1NQCA

Crystal structures of cathepsin s inhibitor complexes
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
217
structure length
217
Chain Sequence
LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVTLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Specificity determinants of human cathepsin s revealed by crystal structures of complexes.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Cathepsin S
total genus 69
structure length 217
sequence length 217
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2003-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1nqcA00
2AIMA 2JQGR 5JH3A 4BS6A 2DCCA 1QDQA 3HWNA 3PNRA 2VHSA 1NB3A 4DMXA 2FRQA 4Q8HA 1POPA 1VJVA 3TNXA 4QBBA 1SNKA 1XKGA 3H7DA 1PIPA 2F1GA 2CB5A 3P5WA 5EF4A 3LXSA 4OELA 2E02A 2AUXA 1MEMA 2DC7A 5K16A 1SP4B 4ZUXU 1AIMA 3BCNA 2IPPB 4AXLA 3OF8A 2ACTA 1AYWA 1Y4HA 3KSEA 3N3GA 3OISA 1ATKA 5CVNB 3MTNA 2DC8A 3OVXA 4CDDB 2DC9A 3BWKA 1S4VA 2OP3A 3IEJA 1U9VA 1VSNA 2YJ2A 4FIPA 4X6IA 1BGOA 2R9OA 3RVWA 1QOLA 1YK8A 4P6GA 2B1NA 1PE6A 4RY2A 4DMYA 2HHNA 2HH5A 1PPNA 2HXZA 3P5XA 3F5VA 1K3BB 2FO5A 1AU0A 2DJGB 3CBKA 3N4CA 3KWZA 2P86A 3P5UA 2C0YA 1MS6A 3NHEA 1KXRA 4W4UA 1NPZA 3MORA 2YJ9A 4N4ZA 1DEUA 3IUTA 3H6SA 3IMAA 2DCBA 2BDLA 3ZUAA 1Y08A 2FT2A 2GHUA 1F2BA 1THEA 1NB5A 1M6DA 5J94A 4MZSA 4CDFB 2NQAA 1GECE 3IV2A 2Y6EA 1FH0A 4YYUA 5PADA 1AECA 3H8BA 2XU1A 1PPDA 3RVVA 1STFE 2HD5A 3B79A 1U9QX 2OULA 1EWPA 1TU6A 3F75A 1U5IA 6PADA 1JQPA 3BC3A 2H7JA 5JA7A 1CQDA 1CS8A 3CH3X 2Y5BA 2DZYA 2CIOA 2R9CA 1EWLA 1F2CA 2PBHA 1ZCMA 3E1ZB 1F29A 5CVOB 1U9XA 3S3QA 4YYQA 4PADA 4I07A 1X9YA 3K8UA 8PCHA 1NL6A 2FQ9A 3CH2X 1KFXL 5CHVA 3IOQA 2R6NA 3ERVA 3BOWA 1U9WA 7PCKA 1YVBA 1DF0A 2PREA 1CB5A 1ME4A 2G6DA 4N79A 4PP1A 2E03A 3WXGA 4FK5A 3QJ3A 1YALA 1KFUL 2DCDA 3O0UA 3BPMA 1AYVA 3I3TA 3KWBX 5CVMA 2AU1A 2E01A 3PDFA 2GFOA 4BSQA 2FYEA 9PAPA 2AYOA 2R9NA 3KW9A 2F7DA 2YJBA 4XR7A 2XU3A 3K24A 1GLOA 3O1GA 4BQVA 3D6SA 2BDZA 1MEGA 4YVAA 1MHWA 2DZZA 3USVA 3CBJA 3IHPA 4XUIA 1PBHA 2JQFR 4QRXA 2FUDA 4W5CA 4OEMA 3KX1A 4HWYA 1PXVA 4PI3A 2IBIA 1YT7A 3H89A 1PPOA 5A24A 1CSBB 3BPFA 2YJ8A 2OZ2A 3HHIA 3I06A 4BPVA 2NQGA 4W5BA 4I04A 4QRVA 3PBHA 1AU3A 1F2AA 4X6HA 2ARYA 4YYWA 2ATOA 1HUCB 2DC6A 2G7YA 2DCAA 5F02A 1ZIVA 5CHTA 2AVWA 2NQDB 1MDWA 5EGWA 2G8EA 2PNSA 2E00A 3H8CA 2XU5A 3OF9A 3S3RA 1CTEA 1KHQA 3KFQA 3C9EA 2DJFB 1IWDA 2VHFA 1QXPA 4FJCA 2P7UA 3RVXA 1ME3A 4AXMA 3WXEA 3HHAA 3QSDA 2FRAA 1CPJA 4QH6A 3KKUA 2WBFX 2AS8A 4YYSA 1EWMA 2AYNA 3MHHA 3PW3A 2O6XA 4N8WA 2P0RA 