1CSBB

Crystal structure of cathepsin b inhibited with ca030 at 2.1 angstroms resolution: a basis for the design of specific epoxysuccinyl inhibitors
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
205
structure length
205
Chain Sequence
b'VSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATHEPSIN B light chain
publication title Crystal structure of cathepsin B inhibited with CA030 at 2.0-A resolution: A basis for the design of specific epoxysuccinyl inhibitors.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 46
structure length 205
sequence length 205
chains with identical sequence E
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 1994-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1csbB00
4X6JA 2HD5A 1SNKA 3I3TA 3N3GA 2OP3A 3NHEA 1PBHA 2FO5A 1YT7A 4BQVA 3RVVA 2XU4A 1EWPA 4X6IA 2DC8A 2R9NA 4PADA 5JA7A 3H6SA 3BPFA 2CIOA 1GECE 3PBHA 2Y5BA 2G7YA 1GCBA 2B1MA 3WXEA 5FPWA 2ATOA 2DC6A 4DMXA 1BY8A 5CVMA 5A24A 3IEJA 1Y08A 5EGWA 4FIPA 8PCHA 3CH2X 4QRXA 1TL9A 2VHFA 1CSBB 4YYRA 1F2AA 2G8JA 1THEA 3LFYA 1NQCA 3C9EA 2E03A 4W4UA 2OZ2A 4Q8GA 1TU6A 1U9WA 3B79A 2GHUA 3H8BA 3HHAA 2IPPB 1KFUL 4PP2E 1Q6KA 4P6EA 3IV2A 2R6NA 2YJ8A 4KLBA 2NQGA 4AXLA 1CV8A 4BS5A 4MSXA 2DCCA 3KX1A 3AI8A 1BP4A 3BWKA 2E01A 3RVWA 2AUZA 4MZSA 3K8UA 3IHPA 1GLOA 3K24A 2WBFX 5CHVA 3KWZA 3P5XA 1F2CA 3OVZA 2DC9A 1KFXL 4OELA 4W5BA 1U9QX 1MIRA 3KKUA 1EWLA 3IOQA 5K16A 1POPA 4HWYA 2AVWA 3PW3A 4YYSA 1O0EA 3P5VA 2AUXA 2G6DA 2FUDA 3O1GA 2PNSA 2DCBA 1NL6A 1U9VA 4N8WA 2AU1A 2NQIA 2Y6EA 1ZCMA 1PE6A 1GMYA 1EWMA 1ME3A 2HH5A 4Q8HA 1ICFA 2P86A 1F29A 1KHPA 3CBKA 2R9CA 3HHIA 5CVNB 2AIMA 1AYWA 3ERVA 5CHTA 2FYEA 1TLOA 4YYQA 3OF8A 4YV8A 1PPPA 3KW9A 1AU0A 1XKGA 3WXGA 3P5UA 3S3RA 2R9FA 1YALA 4K7CA 2YJ2A 3MHHA 3QT4A 1AU2A 4I05A 4BS6A 1VSNA 1CVZA 4X6HA 1EWOA 1S4VA 2DCDA 2YJ9A 2JQGR 1YK7A 4P6GA 3TNXA 4CDEB 2B1NA 1X9YA 2XU3A 1ATKA 3USVA 1K3BB 1MEGA 1QOLA 1MHWA 3QJ3A 2AS8A 2NQAA 4PP1A 1F2BA 2XU5A 9PAPA 1ZIVA 4XR7A 1AIMA 2DZYA 1FH0A 1DEUA 2H7JA 1QMYA 3E1ZB 4QRGA 1NPZA 3ZUAA 1U9XA 2FRQA 1STFE 2AYNA 1M6DA 3V6CA 2GFOA 1U5IA 5J94A 2DJGB 4YYUA 2FRAA 3MORA 1NLJA 2FTDA 3PDFA 4G54A 1QDQA 2BDLA 4N79A 2DCAA 2XU1A 2YJCA 1Y4HA 3BOWA 1YK8A 3U8EA 3M99A 3QSDA 1EF7A 4YVAA 2FT2A 2HHNA 2R9OA 1PADA 3DF0A 1BQIA 2CB5A 1AYUA 3PNRA 1VJVA 2R9MA 1SP4B 4CDFB 3KWBX 3GCBA 