1PIPA

Crystal structure of papain-succinyl-gln-val-val-ala-ala-p-nitroanilide complex at 1.7 angstroms resolution: noncovalent binding mode of a common sequence of endogenous thiol protease inhibitors
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
212
structure length
212
Chain Sequence
IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNQYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNQGALLYSIANQPVSVVLQAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of papain-succinyl-Gln-Val-Val-Ala-Ala-p-nitroanilide complex at 1.7-A resolution: noncovalent binding mode of a common sequence of endogenous thiol protease inhibitors.
pubmed doi rcsb
source organism Carica papaya
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PAPAIN
total genus 66
structure length 212
sequence length 212
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 1992-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1pipA00
3I06A 1S4VA 2NQIA 3K9MA 2P7UA 5A24A 3LFYA 2ATOA 2DC8A 3S3RA 2E02A 3D6SA 3QT4A 2XU4A 2GFOA 3PDFA 1GCBA 5K16A 2DJFB 1KFUL 1CB5A 1CTEA 1SNKA 2OULA 1GLOA 4YYWA 1CVZA 1A6RA 1YK8A 1POPA 1F2CA 4PP2E 4QH6A 2XU5A 1MEMA 1F2AA 2FT2A 2B1NA 2JQFR 4ZUXU 2OP3A 2DC7A 1CSBB 4QRVA 2IBIA 8PCHA 1AU2A 3TNXA 1PCIA 3LXSA 3KFQA 1ICFA 1KXRA 3CBKA 3KSEA 1QXPA 4P6GA 1CS8A 2P0RA 5F02A 1NLJA 3DF0A 4CDFB 2G6DA 3WXFA 3BPFA 2DCAA 1DF0A 3KW9A 5JA7A 4YYUA 3OISA 4CZWA 2Y6EA 1K3BB 1PADA 2DC9A 4I07A 4QBBA 3BPMA 4YYSA 1X9YA 4YYQA 1JQPA 4X6JA 3KWBX 1O0EA 3OF8A 3H6SA 2IPPB 1CV8A 1AU0A 2DZZA 3N4CA 4FK5A 1M6DA 2CB5A 3O0UA 1VSNA 3MHHA 1Y08A 4PADA 1MIRA 2YJ2A 2ARYA 3H8BA 1AIMA 3MHSA 3B79A 4P6EA 1U5IA 2Y5BA 3NHEA 2P86A 5JH3A 1IWDA 2HHNA 3F75A 3N3GA 1EWLA 1U9QX 4W5BA 1KHPA 2FQ9A 4G54A 3CBJA 2YJCA 1PPPA 1AU4A 4Q8GA 1PPNA 6PADA 1YALA 3U8EA 2DCCA 2O6XA 1EWOA 2AYOA 1DEUA 4BPVA 3GCBA 1U9WA 3P5VA 4MSXA 3WXGA 4PI3A 2G7YA 1YVBA 4YVAA 4CDCB 4CDDB 3E1ZB 1YT7A 4W5CA 2XU1A 1AYUA 4X6HA 1AYWA 5CVMA 1NPZA 4OELA 1THEA 4I04A 4BS6A 4XR7A 2DC6A 1QOLA 4YV8A 1CQDA 2HXZA 4DMXA 1FH0A 2BDZA 3F5VA 1U9XA 2AUZA 2R9MA 2DCBA 4KLBA 1GECE 1NB3A 1MHWA 3KKUA 4YYRA 5CHTA 3USVA 3IUTA 3IMAA 2FRAA 2PNSA 1NB5A 3OVZA 5FPWA 3BOWA 3RVWA 3HHAA 4CDEB 4FIPA 2FYEA 2R9CA 2XU3A 1CPJA 3CH3X 4BQVA 1CJLA 3M99A 2NQGA 4N8WA 1BQIA 2NQAA 2PADA 3HHIA 1EWMA 2PBHA 3O1GA 3H7DA 2R6NA 3BC3A 1TLOA 3ERVA 1BP4A 4QRXA 1AU3A 3P5UA 3H8CA 5PADA 3HWNA 3QJ3A 2WBFX 1PE6A 2ACTA 1AECA 2R9NA 1PXVA 2NQDB 1YK7A 3RVVA 1TL9A 2BDLA 3IEJA 2AYNA 3HD3A 2DCDA 4W4UA 2AIMA 3IHPA 3OF9A 2G8JA 3P5XA 1EF7A 4Q8HA 2DJGB 