1AYUA

Crystal structure of cysteine protease human cathepsin k in complex with a covalent symmetric biscarbohydrazide inhibitor
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
215
structure length
215
Chain Sequence
b'APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATHEPSIN K
publication title Design of potent and selective human cathepsin K inhibitors that span the active site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 68
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 1997-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1ayuA00
2YJBA 1FH0A 3MHHA 5CVMA 1CPJA 1O0EA 2CB5A 2B1MA 4YYQA 1NPZA 3KKUA 4AXLA 3N3GA 3KWBX 4AXMA 4PADA 4BSQA 1U5IA 3PNRA 1GECE 3CH3X 1F29A 5A24A 3H89A 3IV2A 1EWMA 4FIPA 2O6XA 4W5CA 3MHSA 1THEA 2E01A 1CS8A 4X6IA 1ZIVA 3O0UA 4CDEB 3BCNA 4YYRA 1ME3A 2AUZA 2XU1A 3HD3A 1AIMA 4PP2E 4ZUXU 4X6JA 1BP4A 1XKGA 2NQAA 3AI8A 4CZWA 3QSDA 5CHTA 3BPMA 1KXRA 2E03A 2Y5BA 1SP4B 4K7CA 1CB5A 4YYSA 3OVXA 2DC6A 4KLBA 2FO5A 2ATOA 3V6CA 5PADA 2F7DA 3N4CA 2GFOA 4X6HA 1AU3A 2R9OA 1STFE 2NQIA 3RVWA 4WA6A 1U9VA 3C9EA 1HUCB 3U8EA 4OEMA 2DC9A 2FQ9A 1GCBA 2GHUA 3CH2X 2JQFR 2JQGR 3QT4A 1QOLA 2FRQA 1DF0A 2AU1A 3GCBA 4DMYA 1YVBA 3ZUAA 4YYVA 3QJ3A 2HXZA 2OULA 4I04A 3OISA 1CSBB 1AYVA 1M6DA 3H6SA 2CIOA 3WXEA 1CTEA 1KHPA 1K3BB 4N8WA 2PREA 2XU4A 1AYUA 3K9MA 2R6NA 3CBJA 4YYUA 2DCAA 1X9YA 1EF7A 1JQPA 4YV8A 1KFUL 3M99A 2FT2A 1BY8A 4Q8HA 3P5UA 2OP3A 1CVZA 3KSEA 3KWZA 4DMXA 2XU3A 3K24A 3WXGA 5CHVA 1Y08A 2FUDA 3RVVA 1S4VA 4QRGA 3MORA 1CV8A 1PPDA 2H7JA 1PXVA 3ERVA 2DZZA 3LXSA 1EWOA 1EWPA 1YALA 4QBBA 1GMYA 2FRAA 3CBKA 2ACTA 2AUXA 3WXFA 1U9WA 1NB3A 3KX1A 1AU0A 2FYEA 1SNKA 2OZ2A 2PBHA 3KFQA 4XR7A 3OF9A 4FK5A 2P86A 4CDFB 4Q8GA 1KFXL 1U9QX 2R9FA 4XUIA 4OELA 1AU2A 2NQGA 3H8BA 2IPPB 4QH6A 2P0RA 1AU4A 1GLOA 2VHSA 2AVWA 1QDQA 3P5WA 4P6GA 1MEMA 2AYNA 2G6DA 3PBHA 1QXPA 1MIRA 3MTNA 1NB5A 1F2AA 3I3TA 2F1GA 3E1ZB 1QMYA 3KW9A 4N79A 2YJ8A 1KHQA 2G8EA 3NHEA 1ATKA 2PADA 3N3KA 1Q6KA 1AECA 3S3RA 2DCDA 2B1NA 2DCCA 1YK7A 1ZCMA 4MSXA 1MHWA 1YT7A 3LFYA 1NL6A 3IEJA 4CDCB 2E00A 4QRVA 4PI3A 4CDDB 4BS5A 2YJ9A 5CVOB 1YK8A 5EF4A 1EWLA 2BDZA 4PP1A 2DJFB 1PPNA 4I07A 4MZOA 3BPFA 1VJVA 2PNSA 5CVNB 1PADA 1PE6A 1F2BA 2HHNA 1NQCA 2DC8A 5J94A 4YYWA 3DF0A 2DJGB 4W4UA 3O1GA 3F5VA 4W5BA 2WBFX 1TL9A 1F2CA 3IMAA 3H7DA 2DCBA 3IUTA 3BC3A 5EGWA 6PADA 2IBIA 3HHAA 3K8UA 4YVAA 2R9NA 2HH5A 3RVXA 2HD5A 2YJ2A 3P5VA 3P5XA 3OF8A 1PPPA 3USVA 2XU5A 2AS8A 1VSNA 1MS6A 2R9MA 1PPOA 4N4ZA 1TLOA 1TU6A 7PCKA 2R9CA 