1AYUA

Crystal structure of cysteine protease human cathepsin k in complex with a covalent symmetric biscarbohydrazide inhibitor
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CATHEPSIN K
publication title Design of potent and selective human cathepsin K inhibitors that span the active site.
pubmed doi rcsb
source organism Homo sapiens
total genus 68
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 1997-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1ayuA00
1F2CA 3IUTA 3CBJA 1VSNA 1CQDA 2AS8A 1AU3A 4Q8HA 1ME3A 1NQCA 4BQVA 3S3RA 4FJCA 1K3BB 4I05A 1PBHA 1KHQA 4OELA 3USVA 2ACTA 2CIOA 5CHVA 1ICFA 2BDZA 4YYSA 2G8JA 1AYWA 3KW9A 3RVXA 4FK5A 1NPZA 3CH3X 4YVAA 1CV8A 2DZZA 4P6GA 3CH2X 3BWKA 2R9FA 3ZUAA 1CS8A 3H89A 3PBHA 2WBFX 3MHSA 3WXFA 2XU3A 3I06A 3D6SA 1GECE 4X6JA 1CPJA 1BY8A 2YJ9A 3N3GA 4YV8A 3C9EA 3HWNA 4XUIA 3H8BA 2R9OA 2H7JA 2R9NA 2R6NA 4CDEB 3DF0A 4PP2E 1ZIVA 1VJVA 2O6XA 4N8WA 3E1ZB 3IOQA 3ERVA 3H6SA 4W5CA 1F2AA 2NQDB 1PIPA 1EF7A 2AIMA 3I3TA 3M99A 3V6EA 1XKGA 3P5XA 1AECA 5CHTA 2FQ9A 4QRVA 2OULA 5JA7A 1F29A 2CB5A 2OP3A 3KSEA 2HD5A 1EWOA 2IPPB 2FTDA 3GCBA 1U9VA 3KKUA 2E02A 4DMXA 2YJ8A 2AVWA 3KX1A 1QXPA 1M6DA 3P5WA 3H8CA 3AI8A 2Y5BA 5PADA 3N4CA 2OZ2A 2ATOA 1TLOA 1POPA 1EWMA 1PE6A 3WXEA 2HH5A 2E01A 3OISA 4PP1A 2F1GA 5A24A 2HHNA 4X6IA 3P5UA 4MZSA 1U9WA 2FO5A 2DJFB 3OF9A 1AYUA 2VHFA 2HXZA 1SP4B 2P86A 2VHSA 4KLBA 1JQPA 3NHEA 1YK8A 2PADA 1SNKA 3O0UA 1GCBA 2DCAA 1GLOA 4X6HA 4PADA 1O0EA 1GMYA 1NL6A 3KFQA 1PADA 2GFOA 5K16A 9PAPA 4MZOA 3PDFA 4MSXA 4Q8GA 4AXMA 1ATKA 3N3KA 6PADA 1KFUL 5EGWA 5JH3A 3BCNA 2DJGB 3K24A 4YYWA 1STFE 2AUXA 2BDLA 4W4UA 4W5BA 3MHHA 1AYVA 1YK7A 3H7DA 4CDFB 1CB5A 2YJ2A 4BSQA 3F5VA 1QDQA 3QT4A 2AYNA 3OF8A 1U9QX 1NB5A 3WXGA 4YYVA 5CVNB 2G6DA 3IEJA 2PREA 2PNSA 3U8EA 2YJBA 4QRXA 1NLJA 5EF4A 2DCBA 5CVOB 1X9YA 3V6CA 2G7YA 1FH0A 1PXVA 2R9MA 3BPMA 3MTNA 2JQGR 1BP4A 4DMYA 3IHPA 3HD3A 3QJ3A 3S3QA 3KWZA 1YT7A 4N79A 2F7DA 2XU1A 2DC9A 3QSDA 4ZUXU 4YYUA 1KXRA 4CZWA 3F75A 3MORA 2E03A 3RVWA 1S4VA 3IMAA 2C0YA 1QOLA 2B1NA 1PPPA 4FIPA 2JQFR 1KHPA 3O1GA 4YYQA 1F2BA 3PW3A 1DF0A 4BPVA 1BGOA 3B79A 3IV2A 2P0RA 1MS6A 4I07A 2YJCA 1AU2A 1ZCMA 1PCIA 3TNXA 1EWPA 2PBHA 3K9MA 1TL9A 1CTEA 4QH6A 1NB3A 1BQIA 3BOWA 2AU1A 1HUCB 4CDDB 7PCKA 3HHIA 2E00A 1YALA 2DZYA 3CBKA 2Y6EA 3LFYA 1CSBB 2FT2A 1U5IA 4BS5A 2GHUA 1A6RA 1IWDA 2P7UA 2FYEA 5F02A 2NQGA 3OVXA 1THEA 1MEGA 1Y4HA 3BPFA 4I04A 4P6EA 1MHWA 1MIRA 2XU5A 2IBIA 4YYRA 2G8EA 4OEMA 1PPDA 2AYOA 1AIMA 3HHAA 4RY2A 1YVBA 1TU6A 2NQAA 5CVMA 1MDWA 3K8UA 1CVZA 4N4ZA 2AUZA 2DC8A 1EWLA 3P5VA 1CJLA 1Q6KA 2ARYA 2NQIA 1QMYA 3BC3A 2R9CA 3OVZA 3PNRA 4PI3A 4G54A 1Y08A 4CDCB 4K7CA 5FPWA 2B1MA 4AXLA 1MEMA 2DC6A 1KFXL 4BS6A 1PPNA 1AU0A 4XR7A 1AU4A 2XU4A 2DC7A 1DEUA 4QBBA 4QRGA 2DCDA 2FRQA 1ITOA 4WA6A 2FUDA 8PCHA 1U9XA 4HWYA 3KWBX 5J94A 1ME4A 2DCCA 1PPOA 2FRAA 3LXSA 3RVVA