2F1GA 3KWZA 2OZ2A 3N3KA 3PNRA 3K24A 4HWYA 2AUXA 1XKGA 1NL6A 4OEMA 3H89A 1ZIVA 2C0YA 1QMYA 3K8UA 2G8EA 3BWKA 2AU1A 1MS6A 4K7CA 2JQGR 2YJ9A 4RY2A 3I3TA 1HUCB 2PREA 1Q6KA 1ITOA 1GMYA 4N4ZA 3CH2X 1SP4B 2FTDA 3BCNA 5J94A 1Y4HA 4AXMA 4MZSA 1ZCMA 4I05A 3MORA 4MZOA 2R9FA 1PBHA 4DMYA 3MTNA 4WA6A 3RVXA 2VHFA 2E03A 2YJ8A 2R9OA 1MEGA 2VHSA 4FJCA 3IOQA 4PP1A 4BS5A 2HH5A 4QRGA 1KHQA 1ATKA 1TU6A 3V6EA 1AYVA 3C9EA 2AS8A 2GHUA 1F2BA 3S3QA 3P5WA 4N79A 2CIOA 1PPDA 2B1MA 3KX1A 3QSDA 1PIPA 3V6CA 7PCKA 1NQCA 2F7DA 3PW3A 1VJVA 4AXLA 2FO5A 3IV2A 2AVWA 4X6IA 2YJBA 9PAPA 1ME4A 3ZUAA 1STFE 4BSQA 3PBHA 1ME3A 2H7JA 4XUIA 5CVOB 4YYVA 1KFXL 3OVXA 5CHVA 1U9VA 1MDWA 5EF4A 2FRQA 3AI8A 2DZYA 2E00A 5CVNB 2HD5A 1EWPA 1QDQA 2E01A 3WXEA 1PPOA 2FUDA 1F29A 1BGOA 1BY8A 5EGWA
chains in the Genus database with same CATH superfamily
3PHUA 3I06A 1S4VA 2NQIA 3K9MA 2P7UA 5A24A 3LFYA 2ATOA 2DC8A 3S3RA 2DOSA 2E02A 5KO3A 3D6SA 3QT4A 4WURA 2XU4A 2GFOA 3PDFA 1GCBA 5K16A 2DJFB 3TMPA 1KFUL 1CB5A 1CTEA 1SNKA 2OULA 1GLOA 4YYWA 1CVZA 1A6RA 1YK8A 1POPA 1F2CA 4PP2E 4QH6A 2XU5A 1MEMA 1F2AA 2FT2A 4GUAA 2B1NA 2JQFR 4ZUXU 2OP3A 2DC7A 1CSBB 4QRVA 3PSEA 2IBIA 8PCHA 1AU2A 5E6JA 4OVZB 3TNXA 1PCIA 3LXSA 3KFQA 1ICFA 1KXRA 3CBKA 3KSEA 1QXPA 4P6GA 1CS8A 2P0RA 5F02A 2UZJA 1NLJA 3DF0A 4CDFB 2G6DA 3WXFA 3BPFA 2DCAA 4BOUA 1DF0A 3KW9A 2JRIA 1DKIA 5JA7A 4YYUA 3OISA 4BOQA 4CZWA 3PHWA 2Y6EA 1K3BB 1PADA 2DC9A 4I07A 4QBBA 3BPMA 4YYSA 4P16A 1X9YA 3OQCA 4YYQA 1JQPA 4X6JA 5JZEA 4MI7A 4RF0A 3KWBX 1O0EA 3OF8A 4D8BA 3IFUA 3H6SA 2Z84A 2IPPB 1CV8A 1AU0A 2DZZA 3N4CA 4FK5A 1M6DA 4BOPA 2CB5A 3MTVA 3O0UA 1VSNA 3MHHA 1Y08A 4PADA 1MIRA 2YJ2A 5EZQA 2ARYA 3MJ5A 3PRPA 3H8BA 1AIMA 3MHSA 3BBAA 3B79A 4P6EA 1U5IA 2Y5BA 4RNAA 3NHEA 2P86A 5JH3A 1IWDA 2BU3A 2HHNA 3F75A 2J7QA 3N3GA 3W31A 1EWLA 1U9QX 4W5BA 1KHPA 2FQ9A 4G54A 3CBJA 4A5UA 2YJCA 1PPPA 1AU4A 4ZTBA 4Q8GA 1PPNA 6PADA 3RNVA 1YALA 3U8EA 2DCCA 2O6XA 1EWOA 2AYOA 1DEUA 4BPVA 3GCBA 1U9WA 4M0WA 3P5VA 4MSXA 3W30A 3WXGA 4PI3A 2G7YA 1YVBA 3B21A 4YVAA 3E9SA 4CDCB 4CDDB 3E1ZB 1YT7A 4W5CA 4MM3B 2XU1A 3TRKA 1AYUA 4X6HA 1AYWA 5CVMA 4OVZA 1NPZA 4OELA 4RKXA 2J7QC 1THEA 4I04A 4BS6A 4XR7A 2DC6A 1QOLA 4YV8A 1CQDA 2HXZA 4DMXA 1FH0A 2BDZA 3F5VA 1U9XA 2AUZA 2R9MA 2DCBA 4KLBA 4R3DA 1GECE 1NB3A 1MHWA 1PVJA 3KKUA 4YYRA 5CHTA 3USVA 3IUTA 3IMAA 2FRAA 3BB7A 2PNSA 1NB5A 3OVZA 5FPWA 3BOWA 3RVWA 3HHAA 4CDEB 4FIPA 2BTWB 2AGAA 2FYEA 2R9CA 2XU3A 1CPJA 4D8EA 3CH3X 4BQVA 1CJLA 3M99A 2NQGA 4N8WA 1BQIA 2NQAA 2PADA 3HHIA 1EWMA 2PBHA 3O1GA 4OW0A 3H7DA 2R6NA 3BC3A 1TLOA 3ERVA 1BP4A 4QRXA 1AU3A 