1PIPA 3OVZA 2VHFA 4BQVA 2G7YA 1BQIA 2YJCA 5FPWA 3D6SA 4G54A 2FTDA 1PCIA 3BWKA 1ICFA 2Y6EA 3HHIA 3I06A 3V6EA 3B79A 3PDFA 1PBHA 5JA7A 1CJLA 4QRXA 2E02A 8PCHA 1Y4HA 2BDLA 3H8CA 1U9XA 2ARYA 2G8JA 5JH3A 1MEGA 4MZSA 1IWDA 1CQDA 2P7UA 1NLJA 2NQDB 2DC7A 2AIMA 1A6RA 3BOWA 3HWNA 4BS6A 1DEUA 1ITOA 5F02A 2AYOA 4I05A 3S3QA 4BPVA 3TNXA 1MDWA 9PAPA 3IHPA 1ME4A 3F75A 4HWYA 2C0YA 5K16A 1AYWA 2DZYA 4RY2A 1POPA 4FJCA 3PW3A 3IOQA 4P6EA 1BGOA
chains in the Genus database with same CATH superfamily
2YJBA 1FH0A 3MHHA 5CVMA 1CPJA 1O0EA 2CB5A 2B1MA 4YYQA 4D8EA 4MI7A 1NPZA 3KKUA 4AXLA 3N3GA 3KWBX 4AXMA 3PHWA 4PADA 4BSQA 1U5IA 3PNRA 1GECE 3CH3X 1F29A 5A24A 3H89A 4RF1A 3IV2A 1EWMA 4FIPA 2O6XA 4W5CA 3MHSA 1THEA 2E01A 1CS8A 4X6IA 1ZIVA 3O0UA 4CDEB 3BCNA 4YYRA 1ME3A 2AUZA 2XU1A 3BB7A 3HD3A 4M0WA 1AIMA 4PP2E 4ZUXU 3O65A 1BP4A 4X6JA 3W31A 3PT2A 1XKGA 2NQAA 3AI8A 4CZWA 3QSDA 5CHTA 3BPMA 1KXRA 2E03A 2Y5BA 1SP4B 3MTVA 4K7CA 1CB5A 4YYSA 3OVXA 2DC6A 2UZJA 4KLBA 2FO5A 2ATOA 3V6CA 4XZXA 5PADA 2F7DA 2BTWB 5KO3A 3N4CA 2GFOA 4D8IA 4X6HA 4HXDB 3RNVA 1AU3A 2R9OA 4P16A 1STFE 2NQIA 3RVWA 4WA6A 3B21A 1U9VA 3C9EA 1PVJA 1HUCB 3U8EA 4OEMA 2DC9A 2FQ9A 1GCBA 2GHUA 4OVZA 3CH2X 2JQFR 2JQGR 3QT4A 1QOLA 2FRQA 1DF0A 2AU1A 3GCBA 4DMYA 1YVBA 3ZUAA 4YYVA 3QJ3A 2HXZA 2OULA 4I04A 3OISA 2DOSA 1CSBB 1AYVA 1M6DA 3H6SA 2CIOA 3WXEA 1CTEA 1KHPA 1K3BB 4N8WA 2PREA 2XU4A 4OW0A 4RNAA 1AYUA 3K9MA 2R6NA 3CBJA 4YYUA 2BTWA 2DCAA 2FE8A 1X9YA 1YZBA 1EF7A 1JQPA 4YV8A 1KFUL 3M99A 2FT2A 1BY8A 4Q8HA 3P5UA 2OP3A 1CVZA 4BOZA 4BOQA 3KSEA 3KWZA 4DMXA 2XU3A 3K24A 3WXGA 5CHVA 1Y08A 2FUDA 3RVVA 1S4VA 4QRGA 3MORA 1CV8A 1PPDA 2H7JA 1PXVA 3ERVA 2DZZA 3LXSA 1EWOA 1EWPA 1YALA 4QBBA 5JZEA 1GMYA 3C0RA 2FRAA 3CBKA 2ACTA 2AUXA 3WXFA 3TRKA 1U9WA 1NB3A 3KX1A 2J7QA 5E6JA 1AU0A 2FYEA 1SNKA 2OZ2A 2Z84A 2PBHA 3KFQA 4XR7A 3OF9A 4FK5A 2P86A 4CDFB 4Q8GA 1KFXL 4RF0A 1U9QX 2R9FA 3BY4A 4XUIA 4OELA 1AU2A 2NQGA 3H8BA 2IPPB 4QH6A 5EZQA 2P0RA 1AU4A 1GLOA 2VHSA 3MP2A 2AVWA 4PT5A 1QDQA 3PRMA 3P5WA 2J7QC 4P6GA 1MEMA 3OQCA 2AYNA 2G6DA 3PBHA 1QXPA 2JTCA 1MIRA 3MTNA 2JRIA 1NB5A 1F2AA 3I3TA 2F1GA 3E1ZB 1QMYA 3KW9A 4N79A 2YJ8A 1KHQA 2G8EA 3NHEA 1ATKA 2PADA 3N3KA 4WURA 1Q6KA 4R3DA 1AECA 3S3RA 2DCDA 2B1NA 2DCCA 1YK7A 3IFUA 1ZCMA 4MSXA 1MHWA 1YT7A 3LFYA 1NL6A 3IEJA 4CDCB 4REZA 2E00A 4QRVA 4PI3A 4CDDB 4BS5A 2YJ9A 5CVOB 1YK8A 4IP3A 5EF4A 1EWLA 2BDZA 4PP1A 2DJFB 1PPNA 4I07A 4MZOA 3BPFA 1VJVA 2PNSA 5CVNB 1PADA 1PE6A 1F2BA 2HHNA 1NQCA 2DC8A 5J94A 4YYWA 3DF0A 2DJGB 1DKIA 4W4UA 3O1GA 3E9SA 