2G8EA 4N4ZA 5CVOB 3CBJA 4YYWA 5JH3A 1CPJA 1A6RA 2P0RA 7PCKA 1CJLA 2DC7A 3KFQA 2VHSA 3MTNA 4I04A 1CTEA 2ACTA 2BDZA 1JQPA 4FJCA 1NB5A 1KHQA 3HWNA 3LXSA 3P5WA 3CH3X 2O6XA 1MDWA 3F75A 4BSQA 3H8CA 3N4CA 4AXMA 3BC3A 1PCIA 1PIPA 2PADA 4QBBA 2FQ9A 4QRVA 2DZZA 1CQDA 2F7DA 4BPVA 3BPMA 2PBHA 4I07A 1CB5A 5F02A 3OF9A 4YYVA 3H89A 3KSEA 4WA6A 1IWDA 2E00A 1YVBA 1KXRA 2C0YA 1BGOA 1MS6A 1AECA 2AYOA 3S3QA 3WXFA 3N3KA 2HXZA 4OEMA 2IBIA 3IMAA 3K9MA 3OVXA 4W5CA 3MHSA 1AU4A 3RVXA 4RY2A 3BCNA 2F1GA 1AU3A 6PADA 3D6SA 3I06A 1PXVA 2ARYA 1HUCB 4FK5A 2YJBA 3V6EA 4PI3A 5PADA 5EF4A 3F5VA 2OULA 4CDCB 1PPOA 3O0UA 3IUTA 1DF0A 1AYVA 4CDDB 2E02A 1QXPA 2P7UA 1CS8A 1PPDA 4DMYA 1MEMA 4ZUXU 2DJFB 1PPNA 4CZWA 3HD3A 1NB3A 2JQFR 3OISA 2NQDB 3H7DA 4MZOA 4XUIA 4QH6A 1ITOA 1ME4A 2PREA
chains in the Genus database with same CATH superfamily
4X6JA 2HD5A 1SNKA 3I3TA 4WURA 3N3GA 2OP3A 4IUMA 3NHEA 4RF0A 1PBHA 2FO5A 1YT7A 4BQVA 3MTVA 3RVVA 2XU4A 1EWPA 4X6IA 2DC8A 2R9NA 4PADA 4REZA 3BY4A 5JA7A 3H6SA 3BPFA 2CIOA 1GECE 3PBHA 2Y5BA 2G7YA 4OW0A 1GCBA 2B1MA 3WXEA 5FPWA 2ATOA 2DC6A 4DMXA 1BY8A 2JRIA 1PVJA 5CVMA 5A24A 3IEJA 4PT5A 1Y08A 5EGWA 4FIPA 8PCHA 3CH2X 4QRXA 1TL9A 2VHFA 1CSBB 3O65A 4YYRA 1F2AA 2G8JA 1THEA 3PT2A 3LFYA 1NQCA 4RKXA 3C9EA 4HXDB 2E03A 4W4UA 2OZ2A 4OVZB 2HWKA 2UZJA 4Q8GA 1TU6A 1U9WA 3B79A 4P16A 2GHUA 3H8BA 3HHAA 2IPPB 1KFUL 4PP2E 1Q6KA 4P6EA 3IV2A 2R6NA 2YJ8A 4RNAA 4KLBA 2NQGA 4AXLA 1CV8A 4BS5A 4MSXA 3OQCA 2BU3A 2DCCA 3KX1A 3TMPA 4IP3A 3PHWA 4OVZA 3AI8A 3MJ5A 1BP4A 3BWKA 2E01A 3RVWA 2AUZA 4MZSA 3K8UA 3IHPA 1GLOA 3K24A 2WBFX 5CHVA 3E9SA 2J7QA 3KWZA 3P5XA 1F2CA 3OVZA 3BB7A 2DC9A 5EZQA 1KFXL 4OELA 4W5BA 3W31A 1U9QX 1MIRA 3KKUA 1EWLA 3IOQA 5K16A 1POPA 4HWYA 2AVWA 3PW3A 4YYSA 1O0EA 3P5VA 3BBAA 2AUXA 4RF1A 2G6DA 2FUDA 3O1GA 2PNSA 2DCBA 1NL6A 2Z84A 1U9VA 4N8WA 2AU1A 2NQIA 2Y6EA 4XZXA 1ZCMA 1DKIA 1PE6A 1GMYA 1EWMA 1ME3A 2HH5A 4Q8HA 1ICFA 2P86A 1F29A 3PRPA 1KHPA 3CBKA 4D8EA 2R9CA 3HHIA 5CVNB 2AIMA 4ZTBA 1AYWA 3ERVA 5CHTA 2FYEA 1TLOA 4YYQA 3OF8A 4YV8A 1PPPA 3KW9A 2JTCA 1AU0A 1XKGA 3WXGA 3P5UA 3C0RA 3S3RA 2R9FA 1YALA 4K7CA 2FE8A 2YJ2A 3MHHA 3QT4A 1AU2A 4I05A 4BS6A 1VSNA 1CVZA 4X6HA 1EWOA 1S4VA 2DCDA 2YJ9A 2JQGR 5JZEA 1YK7A 3PHUA 4P6GA 3TNXA 4CDEB 2B1NA 1X9YA 2XU3A 1ATKA 3USVA 1K3BB 1MEGA 1QOLA 2J7QC 1MHWA 3QJ3A 5EZSA 2AS8A 2NQAA 4PP1A 1F2BA 