3V6EA 4YYRA 2YJCA 2XU4A 4BS5A 1ICFA 1AU4A 2AUZA 4Q8GA 1EF7A 1Q6KA 4MZOA 1PPPA 3OVZA 1MIRA 2FTDA 3K9MA 3MHSA 1BY8A 1YK7A 3U8EA 4KLBA 5FPWA 3GCBA 4I05A 3QT4A 4P6EA 1EWOA 1PADA 2PADA 4CZWA 4G54A 4QRGA 4PP2E 1CVZA 2G8JA 1GCBA 1AYUA 1GMYA 3DF0A 2NQIA 1TLOA 4YYVA 1TL9A 4K7CA 4MSXA 4CDCB 4WA6A 2R9MA 3LFYA 3AI8A 1QMYA 4YV8A 1KHPA 4X6JA 1PCIA 3HD3A 1NQCA 4CDEB 1NLJA 1O0EA 2R9FA 1BQIA 1A6RA 1CJLA 1BP4A 3WXFA 3N3KA 1ITOA 2B1MA 1AU2A 3P5VA 3M99A 3V6CA 1CV8A
chains in the Genus database with same CATH superfamily
2AIMA 2JQGR 5JH3A 4BS6A 2DCCA 1QDQA 4D8EA 3HWNA 3PNRA 2VHSA 3W30A 1NB3A 4DMXA 2FRQA 4Q8HA 1POPA 1VJVA 5E6JA 3TNXA 4R3DA 4QBBA 1SNKA 1XKGA 3H7DA 1PIPA 2F1GA 5EZQA 2CB5A 3P5WA 5EF4A 3LXSA 4OELA 4M0WA 2E02A 2AUXA 1MEMA 2DC7A 5K16A 1SP4B 2Z84A 4ZUXU 1AIMA 3BCNA 3TMPA 2IPPB 4AXLA 3OF8A 2ACTA 1AYWA 1Y4HA 2DOSA 3KSEA 3N3GA 3OISA 1ATKA 5CVNB 3MTNA 2DC8A 3OVXA 4CDDB 3PRPA 4OVZB 2DC9A 3BWKA 3O65A 1S4VA 2OP3A 3IEJA 1U9VA 4ZTBA 1VSNA 2YJ2A 4FIPA 3IFUA 4X6IA 1BGOA 2R9OA 3RVWA 4BOPA 1QOLA 1YK8A 4P6GA 2B1NA 1PE6A 4RY2A 4DMYA 2HHNA 2HH5A 1PPNA 2HXZA 3P5XA 3F5VA 1K3BB 2FO5A 1AU0A 2DJGB 3CBKA 3N4CA 3KWZA 2P86A 3P5UA 2C0YA 1MS6A 3NHEA 2BU3A 1KXRA 1NPZA 3MORA 4OVZA 4W4UA 2YJ9A 3RNVA 4N4ZA 1DEUA 3IUTA 4P16A 3H6SA 3IMAA 2DCBA 2BDLA 3ZUAA 1Y08A 2FT2A 2GHUA 1F2BA 1THEA 4D8IA 1M6DA 1NB5A 5J94A 4HXDB 4MZSA 4CDFB 2NQAA 1GECE 3IV2A 2Y6EA 1FH0A 4YYUA 5PADA 1AECA 3H8BA 2XU1A 1PPDA 3RVVA 1STFE 2HD5A 3B79A 1U9QX 2OULA 1EWPA 3BBAA 1TU6A 2J7QC 3F75A 1U5IA 6PADA 1JQPA 2JRIA 3PRMA 3BC3A 4XZXA 2H7JA 5JA7A 1CQDA 1CS8A 3CH3X 2Y5BA 2DZYA 2CIOA 2R9CA 1EWLA 1F2CA 2PBHA 1DKIA 1ZCMA 3E1ZB 1F29A 5CVOB 1U9XA 3B21A 2UZJA 1PVJA 3S3QA 4YYQA 4PADA 4I07A 1X9YA 3K8UA 8PCHA 1NL6A 2J7QA 2FQ9A 3C0RA 3CH2X 1KFXL 5CHVA 3MJ5A 3IOQA 2R6NA 3ERVA 3BOWA 1U9WA 7PCKA 4IUMA 1YVBA 1DF0A 2PREA 1CB5A 1ME4A 2G6DA 4N79A 4PP1A 2E03A 3OQCA 3WXGA 4A5UA 4FK5A 3QJ3A 1YALA 1KFUL 2DCDA 3O0UA 3BPMA 1AYVA 3BB7A 3I3TA 3KWBX 5CVMA 2AU1A 2AGAA 4MI7A 2E01A 3PDFA 2GFOA 4BSQA 2FYEA 9PAPA 4GUAA 2AYOA 2R9NA 3KW9A 2F7DA 2YJBA 4XR7A 2XU3A 3K24A 3BY4A 1GLOA 3O1GA 4BQVA 3D6SA 2BDZA 1MEGA 4YVAA 1MHWA 2DZZA 3USVA 3CBJA 3IHPA 4REZA 4XUIA 1PBHA 2JQFR 4QRXA 2FUDA 4PT5A 4W5CA 4OEMA 3KX1A 4HWYA 1PXVA 4PI3A 2IBIA 1YT7A 3H89A 4OW0A 1PPOA 5A24A 1CSBB 4IP3A 3BPFA 3PSEA 2YJ8A 2OZ2A 3HHIA 3I06A 3ZNHA 4WURA 1YZBA 4BPVA 2NQGA 4W5BA 4I04A 4QRVA 3PBHA 1AU3A 1F2AA 5JZEA 5EZSA 4X6HA 4RKXA 2ARYA 4YYWA 2ATOA 4RF0A 1HUCB 2DC6A 2G7YA 2DCAA 5F02A 1ZIVA 5CHTA 2AVWA 3MTVA 2NQDB 1MDWA 