4IUMA 3F5VA 4W5BA 2WBFX 2AGAA 1TL9A 1F2CA 3IMAA 4A5UA 3H7DA 2DCBA 3TMPA 3IUTA 3ZNHA 4GUAA 3BC3A 5EGWA 6PADA 2IBIA 4D8BA 2HWKA 3HHAA 3K8UA 4OVZB 4YVAA 2R9NA 2HH5A 3RVXA 2HD5A 2YJ2A 3P5VA 3PHXA 5EZSA 4BOSA 3BBAA 3P5XA 3OF8A 1PPPA 3PSEA 3USVA 2XU5A 2AS8A 4BOUA 1VSNA 1MS6A 2R9MA 1PPOA 4N4ZA 1TLOA 1TU6A 7PCKA 2R9CA 1PIPA 3OVZA 2VHFA 4BQVA 2G7YA 1UKFA 4ZTBA 1BQIA 3W30A 2YJCA 5FPWA 3D6SA 4G54A 2FTDA 1PCIA 2BU3A 3BWKA 1ICFA 3PRPA 2Y6EA 3HHIA 3I06A 3V6EA 3B79A 3PDFA 1PBHA 5JA7A 1CJLA 4QRXA 2E02A 8PCHA 1Y4HA 3PHUA 2BDLA 4MM3B 3H8CA 1U9XA 2ARYA 2G8JA 5JH3A 1MEGA 4RKXA 4MZSA 1IWDA 1CQDA 2P7UA 1NLJA 2NQDB 2DC7A 2AIMA 1A6RA 3BOWA 3HWNA 3MJ5A 1DEUA 1ITOA 5F02A 4BS6A 2AYOA 4I05A 4BOPA 3S3QA 4BPVA 3TNXA 1MDWA 9PAPA 3IHPA 1ME4A 3F75A 4HWYA 2C0YA 5K16A 1AYWA 2DZYA 4RY2A 1POPA 4FJCA 3PW3A 3IOQA 4P6EA 1BGOA
chains in the Genus database with same CATH topology
2YJBA 1FH0A 3MHHA 5CVMA 1CPJA 1O0EA 2CB5A 2B1MA 4YYQA 1NPZA 3KKUA 4AXLA 3N3GA 3KWBX 4AXMA 4PADA 4BSQA 1U5IA 3PNRA 1GECE 3CH3X 1F29A 5A24A 3H89A 3IV2A 1EWMA 4FIPA 2O6XA 4W5CA 3MHSA 1THEA 2E01A 1CS8A 4X6IA 1ZIVA 3O0UA 4CDEB 3BCNA 4YYRA 1ME3A 2AUZA 2XU1A 3HD3A 3LTWA 1AIMA 4PP2E 4ZUXU 4X6JA 1BP4A 1XKGA 2NQAA 3AI8A 4CZWA 3QSDA 5CHTA 3BPMA 1KXRA 2E03A 2Y5BA 1SP4B 1W5RA 4K7CA 1CB5A 4YYSA 3OVXA 2DC6A 2VFCA 4KLBA 2FO5A 2ATOA 3V6CA 5PADA 2F7DA 3N4CA 2GFOA 4X6HA 1AU3A 2R9OA 1STFE 2NQIA 3RVWA 4WA6A 1U9VA 3C9EA 1HUCB 3U8EA 4OEMA 2DC9A 2FQ9A 1GCBA 2GHUA 3CH2X 2JQFR 2JQGR 3QT4A 1QOLA 2FRQA 1DF0A 2AU1A 3GCBA 4DMYA 1YVBA 3ZUAA 4YYVA 3QJ3A 2HXZA 2OULA 4I04A 3OISA 2BSZA 1CSBB 1AYVA 1M6DA 3H6SA 2CIOA 3WXEA 1CTEA 1KHPA 1K3BB 4N8WA 2PREA 2XU4A 1AYUA 3K9MA 4C5PA 2R6NA 3CBJA 4YYUA 2DCAA 1E2TA 1X9YA 1EF7A 1JQPA 4YV8A 1KFUL 3M99A 4NV8A 2FT2A 1BY8A 4Q8HA 3P5UA 2OP3A 2VFBA 1CVZA 3KSEA 3KWZA 4DMXA 2XU3A 4GUZA 3K24A 3WXGA 5CHVA 1Y08A 2FUDA 3RVVA 1S4VA 1W4TA 4QRGA 3MORA 1CV8A 1PPDA 2H7JA 4B55A 1PXVA 3ERVA 2DZZA 3LXSA 1EWOA 1EWPA 1YALA 4QBBA 1GMYA 2FRAA 3CBKA 2ACTA 2AUXA 3WXFA 1U9WA 3D9WA 1NB3A 3KX1A 1AU0A 2FYEA 1SNKA 2OZ2A 2PBHA 3KFQA 4XR7A 3OF9A 4FK5A 2P86A 4BGFA 4CDFB 4Q8GA 1KFXL 1U9QX 2R9FA 4XUIA 4OELA 1AU2A 2NQGA 3H8BA 2IPPB 4QH6A 2P0RA 1AU4A 1GLOA 2VHSA 2AVWA 1QDQA 3P5WA 4P6GA 1MEMA 2AYNA 2G6DA 3PBHA 1QXPA 1MIRA 3MTNA 1NB5A 1F2AA 3I3TA 2F1GA 3E1ZB 1QMYA 3KW9A 4N79A 2YJ8A 1KHQA 2G8EA 3NHEA 1ATKA 2PADA 3N3KA 1Q6KA 1AECA 3S3RA 2DCDA 2B1NA 2DCCA 1YK7A 1ZCMA 4MSXA 1MHWA 1YT7A 3LFYA 1NL6A 3IEJA 4CDCB 2E00A 4QRVA 4PI3A 4CDDB 4BS5A 2YJ9A 5CVOB 1YK8A 5EF4A 