1PIPA

Crystal structure of papain-succinyl-gln-val-val-ala-ala-p-nitroanilide complex at 1.7 angstroms resolution: noncovalent binding mode of a common sequence of endogenous thiol protease inhibitors
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
212
structure length
212
Chain Sequence
IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNQYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNQGALLYSIANQPVSVVLQAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of papain-succinyl-Gln-Val-Val-Ala-Ala-p-nitroanilide complex at 1.7-A resolution: noncovalent binding mode of a common sequence of endogenous thiol protease inhibitors.
pubmed doi rcsb
source organism Carica papaya
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PAPAIN
total genus 66
structure length 212
sequence length 212
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 1992-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1pipA00
4I04A 2AIMA 5CHVA 2OULA 1EWMA 3BOWA 1AU2A 3H6SA 4AXMA 2FRAA 1CPJA 1BP4A 2IBIA 8PCHA 2R9OA 2VHFA 2HD5A 3BPMA 1CSBB 3ZUAA 3BCNA 4XR7A 1U5IA 1EWPA 5JH3A 2ACTA 1CVZA 3D6SA 4G54A 3IMAA 1THEA 1MEGA 1ATKA 2XU3A 2DJGB 2DCDA 1STFE 3H89A 1U9WA 1U9VA 3C9EA 1CTEA 3PBHA 2OP3A 1ME3A 4K7CA 1IWDA 4CDFB 2G6DA 2FQ9A 1K3BB 4MSXA 2FRQA 2CB5A 3TNXA 1EWOA 3HWNA 4W5CA 2NQDB 3MHHA 3S3RA 3HHIA 2ATOA 2BDZA 1YALA 2H7JA 4YYQA 1SP4B 4FK5A 5EGWA 1GCBA 3N3KA 3P5UA 2DC7A 2R9NA 3OVXA 2G7YA 2YJCA 1AECA 1XKGA 3QT4A 2R9MA 1ITOA 2YJ2A 2FTDA 4QBBA 2R6NA 3LFYA 3WXGA 4YYSA 4DMXA 2PADA 2PREA 1AIMA 3K9MA 3USVA 2E00A 5EF4A 1S4VA 2XU4A 4BS5A 4PI3A 1BQIA 1FH0A 3ERVA 2DCBA 1PIPA 4CDDB 5FPWA 2FT2A 1PPDA 1EWLA 4W5BA 1GECE 4X6JA 7PCKA 4X6HA 4XUIA 1F2AA 1TL9A 3H8BA 3BPFA 1Y08A 1MHWA 1CV8A 2AVWA 6PADA 2NQAA 5CVNB 4AXLA 1AU0A 2YJ9A 4N8WA 2P0RA 3O0UA 2FUDA 3B79A 2NQIA 3KW9A 1EF7A 3P5WA 1DEUA 1F2BA 1BGOA 1ZIVA 4W4UA 2AUZA 2AU1A 2PNSA 4BPVA 1MS6A 4I05A 3PDFA 1NLJA 3U8EA 2R9CA 5CHTA 1PPOA 4CDEB 3QJ3A 3IV2A 5A24A 4PADA 3H8CA 3MHSA 4OEMA 3BC3A 1VJVA 2JQFR 1HUCB 2DCAA 3KFQA 1PPPA 1AYUA 3CBKA 4P6GA 3H7DA 2YJ8A 2E02A 4QRXA 4N4ZA 3NHEA 5PADA 1U9QX 2FYEA 1NB5A 1CB5A 3V6EA 4YV8A 4X6IA 1KXRA 1YK7A 3M99A 4MZOA 4BQVA 2R9FA 4FIPA 4N79A 1TLOA 1TU6A 2BDLA 1PCIA 1MDWA 1QXPA 3IHPA 4QRGA 1CJLA 1U9XA 4I07A 5CVMA 3N3GA 2XU1A 2YJBA 2E03A 3OISA 3KSEA 5JA7A 3OF8A 2ARYA 2Y5BA 3OF9A 4FJCA 4YVAA 1F29A 1Q6KA 3RVWA 1F2CA 1JQPA 5F02A 4DMYA 2DC6A 1X9YA 1CS8A 5J94A 1ME4A 1AYVA 2XU5A 1AYWA 2DC9A 1PBHA 2GFOA 1NB3A 2DC8A 2DJFB 2DCCA 3KWBX 2AS8A 2B1NA 9PAPA 3IEJA 1PE6A 1KFXL 