1NQCA

Crystal structures of cathepsin s inhibitor complexes
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
217
structure length
217
Chain Sequence
LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVTLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cathepsin S
publication title Specificity determinants of human cathepsin s revealed by crystal structures of complexes.
pubmed doi rcsb
total genus 69
structure length 217
sequence length 217
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2003-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1nqcA00
4QH6A 3V6CA 2Y5BA 1MEGA 2ATOA 3KKUA 1CTEA 4OELA 2OZ2A 3QJ3A 2NQIA 1NLJA 4PI3A 3MHSA 3M99A 1JQPA 1GECE 1HUCB 1F2BA 1AYUA 4QRVA 4XR7A 3GCBA 3F5VA 1QOLA 2DCBA 1MIRA 1YVBA 1DEUA 1X9YA 4XUIA 1YT7A 1GLOA 3IUTA 3RVWA 1U9VA 2DCDA 4MZSA 1M6DA 1PBHA 2DCCA 2DJGB 2AIMA 2YJ2A 1PADA 3PDFA 2NQAA 1TU6A 1SP4B 1THEA 3H7DA 3N3GA 3CH2X 1GCBA 2DZYA 1KXRA 5EGWA 4QRXA 2PREA 3BCNA 3D6SA 4WA6A 2XU4A 1F2CA 2B1NA 3RVVA 4MZOA 3AI8A 3BPMA 1MS6A 5PADA 5K16A 1Y08A 2P86A 3KWZA 4W4UA 3CBKA 2R9NA 4N4ZA 3PBHA 1EF7A 6PADA 2FRAA 3NHEA 3PW3A 2YJ9A 4PP2E 1F29A 4AXLA 4FJCA 1ZIVA 3KX1A 2DC9A 4CDDB 3IV2A 2IBIA 4YYVA 5J94A 3I06A 3TNXA 1NB3A 4X6HA 3DF0A 1PPNA 3OVZA 3N4CA 2JQGR 1KFUL 5F02A 3P5XA 8PCHA 3O0UA 3RVXA 1BGOA 1PPOA 1AECA 3BC3A 2DC8A 4OEMA 2G7YA 1AU3A 4BPVA 4PADA 3HWNA 3MHHA 4ZUXU 1ITOA 5EF4A 2DJFB 2WBFX 1EWLA 3MTNA 1BQIA 5CHVA 1CJLA 2NQDB 3IOQA 3K8UA 2VHFA 3B79A 2HD5A 1IWDA 1MDWA 1AU0A 4N8WA 1CQDA 2G8EA 3V6EA 1NB5A 2FQ9A 1CSBB 3HD3A 4PP1A 3LXSA 2AUXA 4YV8A 1AU2A 1TLOA 2AYOA 1PPDA 4YYQA 4BQVA 3KW9A 3HHAA 4AXMA 4YYWA 2AU1A 3BPFA 2XU3A 1XKGA 4CDCB 4BS6A 3CH3X 1EWOA 3KFQA 3KSEA 3F75A 1GMYA 2DCAA 3QT4A 1BY8A 3HHIA 3QSDA 5A24A 1DF0A 4FK5A 3KWBX 2G6DA 3H6SA 2AS8A 1F2AA 3H8CA 2FRQA 4QBBA 1MHWA 2FTDA 1PXVA 1VSNA 2YJBA 3P5VA 3H8BA 4MSXA 3E1ZB 4YYUA 1YALA 1QXPA 3H89A 2DC6A 1PIPA 1S4VA 2G8JA 3WXFA 2F1GA 2C0YA 1Y4HA 4X6IA 4FIPA 3PNRA 2CIOA 2AVWA 1KHPA 2FT2A 2FO5A 1SNKA 4Q8HA 4QRGA 1YK7A 2AYNA 4W5BA 1PCIA 1U9XA 2FUDA 4I05A 1ME3A 4W5CA 4KLBA 4BSQA 1CB5A 2BDZA 1KHQA 1TL9A 5CVNB 1STFE 3OF8A 1U5IA 2GHUA 2DZZA 2P0RA 2GFOA 3WXGA 2E01A 4CZWA 1CS8A 4CDFB 1QDQA 2OP3A 2OULA 1O0EA 1AYWA 2R9MA 1VJVA 2HH5A 4YYRA 3OISA 1U9QX 2O6XA 3S3QA 5JA7A 2PNSA 3K24A 1ATKA 3C9EA 2R6NA 1ZCMA 1MEMA 3CBJA 3OVXA 2P7UA 1KFXL 3U8EA 1U9WA 5CHTA 5FPWA 3OF9A 7PCKA 1PE6A 2R9FA 2DC7A 4X6JA 1ICFA 4G54A 4N79A 1K3BB 1PPPA 5CVOB 3O1GA 3IEJA 3WXEA 4YYSA 3IMAA 3BOWA 2BDLA 2F7DA 4RY2A 