1EWLA 2BDZA 4PP1A 2DJFB 1PPNA 4I07A 4MZOA 3BPFA 1VJVA 2PNSA 5CVNB 1PADA 1PE6A 1F2BA 2HHNA 1NQCA 2DC8A 5J94A 4YYWA 3DF0A 2DJGB 4W4UA 3O1GA 3F5VA 4W5BA 2WBFX 1TL9A 1F2CA 3IMAA 3H7DA 2DCBA 3IUTA 3BC3A 5EGWA 6PADA 2IBIA 3HHAA 3K8UA 4YVAA 2R9NA 2HH5A 3RVXA 2HD5A 2YJ2A 3P5VA 3P5XA 3OF8A 1PPPA 3USVA 2XU5A 2AS8A 1VSNA 1MS6A 2R9MA 1PPOA 4N4ZA 1TLOA 1TU6A 7PCKA 2R9CA 1PIPA 3OVZA 2VHFA 4BQVA 2G7YA 1BQIA 2YJCA 5FPWA 3D6SA 4G54A 2FTDA 1PCIA 3BWKA 1ICFA 2Y6EA 3HHIA 3I06A 3V6EA 3B79A 3PDFA 1PBHA 5JA7A 1CJLA 4QRXA 2E02A 8PCHA 1Y4HA 2BDLA 3H8CA 1U9XA 2ARYA 2G8JA 5JH3A 1MEGA 1W6FA 4MZSA 4NV7A 1IWDA 1CQDA 2P7UA 1NLJA 2NQDB 2DC7A 2AIMA 1A6RA 3BOWA 1GX3A 3HWNA 4BS6A 1DEUA 1ITOA 5F02A 2AYOA 4I05A 3S3QA 4BPVA 3TNXA 1MDWA 9PAPA 3IHPA 1ME4A 3F75A 4HWYA 2C0YA 5K16A 1AYWA 2DZYA 4RY2A 1POPA 4FJCA 3PW3A 3IOQA 4P6EA 1BGOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YJB A;  1FH0 A;  3MHH A;  5CVM A;  1CPJ A;  1O0E A;  2CB5 A;  2B1M A;  4YYQ A;  1NPZ A;  3KKU A;  4AXL A;  3N3G A;  3KWB X;  4AXM A;  4PAD A;  4BSQ A;  1U5I A;  3PNR A;  1GEC E;  3CH3 X;  1F29 A;  5A24 A;  3H89 A;  3IV2 A;  1EWM A;  4FIP A;  2O6X A;  4W5C A;  3MHS A;  1THE A;  2E01 A;  1CS8 A;  4X6I A;  1ZIV A;  3O0U A;  4CDE B;  3BCN A;  4YYR A;  1ME3 A;  2AUZ A;  2XU1 A;  3HD3 A;  1AIM A;  4PP2 E;  4ZUX U;  4X6J A;  1BP4 A;  1XKG A;  2NQA A;  3AI8 A;  4CZW A;  3QSD A;  5CHT A;  3BPM A;  1KXR A;  2E03 A;  2Y5B A;  1SP4 B;  4K7C A;  1CB5 A;  4YYS A;  3OVX A;  2DC6 A;  4KLB A;  2FO5 A;  2ATO A;  3V6C A;  5PAD A;  2F7D A;  3N4C A;  2GFO A;  4X6H A;  1AU3 A;  2R9O A;  1STF E;  2NQI A;  3RVW A;  4WA6 A;  1U9V A;  3C9E A;  1HUC B;  3U8E A;  4OEM A;  2DC9 A;  2FQ9 A;  1GCB A;  2GHU A;  3CH2 X;  2JQF R;  2JQG R;  3QT4 A;  1QOL A;  2FRQ A;  1DF0 A;  2AU1 A;  3GCB A;  4DMY A;  1YVB A;  3ZUA A;  4YYV A;  3QJ3 A;  2HXZ A;  2OUL A;  4I04 A;  3OIS A;  1CSB B;  1AYV A;  1M6D A;  3H6S A;  2CIO A;  3WXE A;  1CTE A;  1KHP A;  1K3B B;  4N8W A;  2PRE A;  2XU4 A;  1AYU A;  3K9M A;  2R6N A;  3CBJ A;  4YYU A;  2DCA A;  1X9Y A;  1EF7 A;  1JQP A;  4YV8 A;  1KFU L;  3M99 A;  2FT2 A;  1BY8 A;  4Q8H A;  3P5U A;  2OP3 A;  1CVZ A;  3KSE A;  3KWZ A;  4DMX A;  2XU3 A;  3K24 A;  3WXG A;  5CHV A;  1Y08 A;  2FUD A;  3RVV A;  1S4V A;  4QRG A;  3MOR A;  1CV8 A;  1PPD A;  2H7J A;  1PXV A;  3ERV A;  2DZZ A;  3LXS A;  1EWO A;  1EWP A;  1YAL A;  4QBB A;  1GMY A;  2FRA A;  3CBK A;  2ACT A;  2AUX A;  3WXF A;  1U9W A;  1NB3 A;  3KX1 A;  1AU0 A;  2FYE A;  1SNK A;  