2FE8A 5EGWA 2G8EA 2PNSA 3PHWA 2E00A 3H8CA 2XU5A 3OF9A 3S3RA 1CTEA 4RNAA 1KHQA 3KFQA 3C9EA 2DJFB 1IWDA 2VHFA 1QXPA 4FJCA 2BTWA 3PHUA 2P7UA 3RVXA 1ME3A 4AXMA 3WXEA 3HHAA 3QSDA 2FRAA 1CPJA 4QH6A 3KKUA 1UKFA 2WBFX 2AS8A 4YYSA 1EWMA 4BOZA 2AYNA 3PHXA 3MHHA 3PW3A 2O6XA 4N8WA 4MM3B 2P0RA 3V6EA 4YYRA 2YJCA 2XU4A 4BS5A 1ICFA 1AU4A 2AUZA 4Q8GA 1EF7A 1Q6KA 4MZOA 1PPPA 3OVZA 3TRKA 1MIRA 2FTDA 3K9MA 3MHSA 1BY8A 1YK7A 3U8EA 4KLBA 5FPWA 3GCBA 4I05A 3QT4A 4P6EA 1EWOA 2HWKA 3E9SA 1PADA 2PADA 4CZWA 4G54A 4QRGA 4D8BA 4PP2E 1CVZA 2G8JA 1GCBA 1AYUA 1GMYA 3DF0A 2NQIA 1TLOA 4YYVA 1TL9A 4K7CA 2BTWB 4MSXA 4CDCB 4BOUA 4WA6A 3PT2A 2R9MA 3LFYA 3AI8A 1QMYA 3W31A 4YV8A 1KHPA 4X6JA 1PCIA 3HD3A 1NQCA 4CDEB 1NLJA 1O0EA 2R9FA 1BQIA 1A6RA 1CJLA 5KO3A 1BP4A 3WXFA 3N3KA 1ITOA 4BOQA 2B1MA 1AU2A 3P5VA 3M99A 4RF1A 3V6CA 4BOSA 1CV8A 3MP2A 2JTCA
chains in the Genus database with same CATH topology
2AIMA 2JQGR 4B55A 5JH3A 4BS6A 2DCCA 1QDQA 3HWNA 3PNRA 1GX3A 2VHSA 1NB3A 4DMXA 2FRQA 4Q8HA 1POPA 1VJVA 3TNXA 4QBBA 1SNKA 1XKGA 3H7DA 1PIPA 2F1GA 2CB5A 3P5WA 5EF4A 3LXSA 4OELA 2E02A 2AUXA 1MEMA 2DC7A 5K16A 1SP4B 4ZUXU 1AIMA 3BCNA 2IPPB 4AXLA 3OF8A 2ACTA 1AYWA 1Y4HA 3KSEA 3N3GA 3OISA 1ATKA 5CVNB 3MTNA 2DC8A 3OVXA 1W5RA 4CDDB 2DC9A 3BWKA 1S4VA 2OP3A 3IEJA 1U9VA 1VSNA 2YJ2A 4FIPA 4X6IA 1BGOA 2R9OA 3RVWA 1QOLA 1YK8A 4P6GA 2B1NA 1PE6A 4RY2A 4DMYA 2HHNA 2HH5A 1PPNA 2HXZA 3P5XA 3F5VA 1K3BB 2FO5A 1AU0A 2DJGB 3CBKA 3N4CA 3KWZA 2P86A 3P5UA 2C0YA 1E2TA 1MS6A 3NHEA 1KXRA 4W4UA 1NPZA 3MORA 2YJ9A 4N4ZA 1DEUA 3IUTA 3H6SA 3IMAA 4GUZA 2DCBA 2BDLA 3ZUAA 1Y08A 2FT2A 2GHUA 1F2BA 1THEA 1NB5A 1M6DA 5J94A 4MZSA 4CDFB 2NQAA 1GECE 3IV2A 2Y6EA 1FH0A 4YYUA 5PADA 1AECA 3H8BA 2XU1A 1PPDA 3RVVA 1STFE 2HD5A 3B79A 1U9QX 2OULA 1EWPA 1TU6A 3F75A 1U5IA 6PADA 1JQPA 3BC3A 1W6FA 2H7JA 5JA7A 1CQDA 1CS8A 3CH3X 2Y5BA 2DZYA 2CIOA 2R9CA 1EWLA 1F2CA 2PBHA 1ZCMA 3E1ZB 1F29A 5CVOB 1U9XA 3S3QA 4YYQA 4PADA 4I07A 1X9YA 3K8UA 8PCHA 1NL6A 2FQ9A 3CH2X 1KFXL 5CHVA 3IOQA 2R6NA 3ERVA 3BOWA 1U9WA 7PCKA 4C5PA 1YVBA 1DF0A 2PREA 1CB5A 1ME4A 2G6DA 4N79A 4PP1A 2E03A 3WXGA 4FK5A 3QJ3A 1YALA 1KFUL 2DCDA 3O0UA 3BPMA 1AYVA 3D9WA 3I3TA 3KWBX 5CVMA 2AU1A 2E01A 3PDFA 2GFOA 4BSQA 2FYEA 9PAPA 2AYOA 2R9NA 3KW9A 2F7DA 2YJBA 4XR7A 2XU3A 3K24A 1GLOA 3O1GA 4BQVA 3D6SA 2BDZA 1MEGA 4YVAA 1MHWA 3LTWA 4NV8A 2DZZA 3USVA 3CBJA 3IHPA 4XUIA 1PBHA 2JQFR 4QRXA 2FUDA 4W5CA 4OEMA 3KX1A 4HWYA 1PXVA 4PI3A 2IBIA 1YT7A 3H89A 1PPOA 5A24A 1CSBB 3BPFA 2YJ8A 2OZ2A 3HHIA 3I06A 2VFCA 4BPVA 2NQGA 4W5BA 4I04A 