2HHNA 2E02A 3N3KA 3S3RA 2ACTA 1A6RA 1QMYA 2JQFR 3MORA 1EWPA 1NPZA 4YVAA 2CB5A 1CPJA 2IPPB 2R9OA 3LFYA 3P5WA 1BP4A 2H7JA 4BS5A 2YJ8A 2YJCA 2VHSA 4DMYA 9PAPA 2XU5A 3ZUAA 1CV8A 1CVZA 5CVMA 3USVA 1AIMA 2E03A 1Q6KA 4P6EA 2PADA 3BWKA 3IHPA 2NQGA 2AUZA 1EWMA 4Q8GA 3K9MA 2XU1A 2E00A 3P5UA 2HXZA 4I07A 1AYVA 1AU4A 4I04A 3I3TA 5JH3A 2R9CA 1YK8A 2B1MA 4P6GA 4K7CA 1FH0A 2PBHA 2ARYA 1POPA 4HWYA 2FYEA 4DMXA 3ERVA 1ME4A 2Y6EA 1NL6A 1NQCA 4CDEB
chains in the Genus database with same CATH superfamily
4QH6A 3V6CA 2AGAA 2Y5BA 4OW0A 1MEGA 2ATOA 3KKUA 1CTEA 4OELA 2OZ2A 3QJ3A 2NQIA 1NLJA 4PI3A 3MHSA 2J7QA 3M99A 1JQPA 1GECE 1HUCB 1F2BA 3C0RA 1AYUA 4QRVA 1DKIA 4REZA 4XR7A 3GCBA 3F5VA 1QOLA 2DCBA 1MIRA 1YVBA 4MM3B 1DEUA 1X9YA 4XUIA 1YT7A 1GLOA 3IUTA 3RVWA 1U9VA 2DCDA 4MZSA 3RNVA 1M6DA 1PBHA 2DCCA 2DJGB 2AIMA 2YJ2A 3PSEA 4RF0A 1PADA 3PDFA 2NQAA 1TU6A 2BTWA 1SP4B 1THEA 5JZEA 3H7DA 3N3GA 3CH2X 1GCBA 2DZYA 1KXRA 5EGWA 4PT5A 4QRXA 2PREA 3BCNA 3D6SA 4WA6A 2XU4A 1F2CA 2B1NA 3RVVA 4MZOA 3AI8A 3BPMA 1MS6A 5PADA 5K16A 1Y08A 2P86A 3KWZA 4W4UA 3CBKA 3BB7A 2R9NA 4N4ZA 3PBHA 1EF7A 6PADA 2FRAA 3NHEA 3PW3A 2YJ9A 4PP2E 1F29A 4AXLA 4FJCA 2HWKA 1ZIVA 3KX1A 2DC9A 4CDDB 3IV2A 2IBIA 4YYVA 5J94A 3I06A 4CDEB 3TNXA 4BOSA 2DOSA 1NB3A 4X6HA 3DF0A 1PPNA 3OVZA 3N4CA 2JQGR 1KFUL 5F02A 3P5XA 8PCHA 3O0UA 3TRKA 2BTWB 3RVXA 1BGOA 1PPOA 1AECA 3BC3A 4BOUA 2Z84A 2DC8A 4OEMA 2G7YA 1AU3A 4BPVA 4PADA 3HWNA 3MHHA 4ZUXU 1ITOA 5EF4A 2DJFB 2WBFX 1EWLA 3MTNA 1BQIA 5CHVA 1CJLA 2NQDB 3IOQA 3K8UA 2VHFA 3B79A 2HD5A 1IWDA 1MDWA 1AU0A 1UKFA 5KO3A 4N8WA 1CQDA 4OVZA 2G8EA 3V6EA 1NB5A 2FQ9A 1CSBB 3HD3A 4PP1A 3LXSA 2AUXA 3ZNHA 4BOPA 4YV8A 1AU2A 1TLOA 2AYOA 3W30A 1PPDA 4YYQA 4BQVA 3KW9A 3HHAA 4IP3A 4AXMA 4YYWA 4IUMA 2AU1A 3BPFA 2XU3A 1XKGA 4CDCB 1YZBA 3W31A 4BS6A 3OQCA 3CH3X 1EWOA 3KFQA 3KSEA 3F75A 2UZJA 1GMYA 2DCAA 3QT4A 1BY8A 3HHIA 3QSDA 5A24A 1DF0A 4FK5A 3KWBX 2G6DA 3H6SA 2AS8A 1F2AA 3H8CA 2FRQA 4QBBA 1MHWA 2FTDA 1PXVA 1VSNA 2YJBA 4MI7A 3P5VA 3H8BA 4MSXA 4GUAA 2FE8A 3E1ZB 4YYUA 1YALA 1QXPA 3H89A 2DC6A 1PIPA 1S4VA 2G8JA 3WXFA 2F1GA 3MJ5A 4D8IA 2C0YA 1Y4HA 4X6IA 4FIPA 3PNRA 2CIOA 5EZSA 2AVWA 1KHPA 3MP2A 2FT2A 2FO5A 1SNKA 4Q8HA 4QRGA 1YK7A 4OVZB 2AYNA 4W5BA 1PCIA 1U9XA 2FUDA 4I05A 1ME3A 4W5CA 4KLBA 2JTCA 4BSQA 4M0WA 3PHUA 1CB5A 2BDZA 1KHQA 1TL9A 5CVNB 4R3DA 1STFE 3OF8A 3BY4A 1U5IA 2GHUA 2DZZA 2P0RA 2GFOA 3WXGA 2E01A 4CZWA 1CS8A 4CDFB 1QDQA 2OP3A 2OULA 1O0EA 2J7QC 3PHWA 1AYWA 2R9MA 4RF1A 1VJVA 2HH5A 4YYRA 2BU3A 3OISA 1U9QX 2O6XA 3S3QA 5JA7A 