1KFUL 4QRVA 2AYNA 4BS6A 1YT7A 3IOQA 1AU3A 1ZCMA 4WA6A 3RVXA 2G8EA 4PP2E 1GLOA 1KHQA 1ICFA 4BSQA 3HD3A 4Q8GA 1PXVA 1PPNA 3CH3X 4YYRA 1VSNA 1GMYA 2DZZA 4ZUXU 3GCBA 3LXSA 3KX1A 3S3QA 1QMYA 4OELA 3K8UA 3CH2X 1CQDA 3DF0A 2P86A 2PBHA 3F75A 3I3TA 3IUTA 2F1GA 2FO5A 3RVVA 1Y4HA 1YVBA 2IPPB 1YK8A 4Q8HA 2VHSA 2Y6EA 4RY2A 4YYUA 3QSDA 3HHAA 2F7DA 1MEMA 2E01A 2C0YA 3CBJA 2NQGA 4YYVA 1NQCA 3WXEA 2CIOA 4CZWA 3OVZA 2AYOA 3PW3A 4P6EA 4CDCB 5CVOB 2HH5A 3P5XA 1NPZA 4HWYA 1AU4A 1O0EA 4MZSA 3MORA 2WBFX 3WXFA 1MIRA 3KKUA 1DF0A 1M6DA 4PP1A 2HHNA 3I06A 3MTNA 3N4CA 1QOLA 4KLBA 1A6RA 3P5VA 2JQGR 2O6XA 2P7UA 4YYWA 3AI8A 3PNRA 3F5VA 5K16A 3K24A 3V6CA 4QH6A 1SNKA 1BY8A 3KWZA 2B1MA 3BWKA 1QDQA 2DZYA 3E1ZB 2G8JA 1NL6A 1KHPA 2GHUA 2AUXA 1PADA 2HXZA 3O1GA 2OZ2A 1POPA
chains in the Genus database with same CATH superfamily
4I04A 2AIMA 4OVZA 5CHVA 2OULA 1EWMA 3BOWA 1AU2A 3H6SA 4AXMA 2JTCA 2FRAA 1CPJA 1BP4A 2IBIA 3PT2A 8PCHA 2R9OA 2VHFA 2HD5A 4IP3A 3BPMA 1CSBB 3ZUAA 3BCNA 4XR7A 1U5IA 1EWPA 5JH3A 2ACTA 1CVZA 4ZTBA 3D6SA 4G54A 3IMAA 1THEA 1MEGA 4PT5A 1ATKA 2XU3A 2DJGB 2DCDA 4RKXA 1STFE 3H89A 3MTVA 1U9WA 1U9VA 3C9EA 1CTEA 3PHXA 3PBHA 2OP3A 1ME3A 4K7CA 1IWDA 4CDFB 2G6DA 2FQ9A 4RNAA 1K3BB 4MSXA 2FRQA 2CB5A 3TNXA 1EWOA 3HWNA 4W5CA 2NQDB 3MHHA 3S3RA 3HHIA 2ATOA 2BDZA 1YALA 2H7JA 4YYQA 2AGAA 1PVJA 1SP4B 4FK5A 4RF1A 5EGWA 1GCBA 3N3KA 2HWKA 3P5UA 2DC7A 2R9NA 3OVXA 2G7YA 2YJCA 1AECA 1XKGA 3QT4A 2R9MA 1ITOA 4IUMA 3W31A 2YJ2A 2FTDA 4QBBA 4BOSA 2R6NA 3LFYA 3WXGA 4BOPA 4YYSA 4DMXA 4BOZA 2PADA 2PREA 2JRIA 1AIMA 3K9MA 3PHWA 3USVA 2E00A 1UKFA 5EF4A 1S4VA 2XU4A 4BS5A 4PI3A 1BQIA 1FH0A 3ERVA 4D8BA 2DCBA 1PIPA 4CDDB 5FPWA 2FT2A 1PPDA 3PHUA 1EWLA 4W5BA 1GECE 4X6JA 3B21A 7PCKA 3OQCA 4X6HA 4XUIA 1F2AA 1TL9A 2BU3A 3H8BA 3BPFA 1Y08A 1MHWA 1CV8A 2AVWA 6PADA 2NQAA 4MM3B 5CVNB 4AXLA 1AU0A 2YJ9A 4N8WA 2P0RA 4XZXA 3O0UA 2FUDA 3B79A 2NQIA 3KW9A 1EF7A 3P5WA 1DEUA 1F2BA 1BGOA 1ZIVA 4W4UA 2AUZA 2AU1A 2PNSA 4BPVA 3ZNHA 1MS6A 4I05A 3PDFA 1NLJA 3U8EA 2R9CA 5CHTA 1PPOA 4CDEB 4R3DA 3QJ3A 3IV2A 5A24A 4PADA 3H8CA 3MHSA 4OEMA 3BC3A 1VJVA 2JQFR 1HUCB 2DCAA 3KFQA 1PPPA 1AYUA 3CBKA 4P6GA 3H7DA 2YJ8A 2E02A 4QRXA 4N4ZA 4RF0A 3C0RA 3NHEA 1U9QX 2FYEA 5PADA 1NB5A 1CB5A 4WURA 3V6EA 4YV8A 2Z84A 5KO3A 4X6IA 1KXRA 1YK7A 3M99A 4MZOA 4BQVA 4REZA 2R9FA 3PRPA 4FIPA 4N79A 1TLOA 1DKIA 1TU6A 2BDLA 2DOSA 4GUAA 1PCIA 1MDWA 5EZQA 1QXPA 3IHPA 4QRGA 1CJLA 4BOQA 1U9XA 4I07A 5CVMA 3N3GA 4D8EA 2XU1A 2YJBA 2E03A 3OISA 3KSEA 4BOUA 5JA7A 3OF8A 2ARYA 4P16A 4M0WA 2Y5BA 3OF9A 4FJCA 2J7QC 4YVAA 1F29A 4MI7A 1Q6KA 3RVWA 