4QRVA 3PBHA 1AU3A 1F2AA 4X6HA 2ARYA 4YYWA 2ATOA 1HUCB 2DC6A 2G7YA 2DCAA 5F02A 1ZIVA 5CHTA 2AVWA 2NQDB 1MDWA 5EGWA 2G8EA 2PNSA 2E00A 3H8CA 2XU5A 3OF9A 3S3RA 1CTEA 1KHQA 3KFQA 3C9EA 2DJFB 1IWDA 2VHFA 1QXPA 4NV7A 4FJCA 2P7UA 3RVXA 1ME3A 4AXMA 3WXEA 3HHAA 3QSDA 2FRAA 1CPJA 4QH6A 3KKUA 2WBFX 2AS8A 4YYSA 1EWMA 2AYNA 3MHHA 3PW3A 2O6XA 4N8WA 2P0RA 3V6EA 4YYRA 2YJCA 2XU4A 4BS5A 1ICFA 1AU4A 2AUZA 4Q8GA 1EF7A 1Q6KA 4MZOA 1PPPA 3OVZA 1MIRA 2FTDA 3K9MA 3MHSA 1BY8A 1YK7A 3U8EA 4KLBA 5FPWA 4BGFA 3GCBA 4I05A 3QT4A 2BSZA 4P6EA 1EWOA 1PADA 2PADA 4CZWA 4G54A 4QRGA 4PP2E 1CVZA 2G8JA 1GCBA 1AYUA 1GMYA 3DF0A 2NQIA 1TLOA 4YYVA 1TL9A 4K7CA 1W4TA 4MSXA 4CDCB 4WA6A 2R9MA 3LFYA 3AI8A 1QMYA 4YV8A 1KHPA 4X6JA 1PCIA 3HD3A 1NQCA 4CDEB 1NLJA 1O0EA 2R9FA 1BQIA 1A6RA 1CJLA 1BP4A 3WXFA 3N3KA 2VFBA 1ITOA 2B1MA 1AU2A 3P5VA 3M99A 3V6CA 1CV8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AIM A;  2JQG R;  5JH3 A;  4BS6 A;  2DCC A;  1QDQ A;  3HWN A;  3PNR A;  2VHS A;  1NB3 A;  4DMX A;  2FRQ A;  4Q8H A;  1POP A;  1VJV A;  3TNX A;  4QBB A;  1SNK A;  1XKG A;  3H7D A;  1PIP A;  2F1G A;  2CB5 A;  3P5W A;  5EF4 A;  3LXS A;  4OEL A;  2E02 A;  2AUX A;  1MEM A;  2DC7 A;  5K16 A;  1SP4 B;  4ZUX U;  1AIM A;  3BCN A;  2IPP B;  4AXL A;  3OF8 A;  2ACT A;  1AYW A;  1Y4H A;  3KSE A;  3N3G A;  3OIS A;  1ATK A;  5CVN B;  3MTN A;  2DC8 A;  3OVX A;  4CDD B;  2DC9 A;  3BWK A;  1S4V A;  2OP3 A;  3IEJ A;  1U9V A;  1VSN A;  2YJ2 A;  4FIP A;  4X6I A;  1BGO A;  2R9O A;  3RVW A;  1QOL A;  1YK8 A;  4P6G A;  2B1N A;  1PE6 A;  4RY2 A;  4DMY A;  2HHN A;  2HH5 A;  1PPN A;  2HXZ A;  3P5X A;  3F5V A;  1K3B B;  2FO5 A;  1AU0 A;  2DJG B;  3CBK A;  3N4C A;  3KWZ A;  2P86 A;  3P5U A;  2C0Y A;  1MS6 A;  3NHE A;  1KXR A;  4W4U A;  1NPZ A;  3MOR A;  2YJ9 A;  4N4Z A;  1DEU A;  3IUT A;  3H6S A;  3IMA A;  2DCB A;  2BDL A;  3ZUA A;  1Y08 A;  2FT2 A;  2GHU A;  1F2B A;  1THE A;  1NB5 A;  1M6D A;  5J94 A;  4MZS A;  4CDF B;  2NQA A;  1GEC E;  3IV2 A;  2Y6E A;  1FH0 A;  4YYU A;  5PAD A;  1AEC A;  3H8B A;  2XU1 A;  1PPD A;  3RVV A;  1STF E;  2HD5 A;  3B79 A;  1U9Q X;  2OUL A;  1EWP A;  1TU6 A;  3F75 A;  1U5I A;  6PAD A;  1JQP A;  3BC3 A;  2H7J A;  5JA7 A;  1CQD A;  1CS8 A;  3CH3 X;  2Y5B A;  2DZY A;  2CIO A;  2R9C A;  1EWL A;  1F2C A;  2PBH A;  1ZCM A;  3E1Z B;  1F29 A;  5CVO B;  1U9X A;  3S3Q A;  4YYQ A;  4PAD A;  4I07 A;  1X9Y A;  3K8U A;  8PCH A;  1NL6 A;  2FQ9 A;  3CH2 X;  1KFX L;  5CHV A;  3IOQ A;  2R6N A;  3ERV A;  3BOW A;  1U9W A;  7PCK