3BBAA 2PNSA 3K24A 1ATKA 3C9EA 2R6NA 1ZCMA 1MEMA 3CBJA 3OVXA 2P7UA 1KFXL 3TMPA 3U8EA 1U9WA 4HXDB 5CHTA 5FPWA 3OF9A 7PCKA 5E6JA 1PE6A 4RNAA 1PVJA 2R9FA 3PRPA 2DC7A 4P16A 4X6JA 1ICFA 4G54A 4N79A 1K3BB 1PPPA 5CVOB 3O1GA 3IEJA 3WXEA 4YYSA 3IMAA 3BOWA 2BDLA 2F7DA 4RY2A 2HHNA 2E02A 3E9SA 3N3KA 3S3RA 2ACTA 4BOQA 4RKXA 1A6RA 3PHXA 1QMYA 2JQFR 3MORA 4D8BA 1EWPA 1NPZA 4YVAA 2CB5A 1CPJA 2IPPB 2R9OA 3LFYA 3P5WA 3IFUA 1BP4A 2H7JA 2JRIA 4BS5A 2YJ8A 2YJCA 2VHSA 4DMYA 9PAPA 2XU5A 3ZUAA 4ZTBA 1CV8A 5EZQA 1CVZA 5CVMA 3USVA 1AIMA 2E03A 1Q6KA 4P6EA 2PADA 3B21A 3BWKA 3IHPA 2NQGA 4D8EA 2AUZA 1EWMA 3PT2A 4Q8GA 3K9MA 3MTVA 4XZXA 2XU1A 2E00A 3P5UA 2HXZA 4I07A 1AYVA 4BOZA 1AU4A 4I04A 3I3TA 5JH3A 2R9CA 1YK8A 2B1MA 4P6GA 4K7CA 1FH0A 2PBHA 4WURA 2ARYA 1POPA 4HWYA 2FYEA 4A5UA 4DMXA 3ERVA 1ME4A 3O65A 2Y6EA 1NL6A 1NQCA 3PRMA
chains in the Genus database with same CATH topology
4QH6A 3V6CA 2Y5BA 1MEGA 2ATOA 3KKUA 1CTEA 4OELA 2OZ2A 3QJ3A 2NQIA 1NLJA 4PI3A 3MHSA 3M99A 1JQPA 1GECE 2VFCA 1HUCB 1F2BA 1AYUA 4QRVA 4XR7A 3GCBA 3F5VA 1QOLA 2DCBA 1MIRA 1YVBA 1DEUA 1X9YA 4XUIA 1YT7A 1GLOA 3IUTA 3RVWA 1U9VA 2DCDA 4MZSA 1M6DA 1PBHA 2DCCA 2DJGB 2AIMA 2YJ2A 1PADA 3PDFA 2NQAA 1TU6A 1SP4B 1THEA 4B55A 3H7DA 3N3GA 3CH2X 1GCBA 2DZYA 1KXRA 5EGWA 4QRXA 2PREA 3BCNA 3D6SA 4WA6A 2XU4A 1F2CA 2B1NA 3RVVA 4MZOA 3AI8A 3BPMA 1MS6A 5PADA 5K16A 1Y08A 2P86A 3KWZA 4W4UA 3CBKA 2R9NA 4N4ZA 3PBHA 1EF7A 6PADA 2FRAA 3NHEA 3PW3A 2YJ9A 4PP2E 1F29A 4AXLA 4FJCA 1ZIVA 3KX1A 2DC9A 4NV8A 4CDDB 3IV2A 2IBIA 4YYVA 5J94A 3I06A 3TNXA 1NB3A 4X6HA 3DF0A 1PPNA 3OVZA 3N4CA 2JQGR 1KFUL 5F02A 3P5XA 8PCHA 3O0UA 1GX3A 3D9WA 3RVXA 1BGOA 1PPOA 1AECA 3BC3A 2DC8A 4OEMA 2G7YA 1AU3A 4BPVA 4PADA 3HWNA 3MHHA 4ZUXU 1ITOA 5EF4A 2DJFB 1W5RA 2WBFX 1EWLA 3MTNA 1BQIA 5CHVA 1CJLA 2NQDB 3IOQA 3K8UA 2VHFA 3B79A 2HD5A 1IWDA 1MDWA 1AU0A 4N8WA 1CQDA 2G8EA 3V6EA 1NB5A 2FQ9A 1CSBB 3HD3A 4PP1A 3LXSA 2AUXA 1W4TA 4YV8A 1AU2A 1TLOA 2AYOA 1PPDA 4YYQA 4BQVA 3KW9A 3HHAA 4AXMA 4YYWA 4GUZA 2AU1A 3BPFA 2XU3A 1XKGA 4CDCB 4BS6A 3CH3X 1EWOA 3KFQA 3KSEA 3F75A 1GMYA 2DCAA 3QT4A 1BY8A 3HHIA 3QSDA 5A24A 1DF0A 4FK5A 3KWBX 2G6DA 3H6SA 2AS8A 2BSZA 1F2AA 4NV7A 3H8CA 2FRQA 4QBBA 1MHWA 2FTDA 1PXVA 1VSNA 2YJBA 3P5VA 3H8BA 4MSXA 3E1ZB 4YYUA 1YALA 1QXPA 3H89A 2DC6A 1PIPA 1S4VA 2G8JA 3WXFA 2F1GA 2C0YA 1Y4HA 4X6IA 4FIPA 3PNRA 2CIOA 2AVWA 1KHPA 2FT2A 2FO5A 1SNKA 4Q8HA 4QRGA 1YK7A 2AYNA 4W5BA 1PCIA 1U9XA 2FUDA 4I05A 1ME3A 4W5CA 4KLBA 4BSQA 1CB5A 2BDZA 1KHQA 1TL9A 5CVNB 1STFE 3OF8A 1U5IA 2GHUA 2DZZA 