1UKFA 3P5UA 3H8CA 5PADA 3HWNA 3QJ3A 4D8IA 2WBFX 1PE6A 3PT2A 2ACTA 1AECA 2R9NA 1PXVA 2NQDB 3ZNHA 1YK7A 3RVVA 4RF1A 1TL9A 2BDLA 3IEJA 2AYNA 4BOZA 3HD3A 2DCDA 4PT5A 4W4UA 2AIMA 3IHPA 3OF9A 2G8JA 3P5XA 1EF7A 4REZA 4Q8HA 2DJGB 2F1GA 3KWZA 2OZ2A 3N3KA 3PNRA 3K24A 4HWYA 4IUMA 2AUXA 1XKGA 4OEMA 1NL6A 3H89A 1ZIVA 4XZXA 2BTWA 2HWKA 2C0YA 1QMYA 3K8UA 2G8EA 3BWKA 2AU1A 1MS6A 4K7CA 2JQGR 3PRMA 2YJ9A 4RY2A 5EZSA 3I3TA 1HUCB 2PREA 1Q6KA 1ITOA 1GMYA 4N4ZA 3CH2X 1SP4B 2FTDA 3BCNA 5J94A 1Y4HA 4AXMA 4MZSA 1ZCMA 4I05A 3MORA 4MZOA 2R9FA 4BOSA 2JTCA 1PBHA 4DMYA 3MTNA 4WA6A 3RVXA 2VHFA 2E03A 2YJ8A 2FE8A 2R9OA 1MEGA 2VHSA 4FJCA 3IOQA 4PP1A 1YZBA 4BS5A 2HH5A 4QRGA 1KHQA 4HXDB 1ATKA 1TU6A 3V6EA 1AYVA 3C9EA 2AS8A 2GHUA 3MP2A 1F2BA 3S3QA 3P5WA 4N79A 2CIOA 1PPDA 2B1MA 3KX1A 3QSDA 3BY4A 1PIPA 3V6CA 7PCKA 1NQCA 2F7DA 3PW3A 1VJVA 4AXLA 3O65A 2FO5A 3IV2A 2AVWA 2YJBA 4X6IA 9PAPA 1ME4A 3ZUAA 1STFE 4BSQA 3PBHA 1ME3A 2H7JA 4XUIA 5CVOB 4YYVA 1KFXL 3OVXA 5CHVA 1U9VA 1MDWA 5EF4A 3PHXA 2FRQA 3AI8A 2DZYA 2E00A 5CVNB 2HD5A 4IP3A 1EWPA 3C0RA 1QDQA 2E01A 3WXEA 1PPOA 2FUDA 1F29A 1BGOA 1BY8A 5EGWA
chains in the Genus database with same CATH topology
3I06A 1S4VA 2NQIA 3K9MA 2P7UA 5A24A 3LFYA 2ATOA 2DC8A 3S3RA 2E02A 3D6SA 3QT4A 2XU4A 1W4TA 2GFOA 3PDFA 1GCBA 5K16A 2DJFB 1KFUL 1CB5A 1CTEA 1SNKA 2OULA 1GLOA 4YYWA 1CVZA 1A6RA 1YK8A 1POPA 1F2CA 4PP2E 4QH6A 2XU5A 1MEMA 1F2AA 2FT2A 2B1NA 2JQFR 4ZUXU 2OP3A 2DC7A 1CSBB 4QRVA 2IBIA 8PCHA 1AU2A 3TNXA 1PCIA 3LXSA 3KFQA 4NV8A 1ICFA 1KXRA 3CBKA 3KSEA 1QXPA 4P6GA 1CS8A 2P0RA 5F02A 1NLJA 3DF0A 4CDFB 2G6DA 3WXFA 3BPFA 2DCAA 1DF0A 3KW9A 5JA7A 4YYUA 3OISA 4CZWA 2Y6EA 1K3BB 1PADA 2DC9A 4I07A 4QBBA 3BPMA 4YYSA 1X9YA 4YYQA 1JQPA 4X6JA 3KWBX 1O0EA 3OF8A 3H6SA 2IPPB 1CV8A 1AU0A 2DZZA 3N4CA 4FK5A 1M6DA 2CB5A 3O0UA 1VSNA 3MHHA 1Y08A 4PADA 1MIRA 2YJ2A 2ARYA 4C5PA 3H8BA 1AIMA 3MHSA 3B79A 4P6EA 1U5IA 2Y5BA 3NHEA 2P86A 5JH3A 1IWDA 2HHNA 3F75A 3N3GA 1EWLA 1U9QX 4W5BA 1KHPA 2FQ9A 4G54A 3CBJA 2YJCA 1PPPA 1AU4A 4Q8GA 2VFBA 1PPNA 6PADA 1YALA 3U8EA 2DCCA 2O6XA 1EWOA 2AYOA 1DEUA 4BPVA 3GCBA 1U9WA 3P5VA 4MSXA 3WXGA 4GUZA 4PI3A 2G7YA 1YVBA 4YVAA 4CDCB 4CDDB 3E1ZB 1YT7A 4W5CA 2XU1A 1AYUA 4X6HA 1AYWA 5CVMA 1NPZA 4OELA 1THEA 4I04A 4BS6A 4XR7A 2DC6A 1QOLA 4YV8A 1CQDA 2HXZA 4DMXA 1FH0A 2BDZA 3F5VA 1U9XA 2AUZA 2R9MA 2DCBA 4KLBA 1GECE 1NB3A 1MHWA 3KKUA 4YYRA 5CHTA 3USVA 3IUTA 3IMAA 2FRAA 2PNSA 1NB5A 3OVZA 5FPWA 3BOWA 3RVWA 3HHAA 4CDEB 1E2TA 4FIPA 2FYEA 2R9CA 2XU3A 1CPJA 3CH3X 4BQVA 1CJLA 3M99A 2NQGA 4N8WA 1BQIA 2NQAA 2PADA 3HHIA 1EWMA 2PBHA 