1F2CA 1JQPA 5F02A 4DMYA 2DC6A 2J7QA 1X9YA 1CS8A 5J94A 1ME4A 1AYVA 2XU5A 3W30A 1AYWA 2DC9A 1PBHA 2GFOA 1NB3A 2DC8A 2DJFB 2DCCA 3PSEA 4A5UA 3KWBX 2AS8A 2B1NA 9PAPA 3IEJA 1PE6A 1KFXL 1KFUL 2BTWB 4QRVA 2AYNA 4BS6A 1YT7A 3IOQA 1AU3A 1ZCMA 3MJ5A 4WA6A 3RVXA 2G8EA 4PP2E 1GLOA 1KHQA 1ICFA 3TMPA 4BSQA 3HD3A 4Q8GA 1PXVA 1PPNA 3CH3X 4YYRA 1VSNA 1GMYA 2DZZA 4ZUXU 5E6JA 3GCBA 3LXSA 3KX1A 3S3QA 1QMYA 4OELA 3K8UA 3CH2X 1CQDA 3DF0A 2P86A 2PBHA 3F75A 3I3TA 3IUTA 2F1GA 2FO5A 3RVVA 1Y4HA 1YVBA 2IPPB 1YK8A 4Q8HA 2VHSA 4OW0A 4OVZB 2Y6EA 4RY2A 4YYUA 3QSDA 3HHAA 3E9SA 2F7DA 1MEMA 2E01A 2C0YA 3BBAA 3CBJA 3BB7A 2NQGA 4YYVA 4D8IA 1NQCA 3WXEA 2CIOA 4CZWA 4HXDB 3OVZA 2AYOA 3PW3A 4P6EA 4CDCB 3BY4A 5CVOB 1YZBA 2HH5A 3P5XA 3O65A 1NPZA 4HWYA 3IFUA 3RNVA 1AU4A 1O0EA 5EZSA 2FE8A 4MZSA 3MORA 2WBFX 3TRKA 3WXFA 2UZJA 1MIRA 3KKUA 1DF0A 1M6DA 4PP1A 2HHNA 3I06A 3MTNA 3N4CA 2BTWA 1QOLA 4KLBA 1A6RA 3PRMA 3P5VA 2JQGR 2O6XA 3MP2A 2P7UA 3AI8A 4YYWA 3PNRA 3F5VA 5K16A 3K24A 3V6CA 4QH6A 1SNKA 1BY8A 3KWZA 2B1MA 3BWKA 1QDQA 2DZYA 3E1ZB 2G8JA 1NL6A 1KHPA 2GHUA 2AUXA 1PADA 2HXZA 3O1GA 5JZEA 2OZ2A 1POPA
chains in the Genus database with same CATH topology
4I04A 2AIMA 5CHVA 2OULA 1EWMA 3BOWA 1AU2A 3H6SA 4AXMA 2FRAA 1CPJA 1BP4A 2IBIA 8PCHA 2R9OA 2VHFA 2HD5A 3BPMA 1CSBB 3ZUAA 3BCNA 4XR7A 1U5IA 1EWPA 5JH3A 2ACTA 1CVZA 3D6SA 4G54A 3IMAA 1THEA 1MEGA 1W5RA 1ATKA 2XU3A 2DJGB 2DCDA 1STFE 3H89A 1U9WA 4BGFA 1U9VA 3C9EA 1CTEA 3PBHA 2OP3A 1ME3A 4K7CA 4GUZA 1IWDA 4CDFB 2G6DA 2FQ9A 1K3BB 4MSXA 2FRQA 2CB5A 3TNXA 1EWOA 3HWNA 4W5CA 2NQDB 3MHHA 3S3RA 3HHIA 2ATOA 1W6FA 2BDZA 1YALA 2H7JA 4YYQA 1SP4B 4FK5A 5EGWA 1GCBA 3N3KA 3P5UA 2DC7A 2R9NA 3OVXA 2G7YA 2YJCA 1AECA 1XKGA 3QT4A 2R9MA 1ITOA 2YJ2A 2FTDA 4QBBA 2R6NA 3LFYA 3WXGA 4YYSA 4DMXA 2PADA 2PREA 1AIMA 3K9MA 1GX3A 3USVA 2E00A 5EF4A 1S4VA 2XU4A 4BS5A 4PI3A 1BQIA 1FH0A 3ERVA 2DCBA 1PIPA 4CDDB 5FPWA 2FT2A 1PPDA 3LTWA 1EWLA 4W5BA 1GECE 4X6JA 7PCKA 4X6HA 4XUIA 1F2AA 4B55A 3D9WA 1TL9A 3H8BA 3BPFA 1Y08A 1MHWA 1CV8A 2AVWA 6PADA 2NQAA 5CVNB 4AXLA 1AU0A 2YJ9A 2VFCA 4N8WA 2P0RA 3O0UA 2FUDA 3B79A 2NQIA 3KW9A 1EF7A 3P5WA 1E2TA 1DEUA 1F2BA 1BGOA 4C5PA 1ZIVA 4W4UA 2AUZA 2AU1A 2PNSA 4BPVA 1MS6A 4I05A 3PDFA 1NLJA 3U8EA 2R9CA 5CHTA 1PPOA 4CDEB 3QJ3A 3IV2A 5A24A 4PADA 3H8CA 3MHSA 4OEMA 3BC3A 1VJVA 2JQFR 1HUCB 2DCAA 3KFQA 1PPPA 1AYUA 3CBKA 4P6GA 3H7DA 2YJ8A 2E02A 4QRXA 4N4ZA 3NHEA 1U9QX 2FYEA 5PADA 1NB5A 1CB5A 3V6EA 4YV8A 4X6IA 1KXRA 1YK7A 3M99A 4MZOA 4BQVA 2R9FA 4FIPA 4N79A 1TLOA 1TU6A 2BDLA 1PCIA 1MDWA 1QXPA 3IHPA 4QRGA 1CJLA 1U9XA 4I07A 5CVMA 