chains in the Genus database with same CATH superfamily
1F2CA 3IUTA 3CBJA 3TMPA 1VSNA 1CQDA 3TRKA 2AS8A 4PT5A 1AU3A 4Q8HA 1ME3A 1NQCA 4BQVA 3S3RA 4FJCA 1K3BB 4I05A 1PBHA 1KHQA 4OELA 3USVA 4IUMA 2ACTA 2CIOA 5CHVA 1ICFA 2BDZA 4YYSA 2G8JA 1AYWA 3ZNHA 3KW9A 3RVXA 4M0WA 4FK5A 3BBAA 1NPZA 3CH3X 4YVAA 2JTCA 1CV8A 2DZZA 4P6GA 3CH2X 3BWKA 3MTVA 2R9FA 3ZUAA 1CS8A 3RNVA 3H89A 3PBHA 2AGAA 2WBFX 3PRPA 3MHSA 3WXFA 2JRIA 2XU3A 3I06A 4IP3A 3D6SA 1GECE 4X6JA 1CPJA 1BY8A 2YJ9A 3N3GA 4YV8A 3C9EA 3W30A 3HWNA 4XUIA 3H8BA 2R9OA 2H7JA 2R9NA 2R6NA 4CDEB 4BOPA 3DF0A 4D8BA 4RF1A 4PP2E 1ZIVA 1VJVA 2O6XA 4N8WA 3E1ZB 3IOQA 3B21A 2BTWA 3MJ5A 3ERVA 3H6SA 4W5CA 1F2AA 2NQDB 1PIPA 1EF7A 2AIMA 3I3TA 3M99A 3V6EA 1XKGA 3P5XA 4OVZA 1AECA 5CHTA 2FQ9A 4QRVA 2OULA 5JA7A 2HWKA 1F29A 3KSEA 2CB5A 2OP3A 2HD5A 1EWOA 2IPPB 2FTDA 3GCBA 1U9VA 3KKUA 2E02A 4DMXA 2YJ8A 2AVWA 3KX1A 1QXPA 1M6DA 4XZXA 3P5WA 3H8CA 4D8IA 3AI8A 2Y5BA 5PADA 3N4CA 2OZ2A 2ATOA 1TLOA 1POPA 1EWMA 1PE6A 3WXEA 2HH5A 2J7QA 2E01A 3OISA 4PP1A 2F1GA 5A24A 2HHNA 4X6IA 3P5UA 4MZSA 1U9WA 4OW0A 2FO5A 2DJFB 3OF9A 1AYUA 2VHFA 3BB7A 3O65A 2HXZA 1SP4B 2P86A 2VHSA 4KLBA 1JQPA 3NHEA 4BOUA 1YK8A 2PADA 1SNKA 3O0UA 1GCBA 2DCAA 4REZA 1GLOA 4X6HA 4PADA 4RKXA 1O0EA 1GMYA 1NL6A 3KFQA 1PADA 4MM3B 4WURA 2GFOA 5K16A 9PAPA 4MZOA 3PDFA 4MSXA 4Q8GA 4AXMA 1ATKA 3N3KA 6PADA 1KFUL 5EGWA 5JH3A 3BCNA 2DJGB 3K24A 4YYWA 1STFE 2AUXA 2BDLA 4W4UA 4W5BA 2BU3A 3MHHA 1AYVA 1YK7A 3H7DA 4CDFB 3MP2A 1CB5A 2YJ2A 4BSQA 3F5VA 1QDQA 4BOZA 2AYNA 3QT4A 3OF8A 1U9QX 1NB5A 3WXGA 4YYVA 5CVNB 2G6DA 2Z84A 1PVJA 3IEJA 2PREA 2PNSA 3U8EA 2YJBA 4QRXA 3PT2A 1NLJA 5EF4A 2DCBA 5CVOB 1X9YA 5E6JA 3V6CA 2G7YA 5EZQA 1FH0A 3W31A 1PXVA 3E9SA 2R9MA 3BPMA 3MTNA 5KO3A 2JQGR 1BP4A 4DMYA 2FE8A 3IHPA 3HD3A 3QJ3A 3S3QA 3KWZA 4RF0A 4R3DA 1YT7A 4N79A 2F7DA 2XU1A 2DC9A 3QSDA 4ZUXU 4YYUA 5JZEA 1KXRA 4CZWA 4MI7A 3F75A 3MORA 4BOSA 4A5UA 2E03A 3RVWA 3BY4A 1S4VA 3IMAA 2C0YA 1QOLA 2B1NA 1PPPA 4FIPA 2JQFR 1KHPA 3O1GA 4YYQA 1F2BA 3PW3A 1DF0A 4BPVA 1BGOA 3B79A 3PHWA 3IFUA 3IV2A 2P0RA 1MS6A 4I07A 2YJCA 1AU2A 1ZCMA 1PCIA 3TNXA 1EWPA 3PRMA 2BTWB 2DOSA 2PBHA 3K9MA 1TL9A 5EZSA 