2XU5A 9PAPA 1ZIVA 4XR7A 1AIMA 2DZYA 1FH0A 1DEUA 2H7JA 1QMYA 3E1ZB 4QRGA 1NPZA 3ZUAA 1U9XA 2FRQA 1STFE 2AYNA 1M6DA 3V6CA 4MM3B 2GFOA 1UKFA 1U5IA 5J94A 2DJGB 4YYUA 2FRAA 3MORA 1NLJA 2AGAA 2FTDA 3PDFA 4G54A 1QDQA 2BDLA 4N79A 2DCAA 2XU1A 2YJCA 1Y4HA 3BOWA 1YK8A 3U8EA 4BOPA 3M99A 3QSDA 3TRKA 1EF7A 4YVAA 2FT2A 4BOQA 2HHNA 2R9OA 1PADA 3DF0A 1BQIA 2CB5A 1AYUA 3PNRA 1VJVA 2R9MA 1SP4B 4CDFB 3KWBX 3GCBA 2G8EA 4N4ZA 5CVOB 3CBJA 4YYWA 5JH3A 1CPJA 1A6RA 2P0RA 7PCKA 2DOSA 1CJLA 2DC7A 3KFQA 5E6JA 2VHSA 3MTNA 4D8BA 4I04A 5KO3A 1CTEA 2ACTA 3MP2A 2BDZA 1JQPA 4FJCA 1NB5A 1KHQA 3HWNA 3LXSA 3P5WA 3CH3X 2O6XA 1MDWA 3PSEA 3F75A 4BSQA 3H8CA 3B21A 3N4CA 4AXMA 3BC3A 1PCIA 1PIPA 2PADA 4QBBA 2FQ9A 4QRVA 2DZZA 1CQDA 2F7DA 2BTWB 4BPVA 3BPMA 2PBHA 4I07A 1CB5A 5F02A 3OF9A 4YYVA 3H89A 3KSEA 3IFUA 4WA6A 1IWDA 2E00A 1YZBA 1YVBA 4M0WA 1KXRA 2C0YA 1BGOA 3RNVA 3PRMA 1MS6A 1AECA 2AYOA 3PHXA 4A5UA 3S3QA 4GUAA 4R3DA 2BTWA 3WXFA 3N3KA 3W30A 2HXZA 4D8IA 4OEMA 2IBIA 3IMAA 3K9MA 3OVXA 4W5CA 3MHSA 1AU4A 3RVXA 4RY2A 3BCNA 2F1GA 4MI7A 1AU3A 6PADA 3D6SA 3I06A 1PXVA 4BOZA 2ARYA 1HUCB 4FK5A 2YJBA 3V6EA 4PI3A 5PADA 5EF4A 3F5VA 2OULA 4CDCB 1PPOA 3O0UA 3ZNHA 3IUTA 1DF0A 1AYVA 4CDDB 2E02A 1QXPA 2P7UA 1CS8A 1PPDA 4BOSA 4BOUA 4DMYA 1MEMA 4ZUXU 2DJFB 1PPNA 4CZWA 3HD3A 1NB3A 2JQFR 3OISA 2NQDB 3H7DA 4MZOA 4XUIA 4QH6A 1ITOA 1ME4A 2PREA
chains in the Genus database with same CATH topology
4X6JA 2HD5A 1SNKA 3I3TA 3N3GA 2OP3A 3NHEA 1PBHA 2FO5A 1YT7A 4BQVA 3RVVA 2XU4A 1EWPA 4X6IA 2DC8A 2R9NA 4PADA 5JA7A 3H6SA 3BPFA 2CIOA 1GECE 3PBHA 2Y5BA 2G7YA 1GCBA 2B1MA 3WXEA 5FPWA 2ATOA 2DC6A 4DMXA 1BY8A 5CVMA 5A24A 3IEJA 1Y08A 5EGWA 4FIPA 8PCHA 3CH2X 4QRXA 1TL9A 2VHFA 1CSBB 4YYRA 1F2AA 2G8JA 1THEA 3LFYA 1NQCA 3C9EA 2E03A 4W4UA 2OZ2A 4Q8GA 1TU6A 1U9WA 3B79A 2GHUA 3H8BA 3HHAA 2IPPB 1KFUL 4PP2E 1Q6KA 4P6EA 3IV2A 2R6NA 2YJ8A 4KLBA 2NQGA 4AXLA 1CV8A 4BS5A 4MSXA 2DCCA 3KX1A 3AI8A 1BP4A 3BWKA 2E01A 3RVWA 2AUZA 4BGFA 4MZSA 3K8UA 3IHPA 1GLOA 3K24A 2WBFX 5CHVA 3LTWA 3KWZA 3P5XA 1F2CA 3OVZA 2DC9A 1KFXL 4OELA 4W5BA 1U9QX 1MIRA 3KKUA 1EWLA 3IOQA 5K16A 1POPA 4HWYA 2AVWA 3PW3A 4YYSA 1O0EA 3P5VA 2AUXA 2G6DA 2FUDA 1W6FA 3O1GA 2PNSA 2DCBA 1NL6A 1U9VA 4N8WA 2AU1A 4GUZA 2NQIA 2Y6EA 1ZCMA 2VFBA 1PE6A 1GMYA 1EWMA 1ME3A 2HH5A 4Q8HA 1ICFA 2P86A 1F29A 1KHPA 3CBKA 2R9CA 3HHIA 5CVNB 2AIMA 1AYWA 