3N3GA 2XU1A 2YJBA 2E03A 3OISA 3KSEA 5JA7A 3OF8A 2ARYA 2Y5BA 3OF9A 4FJCA 4YVAA 1F29A 1Q6KA 3RVWA 1F2CA 1JQPA 5F02A 4DMYA 2DC6A 1X9YA 1CS8A 5J94A 1ME4A 1AYVA 2XU5A 1AYWA 2DC9A 1PBHA 2GFOA 1W4TA 1NB3A 2DC8A 2DJFB 2DCCA 3KWBX 2AS8A 2B1NA 9PAPA 3IEJA 1PE6A 1KFXL 1KFUL 4QRVA 2AYNA 4BS6A 1YT7A 3IOQA 1AU3A 1ZCMA 4WA6A 3RVXA 2G8EA 4PP2E 1GLOA 1KHQA 1ICFA 4BSQA 3HD3A 4Q8GA 1PXVA 1PPNA 3CH3X 4YYRA 1VSNA 1GMYA 2DZZA 4ZUXU 3GCBA 3LXSA 3KX1A 3S3QA 1QMYA 4OELA 3K8UA 3CH2X 1CQDA 3DF0A 2P86A 2PBHA 3F75A 3I3TA 3IUTA 2F1GA 2FO5A 3RVVA 1Y4HA 1YVBA 2IPPB 1YK8A 4Q8HA 2VHSA 2Y6EA 4RY2A 4YYUA 3QSDA 3HHAA 2BSZA 2F7DA 1MEMA 2E01A 2C0YA 3CBJA 2NQGA 4YYVA 1NQCA 3WXEA 2CIOA 4CZWA 3OVZA 2AYOA 3PW3A 4P6EA 4CDCB 5CVOB 2HH5A 3P5XA 1NPZA 4HWYA 1AU4A 1O0EA 4MZSA 3MORA 2WBFX 3WXFA 1MIRA 3KKUA 1DF0A 1M6DA 4PP1A 2HHNA 3I06A 4NV7A 3MTNA 3N4CA 1QOLA 2VFBA 4KLBA 1A6RA 3P5VA 2JQGR 2O6XA 2P7UA 4YYWA 3AI8A 3PNRA 3F5VA 5K16A 3K24A 3V6CA 4QH6A 1SNKA 1BY8A 3KWZA 2B1MA 3BWKA 1QDQA 2DZYA 3E1ZB 2G8JA 1NL6A 1KHPA 4NV8A 2GHUA 2AUXA 1PADA 2HXZA 3O1GA 2OZ2A 1POPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I04 A;  2AIM A;  5CHV A;  2OUL A;  1EWM A;  3BOW A;  1AU2 A;  3H6S A;  4AXM A;  2FRA A;  1CPJ A;  1BP4 A;  2IBI A;  8PCH A;  2R9O A;  2VHF A;  2HD5 A;  3BPM A;  1CSB B;  3ZUA A;  3BCN A;  4XR7 A;  1U5I A;  1EWP A;  5JH3 A;  2ACT A;  1CVZ A;  3D6S A;  4G54 A;  3IMA A;  1THE A;  1MEG A;  1ATK A;  2XU3 A;  2DJG B;  2DCD A;  1STF E;  3H89 A;  1U9W A;  1U9V A;  3C9E A;  1CTE A;  3PBH A;  2OP3 A;  1ME3 A;  4K7C A;  1IWD A;  4CDF B;  2G6D A;  2FQ9 A;  1K3B B;  4MSX A;  2FRQ A;  2CB5 A;  3TNX A;  1EWO A;  3HWN A;  4W5C A;  2NQD B;  3MHH A;  3S3R A;  3HHI A;  2ATO A;  2BDZ A;  1YAL A;  2H7J A;  4YYQ A;  1SP4 B;  4FK5 A;  5EGW A;  1GCB A;  3N3K A;  3P5U A;  2DC7 A;  2R9N A;  3OVX A;  2G7Y A;  2YJC A;  1AEC A;  1XKG A;  3QT4 A;  2R9M A;  1ITO A;  2YJ2 A;  2FTD A;  4QBB A;  2R6N A;  3LFY A;  3WXG A;  4YYS A;  4DMX A;  2PAD A;  2PRE A;  1AIM A;  3K9M A;  3USV A;  2E00 A;  5EF4 A;  1S4V A;  2XU4 A;  4BS5 A;  4PI3 A;  1BQI A;  1FH0 A;  3ERV A;  2DCB A;  1PIP A;  4CDD B;  5FPW A;  2FT2 A;  1PPD A;  1EWL A;  4W5B A;  1GEC E;  4X6J A;  7PCK A;  4X6H A;  4XUI A;  1F2A A;  1TL9 A;  3H8B A;  3BPF A;  1Y08 A;  1MHW A;  1CV8 A;  2AVW A;  6PAD A;  2NQA A;  5CVN B;  4AXL A;  1AU0 A;  2YJ9 A;  4N8W A;  2P0R A;  3O0U A;  2FUD A;  3B79 A;  2NQI A;  3KW9 A;  1EF7 A;  3P5W A;  1DEU A;  1F2B A;  1BGO A;  1ZIV A;  4W4U A;  2AUZ A;  2AU1 A;  2PNS A;  4BPV A;  1MS6 A;  4I05 A;  