1CTEA 4QH6A 1NB3A 1BQIA 4GUAA 3BOWA 3OQCA 4OVZB 2AU1A 1HUCB 4CDDB 7PCKA 3HHIA 2E00A 1YALA 3PSEA 2DZYA 4BOQA 3CBKA 2Y6EA 3LFYA 1CSBB 2FT2A 1U5IA 4BS5A 2GHUA 1A6RA 1IWDA 2P7UA 2FYEA 3PHUA 5F02A 2NQGA 3OVXA 4ZTBA 1THEA 1DKIA 1MEGA 4P16A 4HXDB 1Y4HA 3BPFA 4I04A 4P6EA 1MHWA 1MIRA 2XU5A 2IBIA 4YYRA 2G8EA 4OEMA 1PPDA 2AYOA 1AIMA 3HHAA 4RY2A 1YVBA 1TU6A 2NQAA 4RNAA 5CVMA 1MDWA 3K8UA 1CVZA 4N4ZA 2AUZA 2DC8A 1EWLA 3P5VA 1CJLA 1Q6KA 2UZJA 2ARYA 1UKFA 2NQIA 1QMYA 3BC3A 2R9CA 3OVZA 2J7QC 1YZBA 3PNRA 4PI3A 4G54A 1Y08A 4CDCB 4D8EA 4K7CA 5FPWA 2B1MA 4AXLA 1MEMA 2DC6A 1KFXL 4BS6A 1PPNA 1AU0A 4XR7A 1AU4A 2XU4A 2DC7A 1DEUA 4QBBA 4QRGA 2DCDA 2FRQA 1ITOA 4WA6A 2FUDA 8PCHA 3PHXA 1U9XA 3C0RA 4HWYA 3KWBX 5J94A 1ME4A 2DCCA 1PPOA 2FRAA 3LXSA 3RVVA
chains in the Genus database with same CATH topology
1F2CA 3IUTA 3CBJA 1VSNA 1CQDA 2AS8A 1AU3A 4Q8HA 1ME3A 1NQCA 4BQVA 3S3RA 4FJCA 1W6FA 1K3BB 4I05A 1PBHA 1KHQA 4OELA 3USVA 2ACTA 2CIOA 5CHVA 1ICFA 2BDZA 4YYSA 2G8JA 1AYWA 3KW9A 3RVXA 4FK5A 1NPZA 3CH3X 2VFCA 4YVAA 3LTWA 1CV8A 2DZZA 4P6GA 3CH2X 3BWKA 2R9FA 3ZUAA 1CS8A 3H89A 3PBHA 2WBFX 3MHSA 3WXFA 2XU3A 3I06A 3D6SA 1GECE 4X6JA 1CPJA 1BY8A 2YJ9A 3N3GA 4YV8A 3C9EA 3HWNA 4XUIA 3H8BA 2R9OA 2H7JA 2R9NA 2R6NA 4CDEB 3DF0A 4PP2E 1ZIVA 1VJVA 2O6XA 4N8WA 3E1ZB 3IOQA 3ERVA 3H6SA 4W5CA 1F2AA 2NQDB 1PIPA 1EF7A 2AIMA 3I3TA 3M99A 3V6EA 1XKGA 3P5XA 1AECA 5CHTA 2FQ9A 4QRVA 2OULA 5JA7A 1F29A 2CB5A 2OP3A 3KSEA 2HD5A 1EWOA 4GUZA 2IPPB 4NV8A 2FTDA 3GCBA 1U9VA 3KKUA 2E02A 4DMXA 2YJ8A 2AVWA 3KX1A 1QXPA 1M6DA 4NV7A 3P5WA 3H8CA 3AI8A 2Y5BA 5PADA 3N4CA 2OZ2A 2ATOA 1TLOA 1POPA 1EWMA 1PE6A 3WXEA 2HH5A 2E01A 3OISA 4PP1A 2F1GA 5A24A 2HHNA 4X6IA 3P5UA 4MZSA 1U9WA 2FO5A 2DJFB 3OF9A 1AYUA 2VHFA 2HXZA 1SP4B 2P86A 2VHSA 4KLBA 1JQPA 3NHEA 1YK8A 2PADA 1SNKA 3O0UA 1GCBA 2DCAA 1GLOA 4BGFA 4X6HA 4PADA 1O0EA 1GMYA 2VFBA 1NL6A 3KFQA 1PADA 2GFOA 5K16A 9PAPA 4MZOA 3PDFA 4MSXA 4Q8GA 4AXMA 1ATKA 3N3KA 6PADA 1KFUL 5EGWA 5JH3A 3BCNA 2DJGB 3K24A 4YYWA 1W4TA 1STFE 2AUXA 2BDLA 4W4UA 4W5BA 3MHHA 1AYVA 1YK7A 3H7DA 4CDFB 1E2TA 1CB5A 2YJ2A 4BSQA 3F5VA 4C5PA 1QDQA 3QT4A 2AYNA 3OF8A 1U9QX 1NB5A 3WXGA 4YYVA 5CVNB 2G6DA 3IEJA 2PREA 2PNSA 3U8EA 2YJBA 4QRXA 1NLJA 5EF4A 2DCBA 5CVOB 1X9YA 3V6CA 2G7YA 1FH0A 1PXVA 2R9MA 3BPMA 3MTNA 2JQGR 1BP4A 4DMYA 3IHPA 3HD3A 3QJ3A 3S3QA 3KWZA 1YT7A 4N79A 2F7DA 2XU1A 2DC9A 3QSDA 4ZUXU 4YYUA 1KXRA 4CZWA 3F75A 3MORA 2E03A 3RVWA 1S4VA 3IMAA 2C0YA 1QOLA 2B1NA 1PPPA 4FIPA 2JQFR 1KHPA 3O1GA 4YYQA 1F2BA 3PW3A 1DF0A 4BPVA 