3ERVA 5CHTA 2FYEA 1TLOA 4YYQA 3OF8A 4YV8A 1PPPA 3KW9A 1AU0A 1XKGA 3WXGA 3P5UA 3S3RA 2R9FA 1YALA 4K7CA 2YJ2A 3MHHA 3QT4A 1AU2A 4I05A 4BS6A 1VSNA 1CVZA 4X6HA 1GX3A 1EWOA 1S4VA 2DCDA 2YJ9A 2JQGR 1YK7A 2BSZA 4P6GA 3TNXA 4CDEB 2B1NA 1X9YA 2XU3A 1ATKA 3USVA 4NV8A 1K3BB 1MEGA 1QOLA 1MHWA 3QJ3A 2AS8A 2NQAA 4PP1A 1F2BA 2XU5A 9PAPA 1ZIVA 4XR7A 1AIMA 2DZYA 1W4TA 1FH0A 1DEUA 2H7JA 1QMYA 3E1ZB 4QRGA 1NPZA 3ZUAA 1U9XA 2FRQA 1STFE 2AYNA 1M6DA 3V6CA 1E2TA 2GFOA 1U5IA 5J94A 2DJGB 4YYUA 2FRAA 3MORA 1NLJA 2FTDA 3PDFA 4G54A 1QDQA 2BDLA 4N79A 2DCAA 2XU1A 2YJCA 1Y4HA 3BOWA 1YK8A 3U8EA 3M99A 3QSDA 1EF7A 4YVAA 2FT2A 2HHNA 2R9OA 1PADA 2VFCA 3DF0A 1BQIA 2CB5A 1AYUA 3PNRA 1VJVA 2R9MA 1SP4B 4CDFB 3KWBX 3GCBA 2G8EA 4N4ZA 5CVOB 3CBJA 4YYWA 5JH3A 1CPJA 1A6RA 2P0RA 7PCKA 1CJLA 2DC7A 3KFQA 2VHSA 3MTNA 4I04A 1CTEA 2ACTA 2BDZA 1JQPA 4FJCA 1NB5A 1KHQA 3HWNA 3LXSA 3P5WA 3CH3X 2O6XA 1MDWA 3F75A 4BSQA 3H8CA 3N4CA 4AXMA 3BC3A 1PCIA 1PIPA 2PADA 4QBBA 2FQ9A 4QRVA 4C5PA 2DZZA 1CQDA 2F7DA 4BPVA 3BPMA 2PBHA 4I07A 1CB5A 5F02A 3OF9A 4YYVA 3H89A 3KSEA 4WA6A 1IWDA 2E00A 1YVBA 1KXRA 2C0YA 1BGOA 1MS6A 1AECA 2AYOA 3S3QA 3WXFA 3N3KA 2HXZA 4OEMA 2IBIA 3IMAA 3K9MA 3OVXA 4W5CA 3MHSA 1AU4A 3RVXA 4RY2A 3BCNA 2F1GA 1AU3A 6PADA 3D6SA 1W5RA 3I06A 1PXVA 2ARYA 1HUCB 4FK5A 2YJBA 3V6EA 4PI3A 5PADA 5EF4A 3F5VA 2OULA 4CDCB 1PPOA 3O0UA 3IUTA 1DF0A 4B55A 1AYVA 4CDDB 2E02A 1QXPA 2P7UA 1CS8A 1PPDA 3D9WA 4NV7A 4DMYA 1MEMA 4ZUXU 2DJFB 1PPNA 4CZWA 3HD3A 1NB3A 2JQFR 3OISA 2NQDB 3H7DA 4MZOA 4XUIA 4QH6A 1ITOA 1ME4A 2PREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X6J A;  2HD5 A;  1SNK A;  3I3T A;  3N3G A;  2OP3 A;  3NHE A;  1PBH A;  2FO5 A;  1YT7 A;  4BQV A;  3RVV A;  2XU4 A;  1EWP A;  4X6I A;  2DC8 A;  2R9N A;  4PAD A;  5JA7 A;  3H6S A;  3BPF A;  2CIO A;  1GEC E;  3PBH A;  2Y5B A;  2G7Y A;  1GCB A;  2B1M A;  3WXE A;  5FPW A;  2ATO A;  2DC6 A;  4DMX A;  1BY8 A;  5CVM A;  5A24 A;  3IEJ A;  1Y08 A;  5EGW A;  4FIP A;  8PCH A;  3CH2 X;  4QRX A;  1TL9 A;  2VHF A;  1CSB B;  4YYR A;  1F2A A;  2G8J A;  1THE A;  3LFY A;  1NQC A;  3C9E A;  2E03 A;  4W4U A;  2OZ2 A;  4Q8G A;  1TU6 A;  1U9W A;  3B79 A;  2GHU A;  3H8B A;  3HHA A;  2IPP B;  1KFU L;  4PP2 E;  1Q6K A;  4P6E A;  3IV2 A;  2R6N A;  2YJ8 A;  4KLB A;  2NQG A;  4AXL A;  1CV8 A;  4BS5 A;  4MSX A;  2DCC A;  3KX1 A;  3AI8 