3PDF A;  1NLJ A;  3U8E A;  2R9C A;  5CHT A;  1PPO A;  4CDE B;  3QJ3 A;  3IV2 A;  5A24 A;  4PAD A;  3H8C A;  3MHS A;  4OEM A;  3BC3 A;  1VJV A;  2JQF R;  1HUC B;  2DCA A;  3KFQ A;  1PPP A;  1AYU A;  3CBK A;  4P6G A;  3H7D A;  2YJ8 A;  2E02 A;  4QRX A;  4N4Z A;  3NHE A;  5PAD A;  1U9Q X;  2FYE A;  1NB5 A;  1CB5 A;  3V6E A;  4YV8 A;  4X6I A;  1KXR A;  1YK7 A;  3M99 A;  4MZO A;  4BQV A;  2R9F A;  4FIP A;  4N79 A;  1TLO A;  1TU6 A;  2BDL A;  1PCI A;  1MDW A;  1QXP A;  3IHP A;  4QRG A;  1CJL A;  1U9X A;  4I07 A;  5CVM A;  3N3G A;  2XU1 A;  2YJB A;  2E03 A;  3OIS A;  3KSE A;  5JA7 A;  3OF8 A;  2ARY A;  2Y5B A;  3OF9 A;  4FJC A;  4YVA A;  1F29 A;  1Q6K A;  3RVW A;  1F2C A;  1JQP A;  5F02 A;  4DMY A;  2DC6 A;  1X9Y A;  1CS8 A;  5J94 A;  1ME4 A;  1AYV A;  2XU5 A;  1AYW A;  2DC9 A;  1PBH A;  2GFO A;  1NB3 A;  2DC8 A;  2DJF B;  2DCC A;  3KWB X;  2AS8 A;  2B1N A;  9PAP A;  3IEJ A;  1PE6 A;  1KFX L;  1KFU L;  4QRV A;  2AYN A;  4BS6 A;  1YT7 A;  3IOQ A;  1AU3 A;  1ZCM A;  4WA6 A;  3RVX A;  2G8E A;  4PP2 E;  1GLO A;  1KHQ A;  1ICF A;  4BSQ A;  3HD3 A;  4Q8G A;  1PXV A;  1PPN A;  3CH3 X;  4YYR A;  1VSN A;  1GMY A;  2DZZ A;  4ZUX U;  3GCB A;  3LXS A;  3KX1 A;  3S3Q A;  1QMY A;  4OEL A;  3K8U A;  3CH2 X;  1CQD A;  3DF0 A;  2P86 A;  2PBH A;  3F75 A;  3I3T A;  3IUT A;  2F1G A;  2FO5 A;  3RVV A;  1Y4H A;  1YVB A;  2IPP B;  1YK8 A;  4Q8H A;  2VHS A;  2Y6E A;  4RY2 A;  4YYU A;  3QSD A;  3HHA A;  2F7D A;  1MEM A;  2E01 A;  2C0Y A;  3CBJ A;  2NQG A;  4YYV A;  1NQC A;  3WXE A;  2CIO A;  4CZW A;  3OVZ A;  2AYO A;  3PW3 A;  4P6E A;  4CDC B;  5CVO B;  2HH5 A;  3P5X A;  1NPZ A;  4HWY A;  1AU4 A;  1O0E A;  4MZS A;  3MOR A;  2WBF X;  3WXF A;  1MIR A;  3KKU A;  1DF0 A;  1M6D A;  4PP1 A;  2HHN A;  3I06 A;  3MTN A;  3N4C A;  1QOL A;  4KLB A;  1A6R A;  3P5V A;  2JQG R;  2O6X A;  2P7U A;  4YYW A;  3AI8 A;  3PNR A;  3F5V A;  5K16 A;  3K24 A;  3V6C A;  4QH6 A;  1SNK A;  1BY8 A;  3KWZ A;  2B1M A;  3BWK A;  1QDQ A;  2DZY A;  3E1Z B;  2G8J A;  1NL6 A;  1KHP A;  2GHU A;  2AUX A;  1PAD A;  2HXZ A;  3O1G A;  2OZ2 A;  1POP A; 
#chains in the Genus database with same CATH topology
 4I04 A;  2AIM A;  4OVZ A;  5CHV A;  2OUL A;  1EWM A;  3BOW A;  1AU2 A;  3H6S A;  4AXM A;  2JTC A;  2FRA A;  1CPJ A;  1BP4 A;  2IBI A;  3PT2 A;  8PCH A;  2R9O A;  2VHF A;  2HD5 A;  4IP3 A;  3BPM A;  1CSB B;  3ZUA A;  3BCN A;  4XR7 A;  1U5I A;  1EWP A;  5JH3 A;  2ACT A;  1CVZ A;  4ZTB A;  3D6S A;  4G54 A;  3IMA A;  1THE A;  1MEG A;  4PT5 A;  1ATK A;  2XU3 A;  2DJG B;  2DCD