2P0RA 4BGFA 2GFOA 3WXGA 2E01A 4CZWA 1CS8A 4CDFB 1QDQA 1W6FA 2OP3A 2OULA 1O0EA 1AYWA 2R9MA 1VJVA 2HH5A 4YYRA 3OISA 1U9QX 2O6XA 3S3QA 5JA7A 2PNSA 3K24A 1ATKA 3C9EA 2R6NA 1ZCMA 1MEMA 3CBJA 3OVXA 2P7UA 1KFXL 3U8EA 1U9WA 5CHTA 5FPWA 3OF9A 7PCKA 1PE6A 2R9FA 2DC7A 4X6JA 1ICFA 4G54A 4N79A 1K3BB 1PPPA 5CVOB 3O1GA 3IEJA 3WXEA 4YYSA 3IMAA 3LTWA 3BOWA 2BDLA 2F7DA 4RY2A 2HHNA 2E02A 3N3KA 3S3RA 2ACTA 1A6RA 1QMYA 2JQFR 3MORA 1EWPA 1NPZA 4YVAA 2CB5A 1CPJA 2IPPB 2R9OA 3LFYA 3P5WA 1BP4A 2H7JA 4BS5A 2YJ8A 2YJCA 2VHSA 4DMYA 9PAPA 2XU5A 3ZUAA 1CV8A 1CVZA 5CVMA 3USVA 1AIMA 2E03A 1Q6KA 4P6EA 2PADA 3BWKA 3IHPA 2NQGA 1E2TA 2AUZA 1EWMA 4C5PA 4Q8GA 3K9MA 2XU1A 2E00A 3P5UA 2HXZA 4I07A 1AYVA 1AU4A 4I04A 3I3TA 5JH3A 2R9CA 1YK8A 2B1MA 4P6GA 4K7CA 1FH0A 2PBHA 2ARYA 1POPA 4HWYA 2FYEA 2VFBA 4DMXA 3ERVA 1ME4A 2Y6EA 1NL6A 1NQCA 4CDEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QH6 A;  3V6C A;  2Y5B A;  1MEG A;  2ATO A;  3KKU A;  1CTE A;  4OEL A;  2OZ2 A;  3QJ3 A;  2NQI A;  1NLJ A;  4PI3 A;  3MHS A;  3M99 A;  1JQP A;  1GEC E;  1HUC B;  1F2B A;  1AYU A;  4QRV A;  4XR7 A;  3GCB A;  3F5V A;  1QOL A;  2DCB A;  1MIR A;  1YVB A;  1DEU A;  1X9Y A;  4XUI A;  1YT7 A;  1GLO A;  3IUT A;  3RVW A;  1U9V A;  2DCD A;  4MZS A;  1M6D A;  1PBH A;  2DCC A;  2DJG B;  2AIM A;  2YJ2 A;  1PAD A;  3PDF A;  2NQA A;  1TU6 A;  1SP4 B;  1THE A;  3H7D A;  3N3G A;  3CH2 X;  1GCB A;  2DZY A;  1KXR A;  5EGW A;  4QRX A;  2PRE A;  3BCN A;  3D6S A;  4WA6 A;  2XU4 A;  1F2C A;  2B1N A;  3RVV A;  4MZO A;  3AI8 A;  3BPM A;  1MS6 A;  5PAD A;  5K16 A;  1Y08 A;  2P86 A;  3KWZ A;  4W4U A;  3CBK A;  2R9N A;  4N4Z A;  3PBH A;  1EF7 A;  6PAD A;  2FRA A;  3NHE A;  3PW3 A;  2YJ9 A;  4PP2 E;  1F29 A;  4AXL A;  4FJC A;  1ZIV A;  3KX1 A;  2DC9 A;  4CDD B;  3IV2 A;  2IBI A;  4YYV A;  5J94 A;  3I06 A;  3TNX A;  1NB3 A;  4X6H A;  3DF0 A;  1PPN A;  3OVZ A;  3N4C A;  2JQG R;  1KFU L;  5F02 A;  3P5X A;  8PCH A;  3O0U A;  3RVX A;  1BGO A;  1PPO A;  1AEC A;  3BC3 A;  2DC8 A;  4OEM A;  2G7Y A;  1AU3 A;  4BPV A;  4PAD A;  3HWN A;  3MHH A;  4ZUX U;  1ITO A;  5EF4 A;  2DJF B;  2WBF X;  1EWL A;  3MTN A;  1BQI A;  5CHV A;  1CJL A;  2NQD B;  3IOQ A;  3K8U A;  2VHF A;  3B79 A;  2HD5 A;  1IWD A;  1MDW A;  1AU0 A;  4N8W A;  1CQD A;  2G8E A;  3V6E A;  1NB5 A;  2FQ9 A;  1CSB B;  3HD3 A;  4PP1 A;  3LXS A;  2AUX A;  4YV8 A;  1AU2 A;  1TLO A;  2AYO A;  1PPD A;  4YYQ A;  4BQV A;  3KW9 A;  3HHA A;  4AXM A;  4YYW A;  2AU1 A;  3BPF A;  2XU3 A;  1XKG A;  4CDC B;  4BS6 