3O1GA 3H7DA 2R6NA 3BC3A 1TLOA 3ERVA 1BP4A 4QRXA 1AU3A 4B55A 3P5UA 3H8CA 5PADA 3HWNA 3QJ3A 2WBFX 1PE6A 2ACTA 1AECA 2R9NA 1PXVA 2NQDB 1YK7A 3RVVA 3LTWA 4BGFA 1TL9A 2BDLA 3IEJA 2AYNA 3HD3A 2DCDA 4W4UA 2AIMA 3IHPA 3OF9A 2G8JA 3P5XA 1EF7A 4Q8HA 2DJGB 2F1GA 2VFCA 3KWZA 2OZ2A 3N3KA 3PNRA 3K24A 4HWYA 2AUXA 1XKGA 1NL6A 4OEMA 3H89A 1ZIVA 2C0YA 1QMYA 3K8UA 2G8EA 3BWKA 2AU1A 1MS6A 4K7CA 2JQGR 2YJ9A 4RY2A 3I3TA 1W5RA 1HUCB 2PREA 4NV7A 1Q6KA 1ITOA 1GMYA 4N4ZA 3CH2X 1SP4B 2FTDA 3BCNA 5J94A 1Y4HA 4AXMA 4MZSA 1ZCMA 4I05A 3MORA 4MZOA 2R9FA 3D9WA 1W6FA 1PBHA 4DMYA 3MTNA 4WA6A 3RVXA 2VHFA 2E03A 2BSZA 2YJ8A 2R9OA 1MEGA 2VHSA 4FJCA 3IOQA 4PP1A 4BS5A 2HH5A 4QRGA 1KHQA 1ATKA 1TU6A 3V6EA 1AYVA 3C9EA 2AS8A 1GX3A 2GHUA 1F2BA 3S3QA 3P5WA 4N79A 2CIOA 1PPDA 2B1MA 3KX1A 3QSDA 1PIPA 3V6CA 7PCKA 1NQCA 2F7DA 3PW3A 1VJVA 4AXLA 2FO5A 3IV2A 2AVWA 4X6IA 2YJBA 9PAPA 1ME4A 3ZUAA 1STFE 4BSQA 3PBHA 1ME3A 2H7JA 4XUIA 5CVOB 4YYVA 1KFXL 3OVXA 5CHVA 1U9VA 1MDWA 5EF4A 2FRQA 3AI8A 2DZYA 2E00A 5CVNB 2HD5A 1EWPA 1QDQA 2E01A 3WXEA 1PPOA 2FUDA 1F29A 1BGOA 1BY8A 5EGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I06 A;  1S4V A;  2NQI A;  3K9M A;  2P7U A;  5A24 A;  3LFY A;  2ATO A;  2DC8 A;  3S3R A;  2E02 A;  3D6S A;  3QT4 A;  2XU4 A;  2GFO A;  3PDF A;  1GCB A;  5K16 A;  2DJF B;  1KFU L;  1CB5 A;  1CTE A;  1SNK A;  2OUL A;  1GLO A;  4YYW A;  1CVZ A;  1A6R A;  1YK8 A;  1POP A;  1F2C A;  4PP2 E;  4QH6 A;  2XU5 A;  1MEM A;  1F2A A;  2FT2 A;  2B1N A;  2JQF R;  4ZUX U;  2OP3 A;  2DC7 A;  1CSB B;  4QRV A;  2IBI A;  8PCH A;  1AU2 A;  3TNX A;  1PCI A;  3LXS A;  3KFQ A;  1ICF A;  1KXR A;  3CBK A;  3KSE A;  1QXP A;  4P6G A;  1CS8 A;  2P0R A;  5F02 A;  1NLJ A;  3DF0 A;  4CDF B;  2G6D A;  3WXF A;  3BPF A;  2DCA A;  1DF0 A;  3KW9 A;  5JA7 A;  4YYU A;  3OIS A;  4CZW A;  2Y6E A;  1K3B B;  1PAD A;  2DC9 A;  4I07 A;  4QBB A;  3BPM A;  4YYS A;  1X9Y A;  4YYQ A;  1JQP A;  4X6J A;  3KWB X;  1O0E A;  3OF8 A;  3H6S A;  2IPP B;  1CV8 A;  1AU0 A;  2DZZ A;  3N4C A;  4FK5 A;  1M6D A;  2CB5 A;  3O0U A;  1VSN A;  3MHH A;  1Y08 A;  4PAD A;  1MIR A;  2YJ2 A;  2ARY A;  3H8B A;  1AIM A;  3MHS A;  3B79 A;  4P6E A;  1U5I A;  2Y5B A;  3NHE A;  2P86 A;  5JH3 A;  1IWD A;  2HHN A;  3F75 A;  3N3G A;  1EWL A;  1U9Q X;  4W5B A;  1KHP A;  2FQ9 A;  4G54 A;  3CBJ A;  2YJC A;  1PPP A;  1AU4 A;  4Q8G A;  1PPN A;  6PAD A;  1YAL A;  3U8E A;  2DCC A;  2O6X A;  1EWO A;  2AYO A;  1DEU A;  4BPV A;  3GCB A;  1U9W A;  3P5V A;  4MSX A;  3WXG A;  4PI3 A;  2G7Y A;  1YVB A;  4YVA A;  4CDC B;  4CDD B;  3E1Z B;  