A;  4RKX A;  1STF E;  3H89 A;  3MTV A;  1U9W A;  1U9V A;  3C9E A;  1CTE A;  3PHX A;  3PBH A;  2OP3 A;  1ME3 A;  4K7C A;  1IWD A;  4CDF B;  2G6D A;  2FQ9 A;  4RNA A;  1K3B B;  4MSX A;  2FRQ A;  2CB5 A;  3TNX A;  1EWO A;  3HWN A;  4W5C A;  2NQD B;  3MHH A;  3S3R A;  3HHI A;  2ATO A;  2BDZ A;  1YAL A;  2H7J A;  4YYQ A;  2AGA A;  1PVJ A;  1SP4 B;  4FK5 A;  4RF1 A;  5EGW A;  1GCB A;  3N3K A;  2HWK A;  3P5U A;  2DC7 A;  2R9N A;  3OVX A;  2G7Y A;  2YJC A;  1AEC A;  1XKG A;  3QT4 A;  2R9M A;  1ITO A;  4IUM A;  3W31 A;  2YJ2 A;  2FTD A;  4QBB A;  4BOS A;  2R6N A;  3LFY A;  3WXG A;  4BOP A;  4YYS A;  4DMX A;  4BOZ A;  2PAD A;  2PRE A;  2JRI A;  1AIM A;  3K9M A;  3PHW A;  3USV A;  2E00 A;  1UKF A;  5EF4 A;  1S4V A;  2XU4 A;  4BS5 A;  4PI3 A;  1BQI A;  1FH0 A;  3ERV A;  4D8B A;  2DCB A;  1PIP A;  4CDD B;  5FPW A;  2FT2 A;  1PPD A;  3PHU A;  1EWL A;  4W5B A;  1GEC E;  4X6J A;  3B21 A;  7PCK A;  3OQC A;  4X6H A;  4XUI A;  1F2A A;  1TL9 A;  2BU3 A;  3H8B A;  3BPF A;  1Y08 A;  1MHW A;  1CV8 A;  2AVW A;  6PAD A;  2NQA A;  4MM3 B;  5CVN B;  4AXL A;  1AU0 A;  2YJ9 A;  4N8W A;  2P0R A;  4XZX A;  3O0U A;  2FUD A;  3B79 A;  2NQI A;  3KW9 A;  1EF7 A;  3P5W A;  1DEU A;  1F2B A;  1BGO A;  1ZIV A;  4W4U A;  2AUZ A;  2AU1 A;  2PNS A;  4BPV A;  3ZNH A;  1MS6 A;  4I05 A;  3PDF A;  1NLJ A;  3U8E A;  2R9C A;  5CHT A;  1PPO A;  4CDE B;  4R3D A;  3QJ3 A;  3IV2 A;  5A24 A;  4PAD A;  3H8C A;  3MHS A;  4OEM A;  3BC3 A;  1VJV A;  2JQF R;  1HUC B;  2DCA A;  3KFQ A;  1PPP A;  1AYU A;  3CBK A;  4P6G A;  3H7D A;  2YJ8 A;  2E02 A;  4QRX A;  4N4Z A;  4RF0 A;  3C0R A;  3NHE A;  1U9Q X;  2FYE A;  5PAD A;  1NB5 A;  1CB5 A;  4WUR A;  3V6E A;  4YV8 A;  2Z84 A;  5KO3 A;  4X6I A;  1KXR A;  1YK7 A;  3M99 A;  4MZO A;  4BQV A;  4REZ A;  2R9F A;  3PRP A;  4FIP A;  4N79 A;  1TLO A;  1DKI A;  1TU6 A;  2BDL A;  2DOS A;  4GUA A;  1PCI A;  1MDW A;  5EZQ A;  1QXP A;  3IHP A;  4QRG A;  1CJL A;  4BOQ A;  1U9X A;  4I07 A;  5CVM A;  3N3G A;  4D8E A;  2XU1 A;  2YJB A;  2E03 A;  3OIS A;  3KSE A;  4BOU A;  5JA7 A;  3OF8 A;  2ARY A;  4P16 A;  4M0W A;  2Y5B A;  3OF9 A;  4FJC A;  2J7Q C;  4YVA A;  1F29 A;  4MI7 A;  1Q6K A;  3RVW A;  1F2C A;  1JQP A;  5F02 A;  4DMY A;  2DC6 A;  2J7Q A;  1X9Y A;  1CS8 A;  5J94 A;  1ME4 A;  1AYV A;  2XU5 A;  3W30 A;  1AYW A;  2DC9 A;  1PBH A;  2GFO A;  1NB3 A;  2DC8 A;  2DJF B;  2DCC A;  3PSE A;  4A5U A;  3KWB X;  2AS8 A;  2B1N A;  9PAP A;  3IEJ A;  1PE6 A;  1KFX L;  1KFU L;  2BTW B;  4QRV A;  2AYN A;  4BS6 A;  1YT7 A;  3IOQ A;  1AU3 A;  