A;  1YVB A;  1DF0 A;  2PRE A;  1CB5 A;  1ME4 A;  2G6D A;  4N79 A;  4PP1 A;  2E03 A;  3WXG A;  4FK5 A;  3QJ3 A;  1YAL A;  1KFU L;  2DCD A;  3O0U A;  3BPM A;  1AYV A;  3I3T A;  3KWB X;  5CVM A;  2AU1 A;  2E01 A;  3PDF A;  2GFO A;  4BSQ A;  2FYE A;  9PAP A;  2AYO A;  2R9N A;  3KW9 A;  2F7D A;  2YJB A;  4XR7 A;  2XU3 A;  3K24 A;  1GLO A;  3O1G A;  4BQV A;  3D6S A;  2BDZ A;  1MEG A;  4YVA A;  1MHW A;  2DZZ A;  3USV A;  3CBJ A;  3IHP A;  4XUI A;  1PBH A;  2JQF R;  4QRX A;  2FUD A;  4W5C A;  4OEM A;  3KX1 A;  4HWY A;  1PXV A;  4PI3 A;  2IBI A;  1YT7 A;  3H89 A;  1PPO A;  5A24 A;  1CSB B;  3BPF A;  2YJ8 A;  2OZ2 A;  3HHI A;  3I06 A;  4BPV A;  2NQG A;  4W5B A;  4I04 A;  4QRV A;  3PBH A;  1AU3 A;  1F2A A;  4X6H A;  2ARY A;  4YYW A;  2ATO A;  1HUC B;  2DC6 A;  2G7Y A;  2DCA A;  5F02 A;  1ZIV A;  5CHT A;  2AVW A;  2NQD B;  1MDW A;  5EGW A;  2G8E A;  2PNS A;  2E00 A;  3H8C A;  2XU5 A;  3OF9 A;  3S3R A;  1CTE A;  1KHQ A;  3KFQ A;  3C9E A;  2DJF B;  1IWD A;  2VHF A;  1QXP A;  4FJC A;  2P7U A;  3RVX A;  1ME3 A;  4AXM A;  3WXE A;  3HHA A;  3QSD A;  2FRA A;  1CPJ A;  4QH6 A;  3KKU A;  2WBF X;  2AS8 A;  4YYS A;  1EWM A;  2AYN A;  3MHH A;  3PW3 A;  2O6X A;  4N8W A;  2P0R A;  3V6E A;  4YYR A;  2YJC A;  2XU4 A;  4BS5 A;  1ICF A;  1AU4 A;  2AUZ A;  4Q8G A;  1EF7 A;  1Q6K A;  4MZO A;  1PPP A;  3OVZ A;  1MIR A;  2FTD A;  3K9M A;  3MHS A;  1BY8 A;  1YK7 A;  3U8E A;  4KLB A;  5FPW A;  3GCB A;  4I05 A;  3QT4 A;  4P6E A;  1EWO A;  1PAD A;  2PAD A;  4CZW A;  4G54 A;  4QRG A;  4PP2 E;  1CVZ A;  2G8J A;  1GCB A;  1AYU A;  1GMY A;  3DF0 A;  2NQI A;  1TLO A;  4YYV A;  1TL9 A;  4K7C A;  4MSX A;  4CDC B;  4WA6 A;  2R9M A;  3LFY A;  3AI8 A;  1QMY A;  4YV8 A;  1KHP A;  4X6J A;  1PCI A;  3HD3 A;  1NQC A;  4CDE B;  1NLJ A;  1O0E A;  2R9F A;  1BQI A;  1A6R A;  1CJL A;  1BP4 A;  3WXF A;  3N3K A;  1ITO A;  2B1M A;  1AU2 A;  3P5V A;  3M99 A;  3V6C A;  1CV8 A; 
#chains in the Genus database with same CATH topology
 2AIM A;  2JQG R;  5JH3 A;  4BS6 A;  2DCC A;  1QDQ A;  4D8E A;  3HWN A;  3PNR A;  2VHS A;  3W30 A;  1NB3 A;  4DMX A;  2FRQ A;  4Q8H A;  1POP A;  1VJV A;  5E6J A;  3TNX A;  4R3D A;  4QBB A;  1SNK A;  1XKG A;  3H7D A;  1PIP A;  2F1G A;  5EZQ A;  2CB5 A;  3P5W A;  5EF4 A;  3LXS A;  4OEL A;  4M0W A;  2E02 A;  2AUX A;  1MEM A;  2DC7 A;  5K16 A;  1SP4 B;  2Z84 A;  4ZUX U;  1AIM A;  3BCN A;  3TMP A;  2IPP B;  4AXL A;  3OF8 A;  2ACT A;  1AYW A;  1Y4H A;  2DOS A;  3KSE A;  3N3G A;  3OIS A;  1ATK A;  5CVN