1YT7 A;  4W5C A;  2XU1 A;  1AYU A;  4X6H A;  1AYW A;  5CVM A;  1NPZ A;  4OEL A;  1THE A;  4I04 A;  4BS6 A;  4XR7 A;  2DC6 A;  1QOL A;  4YV8 A;  1CQD A;  2HXZ A;  4DMX A;  1FH0 A;  2BDZ A;  3F5V A;  1U9X A;  2AUZ A;  2R9M A;  2DCB A;  4KLB A;  1GEC E;  1NB3 A;  1MHW A;  3KKU A;  4YYR A;  5CHT A;  3USV A;  3IUT A;  3IMA A;  2FRA A;  2PNS A;  1NB5 A;  3OVZ A;  5FPW A;  3BOW A;  3RVW A;  3HHA A;  4CDE B;  4FIP A;  2FYE A;  2R9C A;  2XU3 A;  1CPJ A;  3CH3 X;  4BQV A;  1CJL A;  3M99 A;  2NQG A;  4N8W A;  1BQI A;  2NQA A;  2PAD A;  3HHI A;  1EWM A;  2PBH A;  3O1G A;  3H7D A;  2R6N A;  3BC3 A;  1TLO A;  3ERV A;  1BP4 A;  4QRX A;  1AU3 A;  3P5U A;  3H8C A;  5PAD A;  3HWN A;  3QJ3 A;  2WBF X;  1PE6 A;  2ACT A;  1AEC A;  2R9N A;  1PXV A;  2NQD B;  1YK7 A;  3RVV A;  1TL9 A;  2BDL A;  3IEJ A;  2AYN A;  3HD3 A;  2DCD A;  4W4U A;  2AIM A;  3IHP A;  3OF9 A;  2G8J A;  3P5X A;  1EF7 A;  4Q8H A;  2DJG B;  2F1G A;  3KWZ A;  2OZ2 A;  3N3K A;  3PNR A;  3K24 A;  4HWY A;  2AUX A;  1XKG A;  1NL6 A;  4OEM A;  3H89 A;  1ZIV A;  2C0Y A;  1QMY A;  3K8U A;  2G8E A;  3BWK A;  2AU1 A;  1MS6 A;  4K7C A;  2JQG R;  2YJ9 A;  4RY2 A;  3I3T A;  1HUC B;  2PRE A;  1Q6K A;  1ITO A;  1GMY A;  4N4Z A;  3CH2 X;  1SP4 B;  2FTD A;  3BCN A;  5J94 A;  1Y4H A;  4AXM A;  4MZS A;  1ZCM A;  4I05 A;  3MOR A;  4MZO A;  2R9F A;  1PBH A;  4DMY A;  3MTN A;  4WA6 A;  3RVX A;  2VHF A;  2E03 A;  2YJ8 A;  2R9O A;  1MEG A;  2VHS A;  4FJC A;  3IOQ A;  4PP1 A;  4BS5 A;  2HH5 A;  4QRG A;  1KHQ A;  1ATK A;  1TU6 A;  3V6E A;  1AYV A;  3C9E A;  2AS8 A;  2GHU A;  1F2B A;  3S3Q A;  3P5W A;  4N79 A;  2CIO A;  1PPD A;  2B1M A;  3KX1 A;  3QSD A;  1PIP A;  3V6C A;  7PCK A;  1NQC A;  2F7D A;  3PW3 A;  1VJV A;  4AXL A;  2FO5 A;  3IV2 A;  2AVW A;  4X6I A;  2YJB A;  9PAP A;  1ME4 A;  3ZUA A;  1STF E;  4BSQ A;  3PBH A;  1ME3 A;  2H7J A;  4XUI A;  5CVO B;  4YYV A;  1KFX L;  3OVX A;  5CHV A;  1U9V A;  1MDW A;  5EF4 A;  2FRQ A;  3AI8 A;  2DZY A;  2E00 A;  5CVN B;  2HD5 A;  1EWP A;  1QDQ A;  2E01 A;  3WXE A;  1PPO A;  2FUD A;  1F29 A;  1BGO A;  1BY8 A;  5EGW A; 
#chains in the Genus database with same CATH topology
 3PHU A;  3I06 A;  1S4V A;  2NQI A;  3K9M A;  2P7U A;  5A24 A;  3LFY A;  2ATO A;  2DC8 A;  3S3R A;  2DOS A;  2E02 A;  5KO3 A;  3D6S A;  3QT4 A;  4WUR A;  2XU4 A;  2GFO A;  3PDF A;  1GCB A;  5K16 A;  2DJF B;  3TMP A;  1KFU L;  1CB5 A;  1CTE A;  1SNK A;  2OUL A;  1GLO A;  4YYW A;  1CVZ A;  1A6R A;  1YK8 A;  1POP A;  1F2C A;  4PP2 E;  4QH6 A;  2XU5 A;  1MEM A;  1F2A A;  2FT2 