 A;  1VQ7 1;  3FKI I;  3CCU 1;  3CCR Z;  4E30 A;  1KQS Y;  4HGY A;  2G2K A;  1M1K 1;  1VQ6 1;  3MZL B;  3CMA Z;  3PSE A;  2RBL A;  4XX2 A;  1Q82 2;  3TDH B;  1I6H I;  3GKQ A;  1NP6 A;  1M90 2;  3Q87 A;  1W2B Z;  3S16 I;  5A2Q b;  3HOX I;  4PT5 A;  4BOZ A;  2JA5 I;  3NH8 A;  5E6J A;  3HKZ A;  4QTT A;  1WCM I;  4A3G I;  3G6E Z;  1K8A 1;  5AN9 F;  3MZK B;  3VTN A;  1YJW Z;  2W03 A;  2V8K A;  3NFZ A;  2BTW B;  4QTU A;  3G4S Z;  3J80 b;  1VQM Z;  3BG0 B;  3PO3 I;  4OVZ A;  1YIT 1;  3CCS 1;  3EER A;  4E33 A;  3BBA A;  2R6M A;  4WUR A;  3GTP I;  1WW9 A;  4RVD A;  3PRM A;  2AKL A;  3FQM A;  2PMZ A;  1W2B Y;  1YUA A;  4MRI A;  1RNI A;  4RVH A;  3CMA 1;  4E32 A;  3GTK I;  4A3C I;  3CC7 1;  1L1O C;  1VQK Z;  2Z84 A;  5FLX b;  2DE6 A;  3S1N I;  1Q81 1;  1YHQ 1;  1Q7Y 1;  1RQF A;  3CCJ 1;  3NH5 A;  1WII A;  5IP7 I;  2Q4Z A;  1X0T A;  3NDJ A;  1YI2 1;  2JS4 A;  4OVZ B;  3HOY I;  2OOX B;  1TWH I;  1USP A;  1VQ5 Z;  2R7Z I;  3H0G I;  4DGL A;  3P5J B;  4E2Z A;  2KPI A;  1YJW 1;  2VUM I;  3S2D I;  3CCE Z;  3RNV A;  5C44 I;  1KC8 2;  4NH1 C;  1Y1V S;  1N8R 2;  2H85 A;  1K9M 2;  3ZNH A;  1KQS Z;  3MTV A;  1VLA A;  1Q82 1;  3TMP A;  1DKI A;  4A3B I;  3BY4 A;  1M90 1;  3RZO I;  2E9H A;  3PO2 I;  4IP3 A;  4NBG A;  3I56 Z;  4BBR I;  4NOZ A;  1Y1W I;  3GTQ I;  4Y7N I;  5EZQ A;  1VQO Z;  1YIJ 1;  4S1T A;  3CC4 Z;  3EED A;  2JTC A;  1USP B;  2UZJ A;  1PVJ A;  3QWU A;  2JR6 A;  1ZH1 A;  3CCQ Z;  1YJ9 1;  2OTL Z;  1VQ9 1;  3PHW A;  3HOW I;  2QLV B;  4E31 A;  2WAQ A;  1SFO I;  1ZB9 A;  3HOV I;  2B63 I;  4BY7 I;  3G71 1;  1VQ5 1;  1RLY A;  2DOS A;  3GTJ I;  2JUB A;  4MM3 B;  3PO3 S;  2NVX I;  2PK7 A;  1VQL 1;  3J7A 4;  1YJN 1;  4RV9 A;  3I55 Z;  1K83 I;  3S1Q I;  2OTJ 1;  1P9N A;  3CPW Z;  1S72 Z;  2GTI A;  1N2F A;  1RO4 A;  3CCM Z;  4RF1 A;  1Z03 A;  3JAM f;  5IT9 f;  3CC2 Z;  5D1P A;  2QEX 1;  1VQ8 Z;  3MP2 A;  3CD6 Z;  3GTM I;  2BU3 A;  5D1O B;  3PRP A;  2GU2 A;  1VQO 1;  2R93 I;  3VMI A;  1Z01 A;  2V8I A;  4M0W A;  3T4N B;  4NBF A;  3CCQ 1;  1K73 2;  1KC8 1;  2OTL 1;  1N8R 1;  1K9M 1;  1VQ4 1;  1DL6 A;  1NJI 2;  3PHX A;  5FLM I;  2BJO A;  3CCR 1;  4MXU A;  3F3F C;  5T6B A;  3MON A;  4ZTB A;  3J81 f;  3KIF A;  2EGT A;  4RS4 A;  4RNA A;  3CPW Y;  2QKD A;  4MON A;  4E2X A;  3U50 C;  3H3V J;  1VQN Z;  1Q86 2;  3S17 I;  2M6N A;  3CCL Z;  2NVT I;  4RVF A;  2QA4 Z;  3CME Z;  2QR1 B;  5CM2 M;  1X3Z A;  4X6A I;  4CL1 A;  4E2W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...