1ZCM A;  3MJ5 A;  4WA6 A;  3RVX A;  2G8E A;  4PP2 E;  1GLO A;  1KHQ A;  1ICF A;  3TMP A;  4BSQ A;  3HD3 A;  4Q8G A;  1PXV A;  1PPN A;  3CH3 X;  4YYR A;  1VSN A;  1GMY A;  2DZZ A;  4ZUX U;  5E6J A;  3GCB A;  3LXS A;  3KX1 A;  3S3Q A;  1QMY A;  4OEL A;  3K8U A;  3CH2 X;  1CQD A;  3DF0 A;  2P86 A;  2PBH A;  3F75 A;  3I3T A;  3IUT A;  2F1G A;  2FO5 A;  3RVV A;  1Y4H A;  1YVB A;  2IPP B;  1YK8 A;  4Q8H A;  2VHS A;  4OW0 A;  4OVZ B;  2Y6E A;  4RY2 A;  4YYU A;  3QSD A;  3HHA A;  3E9S A;  2F7D A;  1MEM A;  2E01 A;  2C0Y A;  3BBA A;  3CBJ A;  3BB7 A;  2NQG A;  4YYV A;  4D8I A;  1NQC A;  3WXE A;  2CIO A;  4CZW A;  4HXD B;  3OVZ A;  2AYO A;  3PW3 A;  4P6E A;  4CDC B;  3BY4 A;  5CVO B;  1YZB A;  2HH5 A;  3P5X A;  3O65 A;  1NPZ A;  4HWY A;  3IFU A;  3RNV A;  1AU4 A;  1O0E A;  5EZS A;  2FE8 A;  4MZS A;  3MOR A;  2WBF X;  3TRK A;  3WXF A;  2UZJ A;  1MIR A;  3KKU A;  1DF0 A;  1M6D A;  4PP1 A;  2HHN A;  3I06 A;  3MTN A;  3N4C A;  2BTW A;  1QOL A;  4KLB A;  1A6R A;  3PRM A;  3P5V A;  2JQG R;  2O6X A;  3MP2 A;  2P7U A;  3AI8 A;  4YYW A;  3PNR A;  3F5V A;  5K16 A;  3K24 A;  3V6C A;  4QH6 A;  1SNK A;  1BY8 A;  3KWZ A;  2B1M A;  3BWK A;  1QDQ A;  2DZY A;  3E1Z B;  2G8J A;  1NL6 A;  1KHP A;  2GHU A;  2AUX A;  1PAD A;  2HXZ A;  3O1G A;  5JZE A;  2OZ2 A;  1POP A; 
#chains in the Genus database with same CATH homology
 4I04 A;  2AIM A;  5CHV A;  2OUL A;  1EWM A;  3BOW A;  1AU2 A;  3H6S A;  4AXM A;  2FRA A;  1CPJ A;  1BP4 A;  2IBI A;  8PCH A;  2R9O A;  2VHF A;  2HD5 A;  3BPM A;  1CSB B;  3ZUA A;  3BCN A;  4XR7 A;  1U5I A;  1EWP A;  5JH3 A;  2ACT A;  1CVZ A;  3D6S A;  4G54 A;  3IMA A;  1THE A;  1MEG A;  1W5R A;  1ATK A;  2XU3 A;  2DJG B;  2DCD A;  1STF E;  3H89 A;  1U9W A;  4BGF A;  1U9V A;  3C9E A;  1CTE A;  3PBH A;  2OP3 A;  1ME3 A;  4K7C A;  4GUZ A;  1IWD A;  4CDF B;  2G6D A;  2FQ9 A;  1K3B B;  4MSX A;  2FRQ A;  2CB5 A;  3TNX A;  1EWO A;  3HWN A;  4W5C A;  2NQD B;  3MHH A;  3S3R A;  3HHI A;  2ATO A;  1W6F A;  2BDZ A;  1YAL A;  2H7J A;  4YYQ A;  1SP4 B;  4FK5 A;  5EGW A;  1GCB A;  3N3K A;  3P5U A;  2DC7 A;  2R9N A;  3OVX A;  2G7Y A;  2YJC A;  1AEC A;  1XKG A;  3QT4 A;  2R9M A;  1ITO A;  2YJ2 A;  2FTD A;  4QBB A;  2R6N A;  3LFY A;  3WXG A;  4YYS A;  4DMX A;  2PAD A;  2PRE A;  1AIM A;  3K9M A;  1GX3 A;  3USV A;  2E00 A;  5EF4 A;  1S4V A;  2XU4 A;  4BS5 A;  4PI3 A;  1BQI A;  1FH0 A;  3ERV A;  2DCB A;  1PIP A;  4CDD B;  5FPW A;  2FT2 A;  1PPD A;  3LTW A;  1EWL A;  4W5B A;  1GEC E;  4X6J A;  7PCK A;  4X6H A;  4XUI A;  1F2A A;  4B55 A;  