A;  1BP4 A;  3BWK A;  2E01 A;  3RVW A;  2AUZ A;  4MZS A;  3K8U A;  3IHP A;  1GLO A;  3K24 A;  2WBF X;  5CHV A;  3KWZ A;  3P5X A;  1F2C A;  3OVZ A;  2DC9 A;  1KFX L;  4OEL A;  4W5B A;  1U9Q X;  1MIR A;  3KKU A;  1EWL A;  3IOQ A;  5K16 A;  1POP A;  4HWY A;  2AVW A;  3PW3 A;  4YYS A;  1O0E A;  3P5V A;  2AUX A;  2G6D A;  2FUD A;  3O1G A;  2PNS A;  2DCB A;  1NL6 A;  1U9V A;  4N8W A;  2AU1 A;  2NQI A;  2Y6E A;  1ZCM A;  1PE6 A;  1GMY A;  1EWM A;  1ME3 A;  2HH5 A;  4Q8H A;  1ICF A;  2P86 A;  1F29 A;  1KHP A;  3CBK A;  2R9C A;  3HHI A;  5CVN B;  2AIM A;  1AYW A;  3ERV A;  5CHT A;  2FYE A;  1TLO A;  4YYQ A;  3OF8 A;  4YV8 A;  1PPP A;  3KW9 A;  1AU0 A;  1XKG A;  3WXG A;  3P5U A;  3S3R A;  2R9F A;  1YAL A;  4K7C A;  2YJ2 A;  3MHH A;  3QT4 A;  1AU2 A;  4I05 A;  4BS6 A;  1VSN A;  1CVZ A;  4X6H A;  1EWO A;  1S4V A;  2DCD A;  2YJ9 A;  2JQG R;  1YK7 A;  4P6G A;  3TNX A;  4CDE B;  2B1N A;  1X9Y A;  2XU3 A;  1ATK A;  3USV A;  1K3B B;  1MEG A;  1QOL A;  1MHW A;  3QJ3 A;  2AS8 A;  2NQA A;  4PP1 A;  1F2B A;  2XU5 A;  9PAP A;  1ZIV A;  4XR7 A;  1AIM A;  2DZY A;  1FH0 A;  1DEU A;  2H7J A;  1QMY A;  3E1Z B;  4QRG A;  1NPZ A;  3ZUA A;  1U9X A;  2FRQ A;  1STF E;  2AYN A;  1M6D A;  3V6C A;  2GFO A;  1U5I A;  5J94 A;  2DJG B;  4YYU A;  2FRA A;  3MOR A;  1NLJ A;  2FTD A;  3PDF A;  4G54 A;  1QDQ A;  2BDL A;  4N79 A;  2DCA A;  2XU1 A;  2YJC A;  1Y4H A;  3BOW A;  1YK8 A;  3U8E A;  3M99 A;  3QSD A;  1EF7 A;  4YVA A;  2FT2 A;  2HHN A;  2R9O A;  1PAD A;  3DF0 A;  1BQI A;  2CB5 A;  1AYU A;  3PNR A;  1VJV A;  2R9M A;  1SP4 B;  4CDF B;  3KWB X;  3GCB A;  2G8E A;  4N4Z A;  5CVO B;  3CBJ A;  4YYW A;  5JH3 A;  1CPJ A;  1A6R A;  2P0R A;  7PCK A;  1CJL A;  2DC7 A;  3KFQ A;  2VHS A;  3MTN A;  4I04 A;  1CTE A;  2ACT A;  2BDZ A;  1JQP A;  4FJC A;  1NB5 A;  1KHQ A;  3HWN A;  3LXS A;  3P5W A;  3CH3 X;  2O6X A;  1MDW A;  3F75 A;  4BSQ A;  3H8C A;  3N4C A;  4AXM A;  3BC3 A;  1PCI A;  1PIP A;  2PAD A;  4QBB A;  2FQ9 A;  4QRV A;  2DZZ A;  1CQD A;  2F7D A;  4BPV A;  3BPM A;  2PBH A;  4I07 A;  1CB5 A;  5F02 A;  3OF9 A;  4YYV A;  3H89 A;  3KSE A;  4WA6 A;  1IWD A;  2E00 A;  1YVB A;  1KXR A;  2C0Y A;  1BGO A;  1MS6 A;  1AEC A;  2AYO A;  3S3Q A;  3WXF A;  3N3K A;  2HXZ A;  4OEM A;  2IBI A;  3IMA A;  3K9M A;  3OVX A;  4W5C A;  3MHS A;  1AU4 A;  3RVX