1BGOA 3B79A 3IV2A 2P0RA 1MS6A 4I07A 2YJCA 1AU2A 1ZCMA 1PCIA 3TNXA 1EWPA 2PBHA 3K9MA 1TL9A 1CTEA 4QH6A 1NB3A 1BQIA 3BOWA 2AU1A 1HUCB 4CDDB 7PCKA 3HHIA 2E00A 1YALA 2DZYA 3CBKA 2Y6EA 3LFYA 1CSBB 2FT2A 1U5IA 4BS5A 2GHUA 1A6RA 1IWDA 2P7UA 2FYEA 5F02A 2NQGA 3OVXA 1THEA 1MEGA 1Y4HA 3BPFA 4I04A 4P6EA 1MHWA 1MIRA 2XU5A 2IBIA 4YYRA 2G8EA 4OEMA 1PPDA 2AYOA 1AIMA 3HHAA 4RY2A 1YVBA 1TU6A 2NQAA 5CVMA 1MDWA 3K8UA 1CVZA 4N4ZA 2AUZA 2DC8A 1EWLA 3P5VA 1CJLA 1Q6KA 2ARYA 2NQIA 1QMYA 3BC3A 2R9CA 3OVZA 3PNRA 4PI3A 4G54A 1Y08A 4CDCB 4B55A 1GX3A 4K7CA 5FPWA 2B1MA 2BSZA 1W5RA 4AXLA 1MEMA 2DC6A 1KFXL 4BS6A 1PPNA 1AU0A 4XR7A 1AU4A 2XU4A 2DC7A 1DEUA 4QBBA 4QRGA 3D9WA 2DCDA 2FRQA 1ITOA 4WA6A 2FUDA 8PCHA 1U9XA 4HWYA 3KWBX 5J94A 1ME4A 2DCCA 1PPOA 2FRAA 3LXSA 3RVVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F2C A;  3IUT A;  3CBJ A;  1VSN A;  1CQD A;  2AS8 A;  1AU3 A;  4Q8H A;  1ME3 A;  1NQC A;  4BQV A;  3S3R A;  4FJC A;  1K3B B;  4I05 A;  1PBH A;  1KHQ A;  4OEL A;  3USV A;  2ACT A;  2CIO A;  5CHV A;  1ICF A;  2BDZ A;  4YYS A;  2G8J A;  1AYW A;  3KW9 A;  3RVX A;  4FK5 A;  1NPZ A;  3CH3 X;  4YVA A;  1CV8 A;  2DZZ A;  4P6G A;  3CH2 X;  3BWK A;  2R9F A;  3ZUA A;  1CS8 A;  3H89 A;  3PBH A;  2WBF X;  3MHS A;  3WXF A;  2XU3 A;  3I06 A;  3D6S A;  1GEC E;  4X6J A;  1CPJ A;  1BY8 A;  2YJ9 A;  3N3G A;  4YV8 A;  3C9E A;  3HWN A;  4XUI A;  3H8B A;  2R9O A;  2H7J A;  2R9N A;  2R6N A;  4CDE B;  3DF0 A;  4PP2 E;  1ZIV A;  1VJV A;  2O6X A;  4N8W A;  3E1Z B;  3IOQ A;  3ERV A;  3H6S A;  4W5C A;  1F2A A;  2NQD B;  1PIP A;  1EF7 A;  2AIM A;  3I3T A;  3M99 A;  3V6E A;  1XKG A;  3P5X A;  1AEC A;  5CHT A;  2FQ9 A;  4QRV A;  2OUL A;  5JA7 A;  1F29 A;  2CB5 A;  2OP3 A;  3KSE A;  2HD5 A;  1EWO A;  2IPP B;  2FTD A;  3GCB A;  1U9V A;  3KKU A;  2E02 A;  4DMX A;  2YJ8 A;  2AVW A;  3KX1 A;  1QXP A;  1M6D A;  3P5W A;  3H8C A;  3AI8 A;  2Y5B A;  5PAD A;  3N4C A;  2OZ2 A;  2ATO A;  1TLO A;  1POP A;  1EWM A;  1PE6 A;  3WXE A;  2HH5 A;  2E01 A;  3OIS A;  4PP1 A;  2F1G A;  5A24 A;  2HHN A;  4X6I A;  3P5U A;  4MZS A;  1U9W A;  2FO5 A;  2DJF B;  3OF9 A;  1AYU A;  2VHF A;  2HXZ A;  1SP4 B;  2P86 A;  2VHS A;  4KLB A;  1JQP A;  3NHE A;  1YK8 A;  2PAD A;  1SNK A;  3O0U A;  1GCB A;  2DCA A;  1GLO A;  4X6H A;  4PAD A;  1O0E A;  1GMY A;  1NL6 A;  3KFQ A;  1PAD A;  2GFO A;  5K16 A;  9PAP A;  4MZO A;  3PDF A;  4MSX A;  4Q8G A;  4AXM A;  1ATK A;  3N3K A;  6PAD A;  1KFU L;  5EGW A;  5JH3 A;  3BCN A;  2DJG B;  3K24 A;  