A;  3CH3 X;  1EWO A;  3KFQ A;  3KSE A;  3F75 A;  1GMY A;  2DCA A;  3QT4 A;  1BY8 A;  3HHI A;  3QSD A;  5A24 A;  1DF0 A;  4FK5 A;  3KWB X;  2G6D A;  3H6S A;  2AS8 A;  1F2A A;  3H8C A;  2FRQ A;  4QBB A;  1MHW A;  2FTD A;  1PXV A;  1VSN A;  2YJB A;  3P5V A;  3H8B A;  4MSX A;  3E1Z B;  4YYU A;  1YAL A;  1QXP A;  3H89 A;  2DC6 A;  1PIP A;  1S4V A;  2G8J A;  3WXF A;  2F1G A;  2C0Y A;  1Y4H A;  4X6I A;  4FIP A;  3PNR A;  2CIO A;  2AVW A;  1KHP A;  2FT2 A;  2FO5 A;  1SNK A;  4Q8H A;  4QRG A;  1YK7 A;  2AYN A;  4W5B A;  1PCI A;  1U9X A;  2FUD A;  4I05 A;  1ME3 A;  4W5C A;  4KLB A;  4BSQ A;  1CB5 A;  2BDZ A;  1KHQ A;  1TL9 A;  5CVN B;  1STF E;  3OF8 A;  1U5I A;  2GHU A;  2DZZ A;  2P0R A;  2GFO A;  3WXG A;  2E01 A;  4CZW A;  1CS8 A;  4CDF B;  1QDQ A;  2OP3 A;  2OUL A;  1O0E A;  1AYW A;  2R9M A;  1VJV A;  2HH5 A;  4YYR A;  3OIS A;  1U9Q X;  2O6X A;  3S3Q A;  5JA7 A;  2PNS A;  3K24 A;  1ATK A;  3C9E A;  2R6N A;  1ZCM A;  1MEM A;  3CBJ A;  3OVX A;  2P7U A;  1KFX L;  3U8E A;  1U9W A;  5CHT A;  5FPW A;  3OF9 A;  7PCK A;  1PE6 A;  2R9F A;  2DC7 A;  4X6J A;  1ICF A;  4G54 A;  4N79 A;  1K3B B;  1PPP A;  5CVO B;  3O1G A;  3IEJ A;  3WXE A;  4YYS A;  3IMA A;  3BOW A;  2BDL A;  2F7D A;  4RY2 A;  2HHN A;  2E02 A;  3N3K A;  3S3R A;  2ACT A;  1A6R A;  1QMY A;  2JQF R;  3MOR A;  1EWP A;  1NPZ A;  4YVA A;  2CB5 A;  1CPJ A;  2IPP B;  2R9O A;  3LFY A;  3P5W A;  1BP4 A;  2H7J A;  4BS5 A;  2YJ8 A;  2YJC A;  2VHS A;  4DMY A;  9PAP A;  2XU5 A;  3ZUA A;  1CV8 A;  1CVZ A;  5CVM A;  3USV A;  1AIM A;  2E03 A;  1Q6K A;  4P6E A;  2PAD A;  3BWK A;  3IHP A;  2NQG A;  2AUZ A;  1EWM A;  4Q8G A;  3K9M A;  2XU1 A;  2E00 A;  3P5U A;  2HXZ A;  4I07 A;  1AYV A;  1AU4 A;  4I04 A;  3I3T A;  5JH3 A;  2R9C A;  1YK8 A;  2B1M A;  4P6G A;  4K7C A;  1FH0 A;  2PBH A;  2ARY A;  1POP A;  4HWY A;  2FYE A;  4DMX A;  3ERV A;  1ME4 A;  2Y6E A;  1NL6 A;  1NQC A;  4CDE B; 
#chains in the Genus database with same CATH topology
 4QH6 A;  3V6C A;  2AGA A;  2Y5B A;  4OW0 A;  1MEG A;  2ATO A;  3KKU A;  1CTE A;  4OEL A;  2OZ2 A;  3QJ3 A;  2NQI A;  1NLJ A;  4PI3 A;  3MHS A;  2J7Q A;  3M99 A;  1JQP A;  1GEC E;  1HUC B;  1F2B A;  3C0R A;  1AYU A;  4QRV A;  1DKI A;  4REZ A;  4XR7 A;  3GCB A;  3F5V A;  1QOL A;  2DCB A;  1MIR A;  1YVB A;  4MM3 B;  1DEU A;  1X9Y A;  4XUI A;  1YT7 A;  1GLO A;  3IUT A;  3RVW A;  1U9V A;  2DCD A;  4MZS A;  3RNV A;  1M6D A;  1PBH A;  2DCC A;  2DJG B;  2AIM A;  2YJ2 A;  3PSE A;  4RF0 A;  1PAD A;  3PDF A;  