A;  4RY2 A;  3BCN A;  2F1G A;  1AU3 A;  6PAD A;  3D6S A;  3I06 A;  1PXV A;  2ARY A;  1HUC B;  4FK5 A;  2YJB A;  3V6E A;  4PI3 A;  5PAD A;  5EF4 A;  3F5V A;  2OUL A;  4CDC B;  1PPO A;  3O0U A;  3IUT A;  1DF0 A;  1AYV A;  4CDD B;  2E02 A;  1QXP A;  2P7U A;  1CS8 A;  1PPD A;  4DMY A;  1MEM A;  4ZUX U;  2DJF B;  1PPN A;  4CZW A;  3HD3 A;  1NB3 A;  2JQF R;  3OIS A;  2NQD B;  3H7D A;  4MZO A;  4XUI A;  4QH6 A;  1ITO A;  1ME4 A;  2PRE A; 
#chains in the Genus database with same CATH topology
 4X6J A;  2HD5 A;  1SNK A;  3I3T A;  4WUR A;  3N3G A;  2OP3 A;  4IUM A;  3NHE A;  4RF0 A;  1PBH A;  2FO5 A;  1YT7 A;  4BQV A;  3MTV A;  3RVV A;  2XU4 A;  1EWP A;  4X6I A;  2DC8 A;  2R9N A;  4PAD A;  4REZ A;  3BY4 A;  5JA7 A;  3H6S A;  3BPF A;  2CIO A;  1GEC E;  3PBH A;  2Y5B A;  2G7Y A;  4OW0 A;  1GCB A;  2B1M A;  3WXE A;  5FPW A;  2ATO A;  2DC6 A;  4DMX A;  1BY8 A;  2JRI A;  1PVJ A;  5CVM A;  5A24 A;  3IEJ A;  4PT5 A;  1Y08 A;  5EGW A;  4FIP A;  8PCH A;  3CH2 X;  4QRX A;  1TL9 A;  2VHF A;  1CSB B;  3O65 A;  4YYR A;  1F2A A;  2G8J A;  1THE A;  3PT2 A;  3LFY A;  1NQC A;  4RKX A;  3C9E A;  4HXD B;  2E03 A;  4W4U A;  2OZ2 A;  4OVZ B;  2HWK A;  2UZJ A;  4Q8G A;  1TU6 A;  1U9W A;  3B79 A;  4P16 A;  2GHU A;  3H8B A;  3HHA A;  2IPP B;  1KFU L;  4PP2 E;  1Q6K A;  4P6E A;  3IV2 A;  2R6N A;  2YJ8 A;  4RNA A;  4KLB A;  2NQG A;  4AXL A;  1CV8 A;  4BS5 A;  4MSX A;  3OQC A;  2BU3 A;  2DCC A;  3KX1 A;  3TMP A;  4IP3 A;  3PHW A;  4OVZ A;  3AI8 A;  3MJ5 A;  1BP4 A;  3BWK A;  2E01 A;  3RVW A;  2AUZ A;  4MZS A;  3K8U A;  3IHP A;  1GLO A;  3K24 A;  2WBF X;  5CHV A;  3E9S A;  2J7Q A;  3KWZ A;  3P5X A;  1F2C A;  3OVZ A;  3BB7 A;  2DC9 A;  5EZQ A;  1KFX L;  4OEL A;  4W5B A;  3W31 A;  1U9Q X;  1MIR A;  3KKU A;  1EWL A;  3IOQ A;  5K16 A;  1POP A;  4HWY A;  2AVW A;  3PW3 A;  4YYS A;  1O0E A;  3P5V A;  3BBA A;  2AUX A;  4RF1 A;  2G6D A;  2FUD A;  3O1G A;  2PNS A;  2DCB A;  1NL6 A;  2Z84 A;  1U9V A;  4N8W A;  2AU1 A;  2NQI A;  2Y6E A;  4XZX A;  1ZCM A;  1DKI A;  1PE6 A;  1GMY A;  1EWM A;  1ME3 A;  2HH5 A;  4Q8H A;  1ICF A;  2P86 A;  1F29 A;  3PRP A;  1KHP A;  3CBK A;  4D8E A;  2R9C A;  3HHI A;  5CVN B;  2AIM A;  4ZTB A;  1AYW A;  3ERV A;  5CHT A;  2FYE A;  1TLO A;  4YYQ A;  3OF8 A;  4YV8 A;  1PPP A;  3KW9 A;  2JTC A;  1AU0 A;  1XKG A;  