4YYW A;  1STF E;  2AUX A;  2BDL A;  4W4U A;  4W5B A;  3MHH A;  1AYV A;  1YK7 A;  3H7D A;  4CDF B;  1CB5 A;  2YJ2 A;  4BSQ A;  3F5V A;  1QDQ A;  3QT4 A;  2AYN A;  3OF8 A;  1U9Q X;  1NB5 A;  3WXG A;  4YYV A;  5CVN B;  2G6D A;  3IEJ A;  2PRE A;  2PNS A;  3U8E A;  2YJB A;  4QRX A;  1NLJ A;  5EF4 A;  2DCB A;  5CVO B;  1X9Y A;  3V6C A;  2G7Y A;  1FH0 A;  1PXV A;  2R9M A;  3BPM A;  3MTN A;  2JQG R;  1BP4 A;  4DMY A;  3IHP A;  3HD3 A;  3QJ3 A;  3S3Q A;  3KWZ A;  1YT7 A;  4N79 A;  2F7D A;  2XU1 A;  2DC9 A;  3QSD A;  4ZUX U;  4YYU A;  1KXR A;  4CZW A;  3F75 A;  3MOR A;  2E03 A;  3RVW A;  1S4V A;  3IMA A;  2C0Y A;  1QOL A;  2B1N A;  1PPP A;  4FIP A;  2JQF R;  1KHP A;  3O1G A;  4YYQ A;  1F2B A;  3PW3 A;  1DF0 A;  4BPV A;  1BGO A;  3B79 A;  3IV2 A;  2P0R A;  1MS6 A;  4I07 A;  2YJC A;  1AU2 A;  1ZCM A;  1PCI A;  3TNX A;  1EWP A;  2PBH A;  3K9M A;  1TL9 A;  1CTE A;  4QH6 A;  1NB3 A;  1BQI A;  3BOW A;  2AU1 A;  1HUC B;  4CDD B;  7PCK A;  3HHI A;  2E00 A;  1YAL A;  2DZY A;  3CBK A;  2Y6E A;  3LFY A;  1CSB B;  2FT2 A;  1U5I A;  4BS5 A;  2GHU A;  1A6R A;  1IWD A;  2P7U A;  2FYE A;  5F02 A;  2NQG A;  3OVX A;  1THE A;  1MEG A;  1Y4H A;  3BPF A;  4I04 A;  4P6E A;  1MHW A;  1MIR A;  2XU5 A;  2IBI A;  4YYR A;  2G8E A;  4OEM A;  1PPD A;  2AYO A;  1AIM A;  3HHA A;  4RY2 A;  1YVB A;  1TU6 A;  2NQA A;  5CVM A;  1MDW A;  3K8U A;  1CVZ A;  4N4Z A;  2AUZ A;  2DC8 A;  1EWL A;  3P5V A;  1CJL A;  1Q6K A;  2ARY A;  2NQI A;  1QMY A;  3BC3 A;  2R9C A;  3OVZ A;  3PNR A;  4PI3 A;  4G54 A;  1Y08 A;  4CDC B;  4K7C A;  5FPW A;  2B1M A;  4AXL A;  1MEM A;  2DC6 A;  1KFX L;  4BS6 A;  1PPN A;  1AU0 A;  4XR7 A;  1AU4 A;  2XU4 A;  2DC7 A;  1DEU A;  4QBB A;  4QRG A;  2DCD A;  2FRQ A;  1ITO A;  4WA6 A;  2FUD A;  8PCH A;  1U9X A;  4HWY A;  3KWB X;  5J94 A;  1ME4 A;  2DCC A;  1PPO A;  2FRA A;  3LXS A;  3RVV A; 
#chains in the Genus database with same CATH topology
 1F2C A;  3IUT A;  3CBJ A;  3TMP A;  1VSN A;  1CQD A;  3TRK A;  2AS8 A;  4PT5 A;  1AU3 A;  4Q8H A;  1ME3 A;  1NQC A;  4BQV A;  3S3R A;  4FJC A;  1K3B B;  4I05 A;  1PBH A;  1KHQ A;  4OEL A;  3USV A;  4IUM A;  2ACT A;  2CIO A;  5CHV A;  1ICF A;  2BDZ A;  4YYS A;  2G8J A;  1AYW A;  3ZNH A;  3KW9 A;  3RVX A;  4M0W A;  4FK5 A;  3BBA A;  1NPZ A;  3CH3 X;  4YVA A;  2JTC A;  1CV8 A;  2DZZ A;  4P6G A;  3CH2 X;  3BWK A;  3MTV A;  2R9F A;  3ZUA A;  1CS8 A;  3RNV A;  3H89 A;  3PBH A;  2AGA A;  2WBF X;  3PRP A;  3MHS A;  3WXF A;  2JRI A;  2XU3 A;  3I06 