2OZ2 A;  2PBH A;  3KFQ A;  4XR7 A;  3OF9 A;  4FK5 A;  2P86 A;  4CDF B;  4Q8G A;  1KFX L;  1U9Q X;  2R9F A;  4XUI A;  4OEL A;  1AU2 A;  2NQG A;  3H8B A;  2IPP B;  4QH6 A;  2P0R A;  1AU4 A;  1GLO A;  2VHS A;  2AVW A;  1QDQ A;  3P5W A;  4P6G A;  1MEM A;  2AYN A;  2G6D A;  3PBH A;  1QXP A;  1MIR A;  3MTN A;  1NB5 A;  1F2A A;  3I3T A;  2F1G A;  3E1Z B;  1QMY A;  3KW9 A;  4N79 A;  2YJ8 A;  1KHQ A;  2G8E A;  3NHE A;  1ATK A;  2PAD A;  3N3K A;  1Q6K A;  1AEC A;  3S3R A;  2DCD A;  2B1N A;  2DCC A;  1YK7 A;  1ZCM A;  4MSX A;  1MHW A;  1YT7 A;  3LFY A;  1NL6 A;  3IEJ A;  4CDC B;  2E00 A;  4QRV A;  4PI3 A;  4CDD B;  4BS5 A;  2YJ9 A;  5CVO B;  1YK8 A;  5EF4 A;  1EWL A;  2BDZ A;  4PP1 A;  2DJF B;  1PPN A;  4I07 A;  4MZO A;  3BPF A;  1VJV A;  2PNS A;  5CVN B;  1PAD A;  1PE6 A;  1F2B A;  2HHN A;  1NQC A;  2DC8 A;  5J94 A;  4YYW A;  3DF0 A;  2DJG B;  4W4U A;  3O1G A;  3F5V A;  4W5B A;  2WBF X;  1TL9 A;  1F2C A;  3IMA A;  3H7D A;  2DCB A;  3IUT A;  3BC3 A;  5EGW A;  6PAD A;  2IBI A;  3HHA A;  3K8U A;  4YVA A;  2R9N A;  2HH5 A;  3RVX A;  2HD5 A;  2YJ2 A;  3P5V A;  3P5X A;  3OF8 A;  1PPP A;  3USV A;  2XU5 A;  2AS8 A;  1VSN A;  1MS6 A;  2R9M A;  1PPO A;  4N4Z A;  1TLO A;  1TU6 A;  7PCK A;  2R9C A;  1PIP A;  3OVZ A;  2VHF A;  4BQV A;  2G7Y A;  1BQI A;  2YJC A;  5FPW A;  3D6S A;  4G54 A;  2FTD A;  1PCI A;  3BWK A;  1ICF A;  2Y6E A;  3HHI A;  3I06 A;  3V6E A;  3B79 A;  3PDF A;  1PBH A;  5JA7 A;  1CJL A;  4QRX A;  2E02 A;  8PCH A;  1Y4H A;  2BDL A;  3H8C A;  1U9X A;  2ARY A;  2G8J A;  5JH3 A;  1MEG A;  4MZS A;  1IWD A;  1CQD A;  2P7U A;  1NLJ A;  2NQD B;  2DC7 A;  2AIM A;  1A6R A;  3BOW A;  3HWN A;  4BS6 A;  1DEU A;  1ITO A;  5F02 A;  2AYO A;  4I05 A;  3S3Q A;  4BPV A;  3TNX A;  1MDW A;  9PAP A;  3IHP A;  1ME4 A;  3F75 A;  4HWY A;  2C0Y A;  5K16 A;  1AYW A;  2DZY A;  4RY2 A;  1POP A;  4FJC A;  3PW3 A;  3IOQ A;  4P6E A;  1BGO A; 
#chains in the Genus database with same CATH topology
 2YJB A;  1FH0 A;  3MHH A;  5CVM A;  1CPJ A;  1O0E A;  2CB5 A;  2B1M A;  4YYQ A;  4D8E A;  4MI7 A;  1NPZ A;  3KKU A;  4AXL A;  3N3G A;  3KWB X;  4AXM A;  3PHW A;  4PAD A;  4BSQ A;  1U5I A;  3PNR A;  1GEC E;  3CH3 X;  1F29 A;  5A24 A;  3H89 A;  4RF1 A;  3IV2 A;  1EWM A;  4FIP A;  2O6X A;  4W5C A;  3MHS A;  1THE A;  2E01 A;  1CS8 A;  4X6I A;  1ZIV A;  3O0U A;  4CDE B;  3BCN A;  4YYR A;  1ME3 A;  2AUZ A;  2XU1 A;  3BB7 A;  3HD3 A;  4M0W A;  1AIM A;  4PP2 E;  4ZUX U;  3O65 A;  1BP4 A;  4X6J A;  3W31 A;  3PT2 