A;  4GUA A;  2B1N A;  2JQF R;  4ZUX U;  2OP3 A;  2DC7 A;  1CSB B;  4QRV A;  3PSE A;  2IBI A;  8PCH A;  1AU2 A;  5E6J A;  4OVZ B;  3TNX A;  1PCI A;  3LXS A;  3KFQ A;  1ICF A;  1KXR A;  3CBK A;  3KSE A;  1QXP A;  4P6G A;  1CS8 A;  2P0R A;  5F02 A;  2UZJ A;  1NLJ A;  3DF0 A;  4CDF B;  2G6D A;  3WXF A;  3BPF A;  2DCA A;  4BOU A;  1DF0 A;  3KW9 A;  2JRI A;  1DKI A;  5JA7 A;  4YYU A;  3OIS A;  4BOQ A;  4CZW A;  3PHW A;  2Y6E A;  1K3B B;  1PAD A;  2DC9 A;  4I07 A;  4QBB A;  3BPM A;  4YYS A;  4P16 A;  1X9Y A;  3OQC A;  4YYQ A;  1JQP A;  4X6J A;  5JZE A;  4MI7 A;  4RF0 A;  3KWB X;  1O0E A;  3OF8 A;  4D8B A;  3IFU A;  3H6S A;  2Z84 A;  2IPP B;  1CV8 A;  1AU0 A;  2DZZ A;  3N4C A;  4FK5 A;  1M6D A;  4BOP A;  2CB5 A;  3MTV A;  3O0U A;  1VSN A;  3MHH A;  1Y08 A;  4PAD A;  1MIR A;  2YJ2 A;  5EZQ A;  2ARY A;  3MJ5 A;  3PRP A;  3H8B A;  1AIM A;  3MHS A;  3BBA A;  3B79 A;  4P6E A;  1U5I A;  2Y5B A;  4RNA A;  3NHE A;  2P86 A;  5JH3 A;  1IWD A;  2BU3 A;  2HHN A;  3F75 A;  2J7Q A;  3N3G A;  3W31 A;  1EWL A;  1U9Q X;  4W5B A;  1KHP A;  2FQ9 A;  4G54 A;  3CBJ A;  4A5U A;  2YJC A;  1PPP A;  1AU4 A;  4ZTB A;  4Q8G A;  1PPN A;  6PAD A;  3RNV A;  1YAL A;  3U8E A;  2DCC A;  2O6X A;  1EWO A;  2AYO A;  1DEU A;  4BPV A;  3GCB A;  1U9W A;  4M0W A;  3P5V A;  4MSX A;  3W30 A;  3WXG A;  4PI3 A;  2G7Y A;  1YVB A;  3B21 A;  4YVA A;  3E9S A;  4CDC B;  4CDD B;  3E1Z B;  1YT7 A;  4W5C A;  4MM3 B;  2XU1 A;  3TRK A;  1AYU A;  4X6H A;  1AYW A;  5CVM A;  4OVZ A;  1NPZ A;  4OEL A;  4RKX A;  2J7Q C;  1THE A;  4I04 A;  4BS6 A;  4XR7 A;  2DC6 A;  1QOL A;  4YV8 A;  1CQD A;  2HXZ A;  4DMX A;  1FH0 A;  2BDZ A;  3F5V A;  1U9X A;  2AUZ A;  2R9M A;  2DCB A;  4KLB A;  4R3D A;  1GEC E;  1NB3 A;  1MHW A;  1PVJ A;  3KKU A;  4YYR A;  5CHT A;  3USV A;  3IUT A;  3IMA A;  2FRA A;  3BB7 A;  2PNS A;  1NB5 A;  3OVZ A;  5FPW A;  3BOW A;  3RVW A;  3HHA A;  4CDE B;  4FIP A;  2BTW B;  2AGA A;  2FYE A;  2R9C A;  2XU3 A;  1CPJ A;  4D8E A;  3CH3 X;  4BQV A;  1CJL A;  3M99 A;  2NQG A;  4N8W A;  1BQI A;  2NQA A;  2PAD A;  3HHI A;  1EWM A;  2PBH A;  3O1G A;  4OW0 A;  3H7D A;  2R6N A;  3BC3 A;  1TLO A;  3ERV A;  1BP4 A;  4QRX A;  1AU3 A;  1UKF A;  3P5U A;  3H8C A;  5PAD A;  3HWN A;  3QJ3 A;  4D8I A;  2WBF X;  1PE6 A;  3PT2 A;  2ACT A;  1AEC A;  2R9N A;  1PXV A;  2NQD B;  3ZNH A;  1YK7 A;  3RVV A;  4RF1 A;  1TL9 A;  2BDL A;  3IEJ A;  2AYN A;  4BOZ A;  3HD3 A;  2DCD A;  4PT5 A;  4W4U A;  2AIM A;  3IHP A;  3OF9 A;  2G8J A;  3P5X A;  1EF7 A;  4REZ A;  4Q8H A;  2DJG B;  2F1G A;  