A;  4IP3 A;  3D6S A;  1GEC E;  4X6J A;  1CPJ A;  1BY8 A;  2YJ9 A;  3N3G A;  4YV8 A;  3C9E A;  3W30 A;  3HWN A;  4XUI A;  3H8B A;  2R9O A;  2H7J A;  2R9N A;  2R6N A;  4CDE B;  4BOP A;  3DF0 A;  4D8B A;  4RF1 A;  4PP2 E;  1ZIV A;  1VJV A;  2O6X A;  4N8W A;  3E1Z B;  3IOQ A;  3B21 A;  2BTW A;  3MJ5 A;  3ERV A;  3H6S A;  4W5C A;  1F2A A;  2NQD B;  1PIP A;  1EF7 A;  2AIM A;  3I3T A;  3M99 A;  3V6E A;  1XKG A;  3P5X A;  4OVZ A;  1AEC A;  5CHT A;  2FQ9 A;  4QRV A;  2OUL A;  5JA7 A;  2HWK A;  1F29 A;  3KSE A;  2CB5 A;  2OP3 A;  2HD5 A;  1EWO A;  2IPP B;  2FTD A;  3GCB A;  1U9V A;  3KKU A;  2E02 A;  4DMX A;  2YJ8 A;  2AVW A;  3KX1 A;  1QXP A;  1M6D A;  4XZX A;  3P5W A;  3H8C A;  4D8I A;  3AI8 A;  2Y5B A;  5PAD A;  3N4C A;  2OZ2 A;  2ATO A;  1TLO A;  1POP A;  1EWM A;  1PE6 A;  3WXE A;  2HH5 A;  2J7Q A;  2E01 A;  3OIS A;  4PP1 A;  2F1G A;  5A24 A;  2HHN A;  4X6I A;  3P5U A;  4MZS A;  1U9W A;  4OW0 A;  2FO5 A;  2DJF B;  3OF9 A;  1AYU A;  2VHF A;  3BB7 A;  3O65 A;  2HXZ A;  1SP4 B;  2P86 A;  2VHS A;  4KLB A;  1JQP A;  3NHE A;  4BOU A;  1YK8 A;  2PAD A;  1SNK A;  3O0U A;  1GCB A;  2DCA A;  4REZ A;  1GLO A;  4X6H A;  4PAD A;  4RKX A;  1O0E A;  1GMY A;  1NL6 A;  3KFQ A;  1PAD A;  4MM3 B;  4WUR A;  2GFO A;  5K16 A;  9PAP A;  4MZO A;  3PDF A;  4MSX A;  4Q8G A;  4AXM A;  1ATK A;  3N3K A;  6PAD A;  1KFU L;  5EGW A;  5JH3 A;  3BCN A;  2DJG B;  3K24 A;  4YYW A;  1STF E;  2AUX A;  2BDL A;  4W4U A;  4W5B A;  2BU3 A;  3MHH A;  1AYV A;  1YK7 A;  3H7D A;  4CDF B;  3MP2 A;  1CB5 A;  2YJ2 A;  4BSQ A;  3F5V A;  1QDQ A;  4BOZ A;  2AYN A;  3QT4 A;  3OF8 A;  1U9Q X;  1NB5 A;  3WXG A;  4YYV A;  5CVN B;  2G6D A;  2Z84 A;  1PVJ A;  3IEJ A;  2PRE A;  2PNS A;  3U8E A;  2YJB A;  4QRX A;  3PT2 A;  1NLJ A;  5EF4 A;  2DCB A;  5CVO B;  1X9Y A;  5E6J A;  3V6C A;  2G7Y A;  5EZQ A;  1FH0 A;  3W31 A;  1PXV A;  3E9S A;  2R9M A;  3BPM A;  3MTN A;  5KO3 A;  2JQG R;  1BP4 A;  4DMY A;  2FE8 A;  3IHP A;  3HD3 A;  3QJ3 A;  3S3Q A;  3KWZ A;  4RF0 A;  4R3D A;  1YT7 A;  4N79 A;  2F7D A;  2XU1 A;  2DC9 A;  3QSD A;  4ZUX U;  4YYU A;  5JZE A;  1KXR A;  4CZW A;  4MI7 A;  3F75 A;  3MOR A;  4BOS A;  4A5U A;  2E03 A;  3RVW A;  3BY4 A;  1S4V A;  3IMA A;  2C0Y A;  1QOL A;  2B1N A;  1PPP A;  4FIP A;  2JQF R;  1KHP A;  3O1G A;  4YYQ A;  1F2B A;  3PW3 A;  1DF0 A;  4BPV A;  1BGO A;  3B79 A;  3PHW A;  3IFU A;  3IV2 A;  2P0R A;  1MS6 A;  4I07 A;  2YJC A;  1AU2 A;  1ZCM A;  1PCI A;  3TNX A;  1EWP A;  3PRM A;  2BTW B;  