B;  3MTN A;  2DC8 A;  3OVX A;  4CDD B;  3PRP A;  4OVZ B;  2DC9 A;  3BWK A;  3O65 A;  1S4V A;  2OP3 A;  3IEJ A;  1U9V A;  4ZTB A;  1VSN A;  2YJ2 A;  4FIP A;  3IFU A;  4X6I A;  1BGO A;  2R9O A;  3RVW A;  4BOP A;  1QOL A;  1YK8 A;  4P6G A;  2B1N A;  1PE6 A;  4RY2 A;  4DMY A;  2HHN A;  2HH5 A;  1PPN A;  2HXZ A;  3P5X A;  3F5V A;  1K3B B;  2FO5 A;  1AU0 A;  2DJG B;  3CBK A;  3N4C A;  3KWZ A;  2P86 A;  3P5U A;  2C0Y A;  1MS6 A;  3NHE A;  2BU3 A;  1KXR A;  1NPZ A;  3MOR A;  4OVZ A;  4W4U A;  2YJ9 A;  3RNV A;  4N4Z A;  1DEU A;  3IUT A;  4P16 A;  3H6S A;  3IMA A;  2DCB A;  2BDL A;  3ZUA A;  1Y08 A;  2FT2 A;  2GHU A;  1F2B A;  1THE A;  4D8I A;  1M6D A;  1NB5 A;  5J94 A;  4HXD B;  4MZS A;  4CDF B;  2NQA A;  1GEC E;  3IV2 A;  2Y6E A;  1FH0 A;  4YYU A;  5PAD A;  1AEC A;  3H8B A;  2XU1 A;  1PPD A;  3RVV A;  1STF E;  2HD5 A;  3B79 A;  1U9Q X;  2OUL A;  1EWP A;  3BBA A;  1TU6 A;  2J7Q C;  3F75 A;  1U5I A;  6PAD A;  1JQP A;  2JRI A;  3PRM A;  3BC3 A;  4XZX A;  2H7J A;  5JA7 A;  1CQD A;  1CS8 A;  3CH3 X;  2Y5B A;  2DZY A;  2CIO A;  2R9C A;  1EWL A;  1F2C A;  2PBH A;  1DKI A;  1ZCM A;  3E1Z B;  1F29 A;  5CVO B;  1U9X A;  3B21 A;  2UZJ A;  1PVJ A;  3S3Q A;  4YYQ A;  4PAD A;  4I07 A;  1X9Y A;  3K8U A;  8PCH A;  1NL6 A;  2J7Q A;  2FQ9 A;  3C0R A;  3CH2 X;  1KFX L;  5CHV A;  3MJ5 A;  3IOQ A;  2R6N A;  3ERV A;  3BOW A;  1U9W A;  7PCK A;  4IUM A;  1YVB A;  1DF0 A;  2PRE A;  1CB5 A;  1ME4 A;  2G6D A;  4N79 A;  4PP1 A;  2E03 A;  3OQC A;  3WXG A;  4A5U A;  4FK5 A;  3QJ3 A;  1YAL A;  1KFU L;  2DCD A;  3O0U A;  3BPM A;  1AYV A;  3BB7 A;  3I3T A;  3KWB X;  5CVM A;  2AU1 A;  2AGA A;  4MI7 A;  2E01 A;  3PDF A;  2GFO A;  4BSQ A;  2FYE A;  9PAP A;  4GUA A;  2AYO A;  2R9N A;  3KW9 A;  2F7D A;  2YJB A;  4XR7 A;  2XU3 A;  3K24 A;  3BY4 A;  1GLO A;  3O1G A;  4BQV A;  3D6S A;  2BDZ A;  1MEG A;  4YVA A;  1MHW A;  2DZZ A;  3USV A;  3CBJ A;  3IHP A;  4REZ A;  4XUI A;  1PBH A;  2JQF R;  4QRX A;  2FUD A;  4PT5 A;  4W5C A;  4OEM A;  3KX1 A;  4HWY A;  1PXV A;  4PI3 A;  2IBI A;  1YT7 A;  3H89 A;  4OW0 A;  1PPO A;  5A24 A;  1CSB B;  4IP3 A;  3BPF A;  3PSE A;  2YJ8 A;  2OZ2 A;  3HHI A;  3I06 A;  3ZNH A;  4WUR A;  1YZB A;  4BPV A;  2NQG A;  4W5B A;  4I04 A;  4QRV A;  3PBH A;  1AU3 A;  1F2A A;  5JZE A;  5EZS A;  4X6H A;  4RKX A;  2ARY A;  4YYW A;  2ATO A;  4RF0 A;  1HUC B;  2DC6 A;  2G7Y A;  2DCA A;  5F02 A;  1ZIV A;  5CHT A;  2AVW A;  3MTV A;  2NQD B;  1MDW A;  2FE8 A;  5EGW A;  2G8E A;  2PNS A;  3PHW A;  2E00 