3D9W A;  1TL9 A;  3H8B A;  3BPF A;  1Y08 A;  1MHW A;  1CV8 A;  2AVW A;  6PAD A;  2NQA A;  5CVN B;  4AXL A;  1AU0 A;  2YJ9 A;  2VFC A;  4N8W A;  2P0R A;  3O0U A;  2FUD A;  3B79 A;  2NQI A;  3KW9 A;  1EF7 A;  3P5W A;  1E2T A;  1DEU A;  1F2B A;  1BGO A;  4C5P A;  1ZIV A;  4W4U A;  2AUZ A;  2AU1 A;  2PNS A;  4BPV A;  1MS6 A;  4I05 A;  3PDF A;  1NLJ A;  3U8E A;  2R9C A;  5CHT A;  1PPO A;  4CDE B;  3QJ3 A;  3IV2 A;  5A24 A;  4PAD A;  3H8C A;  3MHS A;  4OEM A;  3BC3 A;  1VJV A;  2JQF R;  1HUC B;  2DCA A;  3KFQ A;  1PPP A;  1AYU A;  3CBK A;  4P6G A;  3H7D A;  2YJ8 A;  2E02 A;  4QRX A;  4N4Z A;  3NHE A;  1U9Q X;  2FYE A;  5PAD A;  1NB5 A;  1CB5 A;  3V6E A;  4YV8 A;  4X6I A;  1KXR A;  1YK7 A;  3M99 A;  4MZO A;  4BQV A;  2R9F A;  4FIP A;  4N79 A;  1TLO A;  1TU6 A;  2BDL A;  1PCI A;  1MDW A;  1QXP A;  3IHP A;  4QRG A;  1CJL A;  1U9X A;  4I07 A;  5CVM A;  3N3G A;  2XU1 A;  2YJB A;  2E03 A;  3OIS A;  3KSE A;  5JA7 A;  3OF8 A;  2ARY A;  2Y5B A;  3OF9 A;  4FJC A;  4YVA A;  1F29 A;  1Q6K A;  3RVW A;  1F2C A;  1JQP A;  5F02 A;  4DMY A;  2DC6 A;  1X9Y A;  1CS8 A;  5J94 A;  1ME4 A;  1AYV A;  2XU5 A;  1AYW A;  2DC9 A;  1PBH A;  2GFO A;  1W4T A;  1NB3 A;  2DC8 A;  2DJF B;  2DCC A;  3KWB X;  2AS8 A;  2B1N A;  9PAP A;  3IEJ A;  1PE6 A;  1KFX L;  1KFU L;  4QRV A;  2AYN A;  4BS6 A;  1YT7 A;  3IOQ A;  1AU3 A;  1ZCM A;  4WA6 A;  3RVX A;  2G8E A;  4PP2 E;  1GLO A;  1KHQ A;  1ICF A;  4BSQ A;  3HD3 A;  4Q8G A;  1PXV A;  1PPN A;  3CH3 X;  4YYR A;  1VSN A;  1GMY A;  2DZZ A;  4ZUX U;  3GCB A;  3LXS A;  3KX1 A;  3S3Q A;  1QMY A;  4OEL A;  3K8U A;  3CH2 X;  1CQD A;  3DF0 A;  2P86 A;  2PBH A;  3F75 A;  3I3T A;  3IUT A;  2F1G A;  2FO5 A;  3RVV A;  1Y4H A;  1YVB A;  2IPP B;  1YK8 A;  4Q8H A;  2VHS A;  2Y6E A;  4RY2 A;  4YYU A;  3QSD A;  3HHA A;  2BSZ A;  2F7D A;  1MEM A;  2E01 A;  2C0Y A;  3CBJ A;  2NQG A;  4YYV A;  1NQC A;  3WXE A;  2CIO A;  4CZW A;  3OVZ A;  2AYO A;  3PW3 A;  4P6E A;  4CDC B;  5CVO B;  2HH5 A;  3P5X A;  1NPZ A;  4HWY A;  1AU4 A;  1O0E A;  4MZS A;  3MOR A;  2WBF X;  3WXF A;  1MIR A;  3KKU A;  1DF0 A;  1M6D A;  4PP1 A;  2HHN A;  3I06 A;  4NV7 A;  3MTN A;  3N4C A;  1QOL A;  2VFB A;  4KLB A;  1A6R A;  3P5V A;  2JQG R;  2O6X A;  2P7U A;  4YYW A;  3AI8 A;  3PNR A;  3F5V A;  5K16 A;  3K24 A;  3V6C A;  4QH6 A;  1SNK A;  1BY8 A;  3KWZ A;  2B1M A;  3BWK A;  1QDQ A;  2DZY A;  3E1Z B;  2G8J A;  1NL6 A;  1KHP A;  4NV8 A;  2GHU A;  2AUX A;  1PAD A;  2HXZ A;  3O1G A;  2OZ2 A;  1POP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...