3WXG A;  3P5U A;  3C0R A;  3S3R A;  2R9F A;  1YAL A;  4K7C A;  2FE8 A;  2YJ2 A;  3MHH A;  3QT4 A;  1AU2 A;  4I05 A;  4BS6 A;  1VSN A;  1CVZ A;  4X6H A;  1EWO A;  1S4V A;  2DCD A;  2YJ9 A;  2JQG R;  5JZE A;  1YK7 A;  3PHU A;  4P6G A;  3TNX A;  4CDE B;  2B1N A;  1X9Y A;  2XU3 A;  1ATK A;  3USV A;  1K3B B;  1MEG A;  1QOL A;  2J7Q C;  1MHW A;  3QJ3 A;  5EZS A;  2AS8 A;  2NQA A;  4PP1 A;  1F2B A;  2XU5 A;  9PAP A;  1ZIV A;  4XR7 A;  1AIM A;  2DZY A;  1FH0 A;  1DEU A;  2H7J A;  1QMY A;  3E1Z B;  4QRG A;  1NPZ A;  3ZUA A;  1U9X A;  2FRQ A;  1STF E;  2AYN A;  1M6D A;  3V6C A;  4MM3 B;  2GFO A;  1UKF A;  1U5I A;  5J94 A;  2DJG B;  4YYU A;  2FRA A;  3MOR A;  1NLJ A;  2AGA A;  2FTD A;  3PDF A;  4G54 A;  1QDQ A;  2BDL A;  4N79 A;  2DCA A;  2XU1 A;  2YJC A;  1Y4H A;  3BOW A;  1YK8 A;  3U8E A;  4BOP A;  3M99 A;  3QSD A;  3TRK A;  1EF7 A;  4YVA A;  2FT2 A;  4BOQ A;  2HHN A;  2R9O A;  1PAD A;  3DF0 A;  1BQI A;  2CB5 A;  1AYU A;  3PNR A;  1VJV A;  2R9M A;  1SP4 B;  4CDF B;  3KWB X;  3GCB A;  2G8E A;  4N4Z A;  5CVO B;  3CBJ A;  4YYW A;  5JH3 A;  1CPJ A;  1A6R A;  2P0R A;  7PCK A;  2DOS A;  1CJL A;  2DC7 A;  3KFQ A;  5E6J A;  2VHS A;  3MTN A;  4D8B A;  4I04 A;  5KO3 A;  1CTE A;  2ACT A;  3MP2 A;  2BDZ A;  1JQP A;  4FJC A;  1NB5 A;  1KHQ A;  3HWN A;  3LXS A;  3P5W A;  3CH3 X;  2O6X A;  1MDW A;  3PSE A;  3F75 A;  4BSQ A;  3H8C A;  3B21 A;  3N4C A;  4AXM A;  3BC3 A;  1PCI A;  1PIP A;  2PAD A;  4QBB A;  2FQ9 A;  4QRV A;  2DZZ A;  1CQD A;  2F7D A;  2BTW B;  4BPV A;  3BPM A;  2PBH A;  4I07 A;  1CB5 A;  5F02 A;  3OF9 A;  4YYV A;  3H89 A;  3KSE A;  3IFU A;  4WA6 A;  1IWD A;  2E00 A;  1YZB A;  1YVB A;  4M0W A;  1KXR A;  2C0Y A;  1BGO A;  3RNV A;  3PRM A;  1MS6 A;  1AEC A;  2AYO A;  3PHX A;  4A5U A;  3S3Q A;  4GUA A;  4R3D A;  2BTW A;  3WXF A;  3N3K A;  3W30 A;  2HXZ A;  4D8I A;  4OEM A;  2IBI A;  3IMA A;  3K9M A;  3OVX A;  4W5C A;  3MHS A;  1AU4 A;  3RVX A;  4RY2 A;  3BCN A;  2F1G A;  4MI7 A;  1AU3 A;  6PAD A;  3D6S A;  3I06 A;  1PXV A;  4BOZ A;  2ARY A;  1HUC B;  4FK5 A;  2YJB A;  3V6E A;  4PI3 A;  5PAD A;  5EF4 A;  3F5V A;  2OUL A;  4CDC B;  1PPO A;  3O0U A;  3ZNH A;  3IUT A;  1DF0 A;  1AYV A;  4CDD B;  2E02 A;  1QXP A;  2P7U A;  1CS8 A;  1PPD A;  4BOS A;  4BOU A;  4DMY A;  1MEM A;  4ZUX U;  2DJF B;  1PPN A;  4CZW A;  3HD3 A;  1NB3 A;  2JQF R;  3OIS A;  2NQD B;  3H7D A;  4MZO A;  4XUI A;  4QH6 A;  1ITO A;  1ME4 A;  2PRE A; 