3KWZ A;  2OZ2 A;  3N3K A;  3PNR A;  3K24 A;  4HWY A;  4IUM A;  2AUX A;  1XKG A;  4OEM A;  1NL6 A;  3H89 A;  1ZIV A;  4XZX A;  2BTW A;  2HWK A;  2C0Y A;  1QMY A;  3K8U A;  2G8E A;  3BWK A;  2AU1 A;  1MS6 A;  4K7C A;  2JQG R;  3PRM A;  2YJ9 A;  4RY2 A;  5EZS A;  3I3T A;  1HUC B;  2PRE A;  1Q6K A;  1ITO A;  1GMY A;  4N4Z A;  3CH2 X;  1SP4 B;  2FTD A;  3BCN A;  5J94 A;  1Y4H A;  4AXM A;  4MZS A;  1ZCM A;  4I05 A;  3MOR A;  4MZO A;  2R9F A;  4BOS A;  2JTC A;  1PBH A;  4DMY A;  3MTN A;  4WA6 A;  3RVX A;  2VHF A;  2E03 A;  2YJ8 A;  2FE8 A;  2R9O A;  1MEG A;  2VHS A;  4FJC A;  3IOQ A;  4PP1 A;  1YZB A;  4BS5 A;  2HH5 A;  4QRG A;  1KHQ A;  4HXD B;  1ATK A;  1TU6 A;  3V6E A;  1AYV A;  3C9E A;  2AS8 A;  2GHU A;  3MP2 A;  1F2B A;  3S3Q A;  3P5W A;  4N79 A;  2CIO A;  1PPD A;  2B1M A;  3KX1 A;  3QSD A;  3BY4 A;  1PIP A;  3V6C A;  7PCK A;  1NQC A;  2F7D A;  3PW3 A;  1VJV A;  4AXL A;  3O65 A;  2FO5 A;  3IV2 A;  2AVW A;  2YJB A;  4X6I A;  9PAP A;  1ME4 A;  3ZUA A;  1STF E;  4BSQ A;  3PBH A;  1ME3 A;  2H7J A;  4XUI A;  5CVO B;  4YYV A;  1KFX L;  3OVX A;  5CHV A;  1U9V A;  1MDW A;  5EF4 A;  3PHX A;  2FRQ A;  3AI8 A;  2DZY A;  2E00 A;  5CVN B;  2HD5 A;  4IP3 A;  1EWP A;  3C0R A;  1QDQ A;  2E01 A;  3WXE A;  1PPO A;  2FUD A;  1F29 A;  1BGO A;  1BY8 A;  5EGW A; 
#chains in the Genus database with same CATH homology
 3I06 A;  1S4V A;  2NQI A;  3K9M A;  2P7U A;  5A24 A;  3LFY A;  2ATO A;  2DC8 A;  3S3R A;  2E02 A;  3D6S A;  3QT4 A;  2XU4 A;  1W4T A;  2GFO A;  3PDF A;  1GCB A;  5K16 A;  2DJF B;  1KFU L;  1CB5 A;  1CTE A;  1SNK A;  2OUL A;  1GLO A;  4YYW A;  1CVZ A;  1A6R A;  1YK8 A;  1POP A;  1F2C A;  4PP2 E;  4QH6 A;  2XU5 A;  1MEM A;  1F2A A;  2FT2 A;  2B1N A;  2JQF R;  4ZUX U;  2OP3 A;  2DC7 A;  1CSB B;  4QRV A;  2IBI A;  8PCH A;  1AU2 A;  3TNX A;  1PCI A;  3LXS A;  3KFQ A;  4NV8 A;  1ICF A;  1KXR A;  3CBK A;  3KSE A;  1QXP A;  4P6G A;  1CS8 A;  2P0R A;  5F02 A;  1NLJ A;  3DF0 A;  4CDF B;  2G6D A;  3WXF A;  3BPF A;  2DCA A;  1DF0 A;  3KW9 A;  5JA7 A;  4YYU A;  3OIS A;  4CZW A;  2Y6E A;  1K3B B;  1PAD A;  2DC9 A;  4I07 A;  4QBB A;  3BPM A;  4YYS A;  1X9Y A;  4YYQ A;  1JQP A;  4X6J A;  3KWB X;  1O0E A;  3OF8 A;  3H6S A;  2IPP B;  1CV8 A;  1AU0 A;  2DZZ A;  3N4C A;  4FK5 A;  1M6D A;  2CB5 A;  3O0U A;  1VSN A;  3MHH A;  1Y08 A;  4PAD A;  1MIR A;  2YJ2 A;  2ARY A;  4C5P A;  3H8B A;  1AIM A;  3MHS A;  3B79 A;  4P6E A;  1U5I A;  2Y5B A;  3NHE A;  2P86 A;  5JH3 A;  1IWD A;  2HHN A;  3F75 A;  3N3G A;  1EWL A;  1U9Q X;  4W5B A;  1KHP A;  