2DOS A;  2PBH A;  3K9M A;  1TL9 A;  5EZS A;  1CTE A;  4QH6 A;  1NB3 A;  1BQI A;  4GUA A;  3BOW A;  3OQC A;  4OVZ B;  2AU1 A;  1HUC B;  4CDD B;  7PCK A;  3HHI A;  2E00 A;  1YAL A;  3PSE A;  2DZY A;  4BOQ A;  3CBK A;  2Y6E A;  3LFY A;  1CSB B;  2FT2 A;  1U5I A;  4BS5 A;  2GHU A;  1A6R A;  1IWD A;  2P7U A;  2FYE A;  3PHU A;  5F02 A;  2NQG A;  3OVX A;  4ZTB A;  1THE A;  1DKI A;  1MEG A;  4P16 A;  4HXD B;  1Y4H A;  3BPF A;  4I04 A;  4P6E A;  1MHW A;  1MIR A;  2XU5 A;  2IBI A;  4YYR A;  2G8E A;  4OEM A;  1PPD A;  2AYO A;  1AIM A;  3HHA A;  4RY2 A;  1YVB A;  1TU6 A;  2NQA A;  4RNA A;  5CVM A;  1MDW A;  3K8U A;  1CVZ A;  4N4Z A;  2AUZ A;  2DC8 A;  1EWL A;  3P5V A;  1CJL A;  1Q6K A;  2UZJ A;  2ARY A;  1UKF A;  2NQI A;  1QMY A;  3BC3 A;  2R9C A;  3OVZ A;  2J7Q C;  1YZB A;  3PNR A;  4PI3 A;  4G54 A;  1Y08 A;  4CDC B;  4D8E A;  4K7C A;  5FPW A;  2B1M A;  4AXL A;  1MEM A;  2DC6 A;  1KFX L;  4BS6 A;  1PPN A;  1AU0 A;  4XR7 A;  1AU4 A;  2XU4 A;  2DC7 A;  1DEU A;  4QBB A;  4QRG A;  2DCD A;  2FRQ A;  1ITO A;  4WA6 A;  2FUD A;  8PCH A;  3PHX A;  1U9X A;  3C0R A;  4HWY A;  3KWB X;  5J94 A;  1ME4 A;  2DCC A;  1PPO A;  2FRA A;  3LXS A;  3RVV A; 
#chains in the Genus database with same CATH homology
 1F2C A;  3IUT A;  3CBJ A;  1VSN A;  1CQD A;  2AS8 A;  1AU3 A;  4Q8H A;  1ME3 A;  1NQC A;  4BQV A;  3S3R A;  4FJC A;  1W6F A;  1K3B B;  4I05 A;  1PBH A;  1KHQ A;  4OEL A;  3USV A;  2ACT A;  2CIO A;  5CHV A;  1ICF A;  2BDZ A;  4YYS A;  2G8J A;  1AYW A;  3KW9 A;  3RVX A;  4FK5 A;  1NPZ A;  3CH3 X;  2VFC A;  4YVA A;  3LTW A;  1CV8 A;  2DZZ A;  4P6G A;  3CH2 X;  3BWK A;  2R9F A;  3ZUA A;  1CS8 A;  3H89 A;  3PBH A;  2WBF X;  3MHS A;  3WXF A;  2XU3 A;  3I06 A;  3D6S A;  1GEC E;  4X6J A;  1CPJ A;  1BY8 A;  2YJ9 A;  3N3G A;  4YV8 A;  3C9E A;  3HWN A;  4XUI A;  3H8B A;  2R9O A;  2H7J A;  2R9N A;  2R6N A;  4CDE B;  3DF0 A;  4PP2 E;  1ZIV A;  1VJV A;  2O6X A;  4N8W A;  3E1Z B;  3IOQ A;  3ERV A;  3H6S A;  4W5C A;  1F2A A;  2NQD B;  1PIP A;  1EF7 A;  2AIM A;  3I3T A;  3M99 A;  3V6E A;  1XKG A;  3P5X A;  1AEC A;  5CHT A;  2FQ9 A;  4QRV A;  2OUL A;  5JA7 A;  1F29 A;  2CB5 A;  2OP3 A;  3KSE A;  2HD5 A;  1EWO A;  4GUZ A;  2IPP B;  4NV8 A;  2FTD A;  3GCB A;  1U9V A;  3KKU A;  2E02 A;  4DMX A;  2YJ8 A;  2AVW A;  3KX1 A;  1QXP A;  1M6D A;  4NV7 A;  3P5W A;  3H8C A;  3AI8 A;  2Y5B A;  5PAD A;  3N4C A;  2OZ2 A;  2ATO A;  1TLO A;  1POP A;  1EWM A;  1PE6 A;  3WXE A;  2HH5 A;  2E01 A;  3OIS A;  