2NQA A;  1TU6 A;  2BTW A;  1SP4 B;  1THE A;  5JZE A;  3H7D A;  3N3G A;  3CH2 X;  1GCB A;  2DZY A;  1KXR A;  5EGW A;  4PT5 A;  4QRX A;  2PRE A;  3BCN A;  3D6S A;  4WA6 A;  2XU4 A;  1F2C A;  2B1N A;  3RVV A;  4MZO A;  3AI8 A;  3BPM A;  1MS6 A;  5PAD A;  5K16 A;  1Y08 A;  2P86 A;  3KWZ A;  4W4U A;  3CBK A;  3BB7 A;  2R9N A;  4N4Z A;  3PBH A;  1EF7 A;  6PAD A;  2FRA A;  3NHE A;  3PW3 A;  2YJ9 A;  4PP2 E;  1F29 A;  4AXL A;  4FJC A;  2HWK A;  1ZIV A;  3KX1 A;  2DC9 A;  4CDD B;  3IV2 A;  2IBI A;  4YYV A;  5J94 A;  3I06 A;  4CDE B;  3TNX A;  4BOS A;  2DOS A;  1NB3 A;  4X6H A;  3DF0 A;  1PPN A;  3OVZ A;  3N4C A;  2JQG R;  1KFU L;  5F02 A;  3P5X A;  8PCH A;  3O0U A;  3TRK A;  2BTW B;  3RVX A;  1BGO A;  1PPO A;  1AEC A;  3BC3 A;  4BOU A;  2Z84 A;  2DC8 A;  4OEM A;  2G7Y A;  1AU3 A;  4BPV A;  4PAD A;  3HWN A;  3MHH A;  4ZUX U;  1ITO A;  5EF4 A;  2DJF B;  2WBF X;  1EWL A;  3MTN A;  1BQI A;  5CHV A;  1CJL A;  2NQD B;  3IOQ A;  3K8U A;  2VHF A;  3B79 A;  2HD5 A;  1IWD A;  1MDW A;  1AU0 A;  1UKF A;  5KO3 A;  4N8W A;  1CQD A;  4OVZ A;  2G8E A;  3V6E A;  1NB5 A;  2FQ9 A;  1CSB B;  3HD3 A;  4PP1 A;  3LXS A;  2AUX A;  3ZNH A;  4BOP A;  4YV8 A;  1AU2 A;  1TLO A;  2AYO A;  3W30 A;  1PPD A;  4YYQ A;  4BQV A;  3KW9 A;  3HHA A;  4IP3 A;  4AXM A;  4YYW A;  4IUM A;  2AU1 A;  3BPF A;  2XU3 A;  1XKG A;  4CDC B;  1YZB A;  3W31 A;  4BS6 A;  3OQC A;  3CH3 X;  1EWO A;  3KFQ A;  3KSE A;  3F75 A;  2UZJ A;  1GMY A;  2DCA A;  3QT4 A;  1BY8 A;  3HHI A;  3QSD A;  5A24 A;  1DF0 A;  4FK5 A;  3KWB X;  2G6D A;  3H6S A;  2AS8 A;  1F2A A;  3H8C A;  2FRQ A;  4QBB A;  1MHW A;  2FTD A;  1PXV A;  1VSN A;  2YJB A;  4MI7 A;  3P5V A;  3H8B A;  4MSX A;  4GUA A;  2FE8 A;  3E1Z B;  4YYU A;  1YAL A;  1QXP A;  3H89 A;  2DC6 A;  1PIP A;  1S4V A;  2G8J A;  3WXF A;  2F1G A;  3MJ5 A;  4D8I A;  2C0Y A;  1Y4H A;  4X6I A;  4FIP A;  3PNR A;  2CIO A;  5EZS A;  2AVW A;  1KHP A;  3MP2 A;  2FT2 A;  2FO5 A;  1SNK A;  4Q8H A;  4QRG A;  1YK7 A;  4OVZ B;  2AYN A;  4W5B A;  1PCI A;  1U9X A;  2FUD A;  4I05 A;  1ME3 A;  4W5C A;  4KLB A;  2JTC A;  4BSQ A;  4M0W A;  3PHU A;  1CB5 A;  2BDZ A;  1KHQ A;  1TL9 A;  5CVN B;  4R3D A;  1STF E;  3OF8 A;  3BY4 A;  1U5I A;  2GHU A;  2DZZ A;  2P0R A;  2GFO A;  3WXG A;  2E01 A;  4CZW A;  1CS8 A;  4CDF B;  1QDQ A;  2OP3 A;  2OUL A;  1O0E A;  2J7Q C;  3PHW A;  1AYW A;  2R9M A;  4RF1 A;  1VJV A;  2HH5 A;  4YYR A;  2BU3 A;  3OIS A;  1U9Q X;  2O6X A;  3S3Q A;  5JA7 A;  3BBA A;  2PNS A;  3K24 A;  1ATK A;  