A;  3H8C A;  2XU5 A;  3OF9 A;  3S3R A;  1CTE A;  4RNA A;  1KHQ A;  3KFQ A;  3C9E A;  2DJF B;  1IWD A;  2VHF A;  1QXP A;  4FJC A;  2BTW A;  3PHU A;  2P7U A;  3RVX A;  1ME3 A;  4AXM A;  3WXE A;  3HHA A;  3QSD A;  2FRA A;  1CPJ A;  4QH6 A;  3KKU A;  1UKF A;  2WBF X;  2AS8 A;  4YYS A;  1EWM A;  4BOZ A;  2AYN A;  3PHX A;  3MHH A;  3PW3 A;  2O6X A;  4N8W A;  4MM3 B;  2P0R A;  3V6E A;  4YYR A;  2YJC A;  2XU4 A;  4BS5 A;  1ICF A;  1AU4 A;  2AUZ A;  4Q8G A;  1EF7 A;  1Q6K A;  4MZO A;  1PPP A;  3OVZ A;  3TRK A;  1MIR A;  2FTD A;  3K9M A;  3MHS A;  1BY8 A;  1YK7 A;  3U8E A;  4KLB A;  5FPW A;  3GCB A;  4I05 A;  3QT4 A;  4P6E A;  1EWO A;  2HWK A;  3E9S A;  1PAD A;  2PAD A;  4CZW A;  4G54 A;  4QRG A;  4D8B A;  4PP2 E;  1CVZ A;  2G8J A;  1GCB A;  1AYU A;  1GMY A;  3DF0 A;  2NQI A;  1TLO A;  4YYV A;  1TL9 A;  4K7C A;  2BTW B;  4MSX A;  4CDC B;  4BOU A;  4WA6 A;  3PT2 A;  2R9M A;  3LFY A;  3AI8 A;  1QMY A;  3W31 A;  4YV8 A;  1KHP A;  4X6J A;  1PCI A;  3HD3 A;  1NQC A;  4CDE B;  1NLJ A;  1O0E A;  2R9F A;  1BQI A;  1A6R A;  1CJL A;  5KO3 A;  1BP4 A;  3WXF A;  3N3K A;  1ITO A;  4BOQ A;  2B1M A;  1AU2 A;  3P5V A;  3M99 A;  4RF1 A;  3V6C A;  4BOS A;  1CV8 A;  3MP2 A;  2JTC A; 
#chains in the Genus database with same CATH homology
 2AIM A;  2JQG R;  4B55 A;  5JH3 A;  4BS6 A;  2DCC A;  1QDQ A;  3HWN A;  3PNR A;  1GX3 A;  2VHS A;  1NB3 A;  4DMX A;  2FRQ A;  4Q8H A;  1POP A;  1VJV A;  3TNX A;  4QBB A;  1SNK A;  1XKG A;  3H7D A;  1PIP A;  2F1G A;  2CB5 A;  3P5W A;  5EF4 A;  3LXS A;  4OEL A;  2E02 A;  2AUX A;  1MEM A;  2DC7 A;  5K16 A;  1SP4 B;  4ZUX U;  1AIM A;  3BCN A;  2IPP B;  4AXL A;  3OF8 A;  2ACT A;  1AYW A;  1Y4H A;  3KSE A;  3N3G A;  3OIS A;  1ATK A;  5CVN B;  3MTN A;  2DC8 A;  3OVX A;  1W5R A;  4CDD B;  2DC9 A;  3BWK A;  1S4V A;  2OP3 A;  3IEJ A;  1U9V A;  1VSN A;  2YJ2 A;  4FIP A;  4X6I A;  1BGO A;  2R9O A;  3RVW A;  1QOL A;  1YK8 A;  4P6G A;  2B1N A;  1PE6 A;  4RY2 A;  4DMY A;  2HHN A;  2HH5 A;  1PPN A;  2HXZ A;  3P5X A;  3F5V A;  1K3B B;  2FO5 A;  1AU0 A;  2DJG B;  3CBK A;  3N4C A;  3KWZ A;  2P86 A;  3P5U A;  2C0Y A;  1E2T A;  1MS6 A;  3NHE A;  1KXR A;  4W4U A;  1NPZ A;  3MOR A;  2YJ9 A;  4N4Z A;  1DEU A;  3IUT A;  3H6S A;  3IMA A;  4GUZ A;  2DCB A;  2BDL A;  3ZUA A;  1Y08 A;  2FT2 A;  2GHU A;  1F2B A;  1THE A;  1NB5 A;  1M6D A;  5J94 A;  4MZS A;  4CDF B;  2NQA A;  1GEC E;  3IV2 A;  2Y6E A;  1FH0 A;  4YYU A;  5PAD A;  1AEC A;  3H8B A;  2XU1 A;  1PPD A;  3RVV A;  1STF E;  2HD5 