A;  1XKG A;  2NQA A;  3AI8 A;  4CZW A;  3QSD A;  5CHT A;  3BPM A;  1KXR A;  2E03 A;  2Y5B A;  1SP4 B;  3MTV A;  4K7C A;  1CB5 A;  4YYS A;  3OVX A;  2DC6 A;  2UZJ A;  4KLB A;  2FO5 A;  2ATO A;  3V6C A;  4XZX A;  5PAD A;  2F7D A;  2BTW B;  5KO3 A;  3N4C A;  2GFO A;  4D8I A;  4X6H A;  4HXD B;  3RNV A;  1AU3 A;  2R9O A;  4P16 A;  1STF E;  2NQI A;  3RVW A;  4WA6 A;  3B21 A;  1U9V A;  3C9E A;  1PVJ A;  1HUC B;  3U8E A;  4OEM A;  2DC9 A;  2FQ9 A;  1GCB A;  2GHU A;  4OVZ A;  3CH2 X;  2JQF R;  2JQG R;  3QT4 A;  1QOL A;  2FRQ A;  1DF0 A;  2AU1 A;  3GCB A;  4DMY A;  1YVB A;  3ZUA A;  4YYV A;  3QJ3 A;  2HXZ A;  2OUL A;  4I04 A;  3OIS A;  2DOS A;  1CSB B;  1AYV A;  1M6D A;  3H6S A;  2CIO A;  3WXE A;  1CTE A;  1KHP A;  1K3B B;  4N8W A;  2PRE A;  2XU4 A;  4OW0 A;  4RNA A;  1AYU A;  3K9M A;  2R6N A;  3CBJ A;  4YYU A;  2BTW A;  2DCA A;  2FE8 A;  1X9Y A;  1YZB A;  1EF7 A;  1JQP A;  4YV8 A;  1KFU L;  3M99 A;  2FT2 A;  1BY8 A;  4Q8H A;  3P5U A;  2OP3 A;  1CVZ A;  4BOZ A;  4BOQ A;  3KSE A;  3KWZ A;  4DMX A;  2XU3 A;  3K24 A;  3WXG A;  5CHV A;  1Y08 A;  2FUD A;  3RVV A;  1S4V A;  4QRG A;  3MOR A;  1CV8 A;  1PPD A;  2H7J A;  1PXV A;  3ERV A;  2DZZ A;  3LXS A;  1EWO A;  1EWP A;  1YAL A;  4QBB A;  5JZE A;  1GMY A;  3C0R A;  2FRA A;  3CBK A;  2ACT A;  2AUX A;  3WXF A;  3TRK A;  1U9W A;  1NB3 A;  3KX1 A;  2J7Q A;  5E6J A;  1AU0 A;  2FYE A;  1SNK A;  2OZ2 A;  2Z84 A;  2PBH A;  3KFQ A;  4XR7 A;  3OF9 A;  4FK5 A;  2P86 A;  4CDF B;  4Q8G A;  1KFX L;  4RF0 A;  1U9Q X;  2R9F A;  3BY4 A;  4XUI A;  4OEL A;  1AU2 A;  2NQG A;  3H8B A;  2IPP B;  4QH6 A;  5EZQ A;  2P0R A;  1AU4 A;  1GLO A;  2VHS A;  3MP2 A;  2AVW A;  4PT5 A;  1QDQ A;  3PRM A;  3P5W A;  2J7Q C;  4P6G A;  1MEM A;  3OQC A;  2AYN A;  2G6D A;  3PBH A;  1QXP A;  2JTC A;  1MIR A;  3MTN A;  2JRI A;  1NB5 A;  1F2A A;  3I3T A;  2F1G A;  3E1Z B;  1QMY A;  3KW9 A;  4N79 A;  2YJ8 A;  1KHQ A;  2G8E A;  3NHE A;  1ATK A;  2PAD A;  3N3K A;  4WUR A;  1Q6K A;  4R3D A;  1AEC A;  3S3R A;  2DCD A;  2B1N A;  2DCC A;  1YK7 A;  3IFU A;  1ZCM A;  4MSX A;  1MHW A;  1YT7 A;  3LFY A;  1NL6 A;  3IEJ A;  4CDC B;  4REZ A;  2E00 A;  4QRV A;  4PI3 A;  4CDD B;  4BS5 A;  2YJ9 A;  5CVO B;  1YK8 A;  4IP3 A;  5EF4 A;  1EWL A;  2BDZ A;  4PP1 A;  2DJF B;  1PPN A;  4I07 A;  4MZO A;  3BPF A;  1VJV A;  2PNS A;  5CVN B;  1PAD A;  1PE6 A;  1F2B A;  2HHN A;  1NQC A;  2DC8 A;  5J94 A;  4YYW A;  3DF0 A;  2DJG B;  1DKI A;  4W4U A;  3O1G A;  3E9S A;  4IUM A;  3F5V A;  4W5B A;  