3C9E A;  2R6N A;  1ZCM A;  1MEM A;  3CBJ A;  3OVX A;  2P7U A;  1KFX L;  3TMP A;  3U8E A;  1U9W A;  4HXD B;  5CHT A;  5FPW A;  3OF9 A;  7PCK A;  5E6J A;  1PE6 A;  4RNA A;  1PVJ A;  2R9F A;  3PRP A;  2DC7 A;  4P16 A;  4X6J A;  1ICF A;  4G54 A;  4N79 A;  1K3B B;  1PPP A;  5CVO B;  3O1G A;  3IEJ A;  3WXE A;  4YYS A;  3IMA A;  3BOW A;  2BDL A;  2F7D A;  4RY2 A;  2HHN A;  2E02 A;  3E9S A;  3N3K A;  3S3R A;  2ACT A;  4BOQ A;  4RKX A;  1A6R A;  3PHX A;  1QMY A;  2JQF R;  3MOR A;  4D8B A;  1EWP A;  1NPZ A;  4YVA A;  2CB5 A;  1CPJ A;  2IPP B;  2R9O A;  3LFY A;  3P5W A;  3IFU A;  1BP4 A;  2H7J A;  2JRI A;  4BS5 A;  2YJ8 A;  2YJC A;  2VHS A;  4DMY A;  9PAP A;  2XU5 A;  3ZUA A;  4ZTB A;  1CV8 A;  5EZQ A;  1CVZ A;  5CVM A;  3USV A;  1AIM A;  2E03 A;  1Q6K A;  4P6E A;  2PAD A;  3B21 A;  3BWK A;  3IHP A;  2NQG A;  4D8E A;  2AUZ A;  1EWM A;  3PT2 A;  4Q8G A;  3K9M A;  3MTV A;  4XZX A;  2XU1 A;  2E00 A;  3P5U A;  2HXZ A;  4I07 A;  1AYV A;  4BOZ A;  1AU4 A;  4I04 A;  3I3T A;  5JH3 A;  2R9C A;  1YK8 A;  2B1M A;  4P6G A;  4K7C A;  1FH0 A;  2PBH A;  4WUR A;  2ARY A;  1POP A;  4HWY A;  2FYE A;  4A5U A;  4DMX A;  3ERV A;  1ME4 A;  3O65 A;  2Y6E A;  1NL6 A;  1NQC A;  3PRM A; 
#chains in the Genus database with same CATH homology
 4QH6 A;  3V6C A;  2Y5B A;  1MEG A;  2ATO A;  3KKU A;  1CTE A;  4OEL A;  2OZ2 A;  3QJ3 A;  2NQI A;  1NLJ A;  4PI3 A;  3MHS A;  3M99 A;  1JQP A;  1GEC E;  2VFC A;  1HUC B;  1F2B A;  1AYU A;  4QRV A;  4XR7 A;  3GCB A;  3F5V A;  1QOL A;  2DCB A;  1MIR A;  1YVB A;  1DEU A;  1X9Y A;  4XUI A;  1YT7 A;  1GLO A;  3IUT A;  3RVW A;  1U9V A;  2DCD A;  4MZS A;  1M6D A;  1PBH A;  2DCC A;  2DJG B;  2AIM A;  2YJ2 A;  1PAD A;  3PDF A;  2NQA A;  1TU6 A;  1SP4 B;  1THE A;  4B55 A;  3H7D A;  3N3G A;  3CH2 X;  1GCB A;  2DZY A;  1KXR A;  5EGW A;  4QRX A;  2PRE A;  3BCN A;  3D6S A;  4WA6 A;  2XU4 A;  1F2C A;  2B1N A;  3RVV A;  4MZO A;  3AI8 A;  3BPM A;  1MS6 A;  5PAD A;  5K16 A;  1Y08 A;  2P86 A;  3KWZ A;  4W4U A;  3CBK A;  2R9N A;  4N4Z A;  3PBH A;  1EF7 A;  6PAD A;  2FRA A;  3NHE A;  3PW3 A;  2YJ9 A;  4PP2 E;  1F29 A;  4AXL A;  4FJC A;  1ZIV A;  3KX1 A;  2DC9 A;  4NV8 A;  4CDD B;  3IV2 A;  2IBI A;  4YYV A;  5J94 A;  3I06 A;  3TNX A;  1NB3 A;  4X6H A;  3DF0 A;  1PPN A;  3OVZ A;  3N4C A;  2JQG R;  1KFU L;  5F02 A;  3P5X A;  8PCH A;  3O0U A;  1GX3 A;  3D9W A;  3RVX A;  1BGO A;  1PPO A;  1AEC A;  3BC3 A;  2DC8 A;  4OEM A;  2G7Y A;  1AU3 A;  4BPV A;  4PAD A;  3HWN A;  3MHH A;  4ZUX U;  