4PP1 A;  2F1G A;  5A24 A;  2HHN A;  4X6I A;  3P5U A;  4MZS A;  1U9W A;  2FO5 A;  2DJF B;  3OF9 A;  1AYU A;  2VHF A;  2HXZ A;  1SP4 B;  2P86 A;  2VHS A;  4KLB A;  1JQP A;  3NHE A;  1YK8 A;  2PAD A;  1SNK A;  3O0U A;  1GCB A;  2DCA A;  1GLO A;  4BGF A;  4X6H A;  4PAD A;  1O0E A;  1GMY A;  2VFB A;  1NL6 A;  3KFQ A;  1PAD A;  2GFO A;  5K16 A;  9PAP A;  4MZO A;  3PDF A;  4MSX A;  4Q8G A;  4AXM A;  1ATK A;  3N3K A;  6PAD A;  1KFU L;  5EGW A;  5JH3 A;  3BCN A;  2DJG B;  3K24 A;  4YYW A;  1W4T A;  1STF E;  2AUX A;  2BDL A;  4W4U A;  4W5B A;  3MHH A;  1AYV A;  1YK7 A;  3H7D A;  4CDF B;  1E2T A;  1CB5 A;  2YJ2 A;  4BSQ A;  3F5V A;  4C5P A;  1QDQ A;  3QT4 A;  2AYN A;  3OF8 A;  1U9Q X;  1NB5 A;  3WXG A;  4YYV A;  5CVN B;  2G6D A;  3IEJ A;  2PRE A;  2PNS A;  3U8E A;  2YJB A;  4QRX A;  1NLJ A;  5EF4 A;  2DCB A;  5CVO B;  1X9Y A;  3V6C A;  2G7Y A;  1FH0 A;  1PXV A;  2R9M A;  3BPM A;  3MTN A;  2JQG R;  1BP4 A;  4DMY A;  3IHP A;  3HD3 A;  3QJ3 A;  3S3Q A;  3KWZ A;  1YT7 A;  4N79 A;  2F7D A;  2XU1 A;  2DC9 A;  3QSD A;  4ZUX U;  4YYU A;  1KXR A;  4CZW A;  3F75 A;  3MOR A;  2E03 A;  3RVW A;  1S4V A;  3IMA A;  2C0Y A;  1QOL A;  2B1N A;  1PPP A;  4FIP A;  2JQF R;  1KHP A;  3O1G A;  4YYQ A;  1F2B A;  3PW3 A;  1DF0 A;  4BPV A;  1BGO A;  3B79 A;  3IV2 A;  2P0R A;  1MS6 A;  4I07 A;  2YJC A;  1AU2 A;  1ZCM A;  1PCI A;  3TNX A;  1EWP A;  2PBH A;  3K9M A;  1TL9 A;  1CTE A;  4QH6 A;  1NB3 A;  1BQI A;  3BOW A;  2AU1 A;  1HUC B;  4CDD B;  7PCK A;  3HHI A;  2E00 A;  1YAL A;  2DZY A;  3CBK A;  2Y6E A;  3LFY A;  1CSB B;  2FT2 A;  1U5I A;  4BS5 A;  2GHU A;  1A6R A;  1IWD A;  2P7U A;  2FYE A;  5F02 A;  2NQG A;  3OVX A;  1THE A;  1MEG A;  1Y4H A;  3BPF A;  4I04 A;  4P6E A;  1MHW A;  1MIR A;  2XU5 A;  2IBI A;  4YYR A;  2G8E A;  4OEM A;  1PPD A;  2AYO A;  1AIM A;  3HHA A;  4RY2 A;  1YVB A;  1TU6 A;  2NQA A;  5CVM A;  1MDW A;  3K8U A;  1CVZ A;  4N4Z A;  2AUZ A;  2DC8 A;  1EWL A;  3P5V A;  1CJL A;  1Q6K A;  2ARY A;  2NQI A;  1QMY A;  3BC3 A;  2R9C A;  3OVZ A;  3PNR A;  4PI3 A;  4G54 A;  1Y08 A;  4CDC B;  4B55 A;  1GX3 A;  4K7C A;  5FPW A;  2B1M A;  2BSZ A;  1W5R A;  4AXL A;  1MEM A;  2DC6 A;  1KFX L;  4BS6 A;  1PPN A;  1AU0 A;  4XR7 A;  1AU4 A;  2XU4 A;  2DC7 A;  1DEU A;  4QBB A;  4QRG A;  3D9W A;  2DCD A;  2FRQ A;  1ITO A;  4WA6 A;  2FUD A;  8PCH A;  1U9X A;  4HWY A;  3KWB X;  5J94 A;  1ME4 A;  2DCC A;  1PPO A;  2FRA A;  3LXS A;  3RVV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...