2WBF X;  2AGA A;  1TL9 A;  1F2C A;  3IMA A;  4A5U A;  3H7D A;  2DCB A;  3TMP A;  3IUT A;  3ZNH A;  4GUA A;  3BC3 A;  5EGW A;  6PAD A;  2IBI A;  4D8B A;  2HWK A;  3HHA A;  3K8U A;  4OVZ B;  4YVA A;  2R9N A;  2HH5 A;  3RVX A;  2HD5 A;  2YJ2 A;  3P5V A;  3PHX A;  5EZS A;  4BOS A;  3BBA A;  3P5X A;  3OF8 A;  1PPP A;  3PSE A;  3USV A;  2XU5 A;  2AS8 A;  4BOU A;  1VSN A;  1MS6 A;  2R9M A;  1PPO A;  4N4Z A;  1TLO A;  1TU6 A;  7PCK A;  2R9C A;  1PIP A;  3OVZ A;  2VHF A;  4BQV A;  2G7Y A;  1UKF A;  4ZTB A;  1BQI A;  3W30 A;  2YJC A;  5FPW A;  3D6S A;  4G54 A;  2FTD A;  1PCI A;  2BU3 A;  3BWK A;  1ICF A;  3PRP A;  2Y6E A;  3HHI A;  3I06 A;  3V6E A;  3B79 A;  3PDF A;  1PBH A;  5JA7 A;  1CJL A;  4QRX A;  2E02 A;  8PCH A;  1Y4H A;  3PHU A;  2BDL A;  4MM3 B;  3H8C A;  1U9X A;  2ARY A;  2G8J A;  5JH3 A;  1MEG A;  4RKX A;  4MZS A;  1IWD A;  1CQD A;  2P7U A;  1NLJ A;  2NQD B;  2DC7 A;  2AIM A;  1A6R A;  3BOW A;  3HWN A;  3MJ5 A;  1DEU A;  1ITO A;  5F02 A;  4BS6 A;  2AYO A;  4I05 A;  4BOP A;  3S3Q A;  4BPV A;  3TNX A;  1MDW A;  9PAP A;  3IHP A;  1ME4 A;  3F75 A;  4HWY A;  2C0Y A;  5K16 A;  1AYW A;  2DZY A;  4RY2 A;  1POP A;  4FJC A;  3PW3 A;  3IOQ A;  4P6E A;  1BGO A; 
#chains in the Genus database with same CATH homology
 2YJB A;  1FH0 A;  3MHH A;  5CVM A;  1CPJ A;  1O0E A;  2CB5 A;  2B1M A;  4YYQ A;  1NPZ A;  3KKU A;  4AXL A;  3N3G A;  3KWB X;  4AXM A;  4PAD A;  4BSQ A;  1U5I A;  3PNR A;  1GEC E;  3CH3 X;  1F29 A;  5A24 A;  3H89 A;  3IV2 A;  1EWM A;  4FIP A;  2O6X A;  4W5C A;  3MHS A;  1THE A;  2E01 A;  1CS8 A;  4X6I A;  1ZIV A;  3O0U A;  4CDE B;  3BCN A;  4YYR A;  1ME3 A;  2AUZ A;  2XU1 A;  3HD3 A;  3LTW A;  1AIM A;  4PP2 E;  4ZUX U;  4X6J A;  1BP4 A;  1XKG A;  2NQA A;  3AI8 A;  4CZW A;  3QSD A;  5CHT A;  3BPM A;  1KXR A;  2E03 A;  2Y5B A;  1SP4 B;  1W5R A;  4K7C A;  1CB5 A;  4YYS A;  3OVX A;  2DC6 A;  2VFC A;  4KLB A;  2FO5 A;  2ATO A;  3V6C A;  5PAD A;  2F7D A;  3N4C A;  2GFO A;  4X6H A;  1AU3 A;  2R9O A;  1STF E;  2NQI A;  3RVW A;  4WA6 A;  1U9V A;  3C9E A;  1HUC B;  3U8E A;  4OEM A;  2DC9 A;  2FQ9 A;  1GCB A;  2GHU A;  3CH2 X;  2JQF R;  2JQG R;  3QT4 A;  1QOL A;  2FRQ A;  1DF0 A;  2AU1 A;  3GCB A;  4DMY A;  1YVB A;  3ZUA A;  4YYV A;  3QJ3 A;  2HXZ A;  2OUL A;  4I04 A;  3OIS A;  2BSZ A;  1CSB B;  1AYV A;  1M6D A;  3H6S A;  2CIO A;  3WXE A;  1CTE A;  1KHP A;  1K3B B;  4N8W A;  2PRE A;  2XU4 A;  1AYU A;  3K9M A;  4C5P A;  2R6N A;  3CBJ A;  4YYU A;  2DCA A;  1E2T A;  1X9Y A;  