2FQ9 A;  4G54 A;  3CBJ A;  2YJC A;  1PPP A;  1AU4 A;  4Q8G A;  2VFB A;  1PPN A;  6PAD A;  1YAL A;  3U8E A;  2DCC A;  2O6X A;  1EWO A;  2AYO A;  1DEU A;  4BPV A;  3GCB A;  1U9W A;  3P5V A;  4MSX A;  3WXG A;  4GUZ A;  4PI3 A;  2G7Y A;  1YVB A;  4YVA A;  4CDC B;  4CDD B;  3E1Z B;  1YT7 A;  4W5C A;  2XU1 A;  1AYU A;  4X6H A;  1AYW A;  5CVM A;  1NPZ A;  4OEL A;  1THE A;  4I04 A;  4BS6 A;  4XR7 A;  2DC6 A;  1QOL A;  4YV8 A;  1CQD A;  2HXZ A;  4DMX A;  1FH0 A;  2BDZ A;  3F5V A;  1U9X A;  2AUZ A;  2R9M A;  2DCB A;  4KLB A;  1GEC E;  1NB3 A;  1MHW A;  3KKU A;  4YYR A;  5CHT A;  3USV A;  3IUT A;  3IMA A;  2FRA A;  2PNS A;  1NB5 A;  3OVZ A;  5FPW A;  3BOW A;  3RVW A;  3HHA A;  4CDE B;  1E2T A;  4FIP A;  2FYE A;  2R9C A;  2XU3 A;  1CPJ A;  3CH3 X;  4BQV A;  1CJL A;  3M99 A;  2NQG A;  4N8W A;  1BQI A;  2NQA A;  2PAD A;  3HHI A;  1EWM A;  2PBH A;  3O1G A;  3H7D A;  2R6N A;  3BC3 A;  1TLO A;  3ERV A;  1BP4 A;  4QRX A;  1AU3 A;  4B55 A;  3P5U A;  3H8C A;  5PAD A;  3HWN A;  3QJ3 A;  2WBF X;  1PE6 A;  2ACT A;  1AEC A;  2R9N A;  1PXV A;  2NQD B;  1YK7 A;  3RVV A;  3LTW A;  4BGF A;  1TL9 A;  2BDL A;  3IEJ A;  2AYN A;  3HD3 A;  2DCD A;  4W4U A;  2AIM A;  3IHP A;  3OF9 A;  2G8J A;  3P5X A;  1EF7 A;  4Q8H A;  2DJG B;  2F1G A;  2VFC A;  3KWZ A;  2OZ2 A;  3N3K A;  3PNR A;  3K24 A;  4HWY A;  2AUX A;  1XKG A;  1NL6 A;  4OEM A;  3H89 A;  1ZIV A;  2C0Y A;  1QMY A;  3K8U A;  2G8E A;  3BWK A;  2AU1 A;  1MS6 A;  4K7C A;  2JQG R;  2YJ9 A;  4RY2 A;  3I3T A;  1W5R A;  1HUC B;  2PRE A;  4NV7 A;  1Q6K A;  1ITO A;  1GMY A;  4N4Z A;  3CH2 X;  1SP4 B;  2FTD A;  3BCN A;  5J94 A;  1Y4H A;  4AXM A;  4MZS A;  1ZCM A;  4I05 A;  3MOR A;  4MZO A;  2R9F A;  3D9W A;  1W6F A;  1PBH A;  4DMY A;  3MTN A;  4WA6 A;  3RVX A;  2VHF A;  2E03 A;  2BSZ A;  2YJ8 A;  2R9O A;  1MEG A;  2VHS A;  4FJC A;  3IOQ A;  4PP1 A;  4BS5 A;  2HH5 A;  4QRG A;  1KHQ A;  1ATK A;  1TU6 A;  3V6E A;  1AYV A;  3C9E A;  2AS8 A;  1GX3 A;  2GHU A;  1F2B A;  3S3Q A;  3P5W A;  4N79 A;  2CIO A;  1PPD A;  2B1M A;  3KX1 A;  3QSD A;  1PIP A;  3V6C A;  7PCK A;  1NQC A;  2F7D A;  3PW3 A;  1VJV A;  4AXL A;  2FO5 A;  3IV2 A;  2AVW A;  4X6I A;  2YJB A;  9PAP A;  1ME4 A;  3ZUA A;  1STF E;  4BSQ A;  3PBH A;  1ME3 A;  2H7J A;  4XUI A;  5CVO B;  4YYV A;  1KFX L;  3OVX A;  5CHV A;  1U9V A;  1MDW A;  5EF4 A;  2FRQ A;  3AI8 A;  2DZY A;  2E00 A;  5CVN B;  2HD5 A;  1EWP A;  1QDQ A;  2E01 A;  3WXE A;  1PPO A;  2FUD A;  1F29 A;  1BGO A;  1BY8 A;  5EGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...