1ITO A;  5EF4 A;  2DJF B;  1W5R A;  2WBF X;  1EWL A;  3MTN A;  1BQI A;  5CHV A;  1CJL A;  2NQD B;  3IOQ A;  3K8U A;  2VHF A;  3B79 A;  2HD5 A;  1IWD A;  1MDW A;  1AU0 A;  4N8W A;  1CQD A;  2G8E A;  3V6E A;  1NB5 A;  2FQ9 A;  1CSB B;  3HD3 A;  4PP1 A;  3LXS A;  2AUX A;  1W4T A;  4YV8 A;  1AU2 A;  1TLO A;  2AYO A;  1PPD A;  4YYQ A;  4BQV A;  3KW9 A;  3HHA A;  4AXM A;  4YYW A;  4GUZ A;  2AU1 A;  3BPF A;  2XU3 A;  1XKG A;  4CDC B;  4BS6 A;  3CH3 X;  1EWO A;  3KFQ A;  3KSE A;  3F75 A;  1GMY A;  2DCA A;  3QT4 A;  1BY8 A;  3HHI A;  3QSD A;  5A24 A;  1DF0 A;  4FK5 A;  3KWB X;  2G6D A;  3H6S A;  2AS8 A;  2BSZ A;  1F2A A;  4NV7 A;  3H8C A;  2FRQ A;  4QBB A;  1MHW A;  2FTD A;  1PXV A;  1VSN A;  2YJB A;  3P5V A;  3H8B A;  4MSX A;  3E1Z B;  4YYU A;  1YAL A;  1QXP A;  3H89 A;  2DC6 A;  1PIP A;  1S4V A;  2G8J A;  3WXF A;  2F1G A;  2C0Y A;  1Y4H A;  4X6I A;  4FIP A;  3PNR A;  2CIO A;  2AVW A;  1KHP A;  2FT2 A;  2FO5 A;  1SNK A;  4Q8H A;  4QRG A;  1YK7 A;  2AYN A;  4W5B A;  1PCI A;  1U9X A;  2FUD A;  4I05 A;  1ME3 A;  4W5C A;  4KLB A;  4BSQ A;  1CB5 A;  2BDZ A;  1KHQ A;  1TL9 A;  5CVN B;  1STF E;  3OF8 A;  1U5I A;  2GHU A;  2DZZ A;  2P0R A;  4BGF A;  2GFO A;  3WXG A;  2E01 A;  4CZW A;  1CS8 A;  4CDF B;  1QDQ A;  1W6F A;  2OP3 A;  2OUL A;  1O0E A;  1AYW A;  2R9M A;  1VJV A;  2HH5 A;  4YYR A;  3OIS A;  1U9Q X;  2O6X A;  3S3Q A;  5JA7 A;  2PNS A;  3K24 A;  1ATK A;  3C9E A;  2R6N A;  1ZCM A;  1MEM A;  3CBJ A;  3OVX A;  2P7U A;  1KFX L;  3U8E A;  1U9W A;  5CHT A;  5FPW A;  3OF9 A;  7PCK A;  1PE6 A;  2R9F A;  2DC7 A;  4X6J A;  1ICF A;  4G54 A;  4N79 A;  1K3B B;  1PPP A;  5CVO B;  3O1G A;  3IEJ A;  3WXE A;  4YYS A;  3IMA A;  3LTW A;  3BOW A;  2BDL A;  2F7D A;  4RY2 A;  2HHN A;  2E02 A;  3N3K A;  3S3R A;  2ACT A;  1A6R A;  1QMY A;  2JQF R;  3MOR A;  1EWP A;  1NPZ A;  4YVA A;  2CB5 A;  1CPJ A;  2IPP B;  2R9O A;  3LFY A;  3P5W A;  1BP4 A;  2H7J A;  4BS5 A;  2YJ8 A;  2YJC A;  2VHS A;  4DMY A;  9PAP A;  2XU5 A;  3ZUA A;  1CV8 A;  1CVZ A;  5CVM A;  3USV A;  1AIM A;  2E03 A;  1Q6K A;  4P6E A;  2PAD A;  3BWK A;  3IHP A;  2NQG A;  1E2T A;  2AUZ A;  1EWM A;  4C5P A;  4Q8G A;  3K9M A;  2XU1 A;  2E00 A;  3P5U A;  2HXZ A;  4I07 A;  1AYV A;  1AU4 A;  4I04 A;  3I3T A;  5JH3 A;  2R9C A;  1YK8 A;  2B1M A;  4P6G A;  4K7C A;  1FH0 A;  2PBH A;  2ARY A;  1POP A;  4HWY A;  2FYE A;  2VFB A;  4DMX A;  3ERV A;  1ME4 A;  2Y6E A;  1NL6 A;  1NQC A;  4CDE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...