A;  3B79 A;  1U9Q X;  2OUL A;  1EWP A;  1TU6 A;  3F75 A;  1U5I A;  6PAD A;  1JQP A;  3BC3 A;  1W6F A;  2H7J A;  5JA7 A;  1CQD A;  1CS8 A;  3CH3 X;  2Y5B A;  2DZY A;  2CIO A;  2R9C A;  1EWL A;  1F2C A;  2PBH A;  1ZCM A;  3E1Z B;  1F29 A;  5CVO B;  1U9X A;  3S3Q A;  4YYQ A;  4PAD A;  4I07 A;  1X9Y A;  3K8U A;  8PCH A;  1NL6 A;  2FQ9 A;  3CH2 X;  1KFX L;  5CHV A;  3IOQ A;  2R6N A;  3ERV A;  3BOW A;  1U9W A;  7PCK A;  4C5P A;  1YVB A;  1DF0 A;  2PRE A;  1CB5 A;  1ME4 A;  2G6D A;  4N79 A;  4PP1 A;  2E03 A;  3WXG A;  4FK5 A;  3QJ3 A;  1YAL A;  1KFU L;  2DCD A;  3O0U A;  3BPM A;  1AYV A;  3D9W A;  3I3T A;  3KWB X;  5CVM A;  2AU1 A;  2E01 A;  3PDF A;  2GFO A;  4BSQ A;  2FYE A;  9PAP A;  2AYO A;  2R9N A;  3KW9 A;  2F7D A;  2YJB A;  4XR7 A;  2XU3 A;  3K24 A;  1GLO A;  3O1G A;  4BQV A;  3D6S A;  2BDZ A;  1MEG A;  4YVA A;  1MHW A;  3LTW A;  4NV8 A;  2DZZ A;  3USV A;  3CBJ A;  3IHP A;  4XUI A;  1PBH A;  2JQF R;  4QRX A;  2FUD A;  4W5C A;  4OEM A;  3KX1 A;  4HWY A;  1PXV A;  4PI3 A;  2IBI A;  1YT7 A;  3H89 A;  1PPO A;  5A24 A;  1CSB B;  3BPF A;  2YJ8 A;  2OZ2 A;  3HHI A;  3I06 A;  2VFC A;  4BPV A;  2NQG A;  4W5B A;  4I04 A;  4QRV A;  3PBH A;  1AU3 A;  1F2A A;  4X6H A;  2ARY A;  4YYW A;  2ATO A;  1HUC B;  2DC6 A;  2G7Y A;  2DCA A;  5F02 A;  1ZIV A;  5CHT A;  2AVW A;  2NQD B;  1MDW A;  5EGW A;  2G8E A;  2PNS A;  2E00 A;  3H8C A;  2XU5 A;  3OF9 A;  3S3R A;  1CTE A;  1KHQ A;  3KFQ A;  3C9E A;  2DJF B;  1IWD A;  2VHF A;  1QXP A;  4NV7 A;  4FJC A;  2P7U A;  3RVX A;  1ME3 A;  4AXM A;  3WXE A;  3HHA A;  3QSD A;  2FRA A;  1CPJ A;  4QH6 A;  3KKU A;  2WBF X;  2AS8 A;  4YYS A;  1EWM A;  2AYN A;  3MHH A;  3PW3 A;  2O6X A;  4N8W A;  2P0R A;  3V6E A;  4YYR A;  2YJC A;  2XU4 A;  4BS5 A;  1ICF A;  1AU4 A;  2AUZ A;  4Q8G A;  1EF7 A;  1Q6K A;  4MZO A;  1PPP A;  3OVZ A;  1MIR A;  2FTD A;  3K9M A;  3MHS A;  1BY8 A;  1YK7 A;  3U8E A;  4KLB A;  5FPW A;  4BGF A;  3GCB A;  4I05 A;  3QT4 A;  2BSZ A;  4P6E A;  1EWO A;  1PAD A;  2PAD A;  4CZW A;  4G54 A;  4QRG A;  4PP2 E;  1CVZ A;  2G8J A;  1GCB A;  1AYU A;  1GMY A;  3DF0 A;  2NQI A;  1TLO A;  4YYV A;  1TL9 A;  4K7C A;  1W4T A;  4MSX A;  4CDC B;  4WA6 A;  2R9M A;  3LFY A;  3AI8 A;  1QMY A;  4YV8 A;  1KHP A;  4X6J A;  1PCI A;  3HD3 A;  1NQC A;  4CDE B;  1NLJ A;  1O0E A;  2R9F A;  1BQI A;  1A6R A;  1CJL A;  1BP4 A;  3WXF A;  3N3K A;  2VFB A;  1ITO A;  2B1M A;  1AU2 A;  3P5V A;  3M99 A;  3V6C A;  1CV8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...