1EF7 A;  1JQP A;  4YV8 A;  1KFU L;  3M99 A;  4NV8 A;  2FT2 A;  1BY8 A;  4Q8H A;  3P5U A;  2OP3 A;  2VFB A;  1CVZ A;  3KSE A;  3KWZ A;  4DMX A;  2XU3 A;  4GUZ A;  3K24 A;  3WXG A;  5CHV A;  1Y08 A;  2FUD A;  3RVV A;  1S4V A;  1W4T A;  4QRG A;  3MOR A;  1CV8 A;  1PPD A;  2H7J A;  4B55 A;  1PXV A;  3ERV A;  2DZZ A;  3LXS A;  1EWO A;  1EWP A;  1YAL A;  4QBB A;  1GMY A;  2FRA A;  3CBK A;  2ACT A;  2AUX A;  3WXF A;  1U9W A;  3D9W A;  1NB3 A;  3KX1 A;  1AU0 A;  2FYE A;  1SNK A;  2OZ2 A;  2PBH A;  3KFQ A;  4XR7 A;  3OF9 A;  4FK5 A;  2P86 A;  4BGF A;  4CDF B;  4Q8G A;  1KFX L;  1U9Q X;  2R9F A;  4XUI A;  4OEL A;  1AU2 A;  2NQG A;  3H8B A;  2IPP B;  4QH6 A;  2P0R A;  1AU4 A;  1GLO A;  2VHS A;  2AVW A;  1QDQ A;  3P5W A;  4P6G A;  1MEM A;  2AYN A;  2G6D A;  3PBH A;  1QXP A;  1MIR A;  3MTN A;  1NB5 A;  1F2A A;  3I3T A;  2F1G A;  3E1Z B;  1QMY A;  3KW9 A;  4N79 A;  2YJ8 A;  1KHQ A;  2G8E A;  3NHE A;  1ATK A;  2PAD A;  3N3K A;  1Q6K A;  1AEC A;  3S3R A;  2DCD A;  2B1N A;  2DCC A;  1YK7 A;  1ZCM A;  4MSX A;  1MHW A;  1YT7 A;  3LFY A;  1NL6 A;  3IEJ A;  4CDC B;  2E00 A;  4QRV A;  4PI3 A;  4CDD B;  4BS5 A;  2YJ9 A;  5CVO B;  1YK8 A;  5EF4 A;  1EWL A;  2BDZ A;  4PP1 A;  2DJF B;  1PPN A;  4I07 A;  4MZO A;  3BPF A;  1VJV A;  2PNS A;  5CVN B;  1PAD A;  1PE6 A;  1F2B A;  2HHN A;  1NQC A;  2DC8 A;  5J94 A;  4YYW A;  3DF0 A;  2DJG B;  4W4U A;  3O1G A;  3F5V A;  4W5B A;  2WBF X;  1TL9 A;  1F2C A;  3IMA A;  3H7D A;  2DCB A;  3IUT A;  3BC3 A;  5EGW A;  6PAD A;  2IBI A;  3HHA A;  3K8U A;  4YVA A;  2R9N A;  2HH5 A;  3RVX A;  2HD5 A;  2YJ2 A;  3P5V A;  3P5X A;  3OF8 A;  1PPP A;  3USV A;  2XU5 A;  2AS8 A;  1VSN A;  1MS6 A;  2R9M A;  1PPO A;  4N4Z A;  1TLO A;  1TU6 A;  7PCK A;  2R9C A;  1PIP A;  3OVZ A;  2VHF A;  4BQV A;  2G7Y A;  1BQI A;  2YJC A;  5FPW A;  3D6S A;  4G54 A;  2FTD A;  1PCI A;  3BWK A;  1ICF A;  2Y6E A;  3HHI A;  3I06 A;  3V6E A;  3B79 A;  3PDF A;  1PBH A;  5JA7 A;  1CJL A;  4QRX A;  2E02 A;  8PCH A;  1Y4H A;  2BDL A;  3H8C A;  1U9X A;  2ARY A;  2G8J A;  5JH3 A;  1MEG A;  1W6F A;  4MZS A;  4NV7 A;  1IWD A;  1CQD A;  2P7U A;  1NLJ A;  2NQD B;  2DC7 A;  2AIM A;  1A6R A;  3BOW A;  1GX3 A;  3HWN A;  4BS6 A;  1DEU A;  1ITO A;  5F02 A;  2AYO A;  4I05 A;  3S3Q A;  4BPV A;  3TNX A;  1MDW A;  9PAP A;  3IHP A;  1ME4 A;  3F75 A;  4HWY A;  2C0Y A;  5K16 A;  1AYW A;  2DZY A;  4RY2 A;  1POP A;  4FJC A;  3PW3 A;  3IOQ A;  4P6E A;  1BGO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...