#chains in the Genus database with same CATH homology
 4X6J A;  2HD5 A;  1SNK A;  3I3T A;  3N3G A;  2OP3 A;  3NHE A;  1PBH A;  2FO5 A;  1YT7 A;  4BQV A;  3RVV A;  2XU4 A;  1EWP A;  4X6I A;  2DC8 A;  2R9N A;  4PAD A;  5JA7 A;  3H6S A;  3BPF A;  2CIO A;  1GEC E;  3PBH A;  2Y5B A;  2G7Y A;  1GCB A;  2B1M A;  3WXE A;  5FPW A;  2ATO A;  2DC6 A;  4DMX A;  1BY8 A;  5CVM A;  5A24 A;  3IEJ A;  1Y08 A;  5EGW A;  4FIP A;  8PCH A;  3CH2 X;  4QRX A;  1TL9 A;  2VHF A;  1CSB B;  4YYR A;  1F2A A;  2G8J A;  1THE A;  3LFY A;  1NQC A;  3C9E A;  2E03 A;  4W4U A;  2OZ2 A;  4Q8G A;  1TU6 A;  1U9W A;  3B79 A;  2GHU A;  3H8B A;  3HHA A;  2IPP B;  1KFU L;  4PP2 E;  1Q6K A;  4P6E A;  3IV2 A;  2R6N A;  2YJ8 A;  4KLB A;  2NQG A;  4AXL A;  1CV8 A;  4BS5 A;  4MSX A;  2DCC A;  3KX1 A;  3AI8 A;  1BP4 A;  3BWK A;  2E01 A;  3RVW A;  2AUZ A;  4BGF A;  4MZS A;  3K8U A;  3IHP A;  1GLO A;  3K24 A;  2WBF X;  5CHV A;  3LTW A;  3KWZ A;  3P5X A;  1F2C A;  3OVZ A;  2DC9 A;  1KFX L;  4OEL A;  4W5B A;  1U9Q X;  1MIR A;  3KKU A;  1EWL A;  3IOQ A;  5K16 A;  1POP A;  4HWY A;  2AVW A;  3PW3 A;  4YYS A;  1O0E A;  3P5V A;  2AUX A;  2G6D A;  2FUD A;  1W6F A;  3O1G A;  2PNS A;  2DCB A;  1NL6 A;  1U9V A;  4N8W A;  2AU1 A;  4GUZ A;  2NQI A;  2Y6E A;  1ZCM A;  2VFB A;  1PE6 A;  1GMY A;  1EWM A;  1ME3 A;  2HH5 A;  4Q8H A;  1ICF A;  2P86 A;  1F29 A;  1KHP A;  3CBK A;  2R9C A;  3HHI A;  5CVN B;  2AIM A;  1AYW A;  3ERV A;  5CHT A;  2FYE A;  1TLO A;  4YYQ A;  3OF8 A;  4YV8 A;  1PPP A;  3KW9 A;  1AU0 A;  1XKG A;  3WXG A;  3P5U A;  3S3R A;  2R9F A;  1YAL A;  4K7C A;  2YJ2 A;  3MHH A;  3QT4 A;  1AU2 A;  4I05 A;  4BS6 A;  1VSN A;  1CVZ A;  4X6H A;  1GX3 A;  1EWO A;  1S4V A;  2DCD A;  2YJ9 A;  2JQG R;  1YK7 A;  2BSZ A;  4P6G A;  3TNX A;  4CDE B;  2B1N A;  1X9Y A;  2XU3 A;  1ATK A;  3USV A;  4NV8 A;  1K3B B;  1MEG A;  1QOL A;  1MHW A;  3QJ3 A;  2AS8 A;  2NQA A;  4PP1 A;  1F2B A;  2XU5 A;  9PAP A;  1ZIV A;  4XR7 A;  1AIM A;  2DZY A;  1W4T A;  1FH0 A;  1DEU A;  2H7J A;  1QMY A;  3E1Z B;  4QRG A;  1NPZ A;  3ZUA A;  1U9X A;  2FRQ A;  1STF E;  2AYN A;  1M6D A;  3V6C A;  1E2T A;  2GFO A;  1U5I A;  5J94 A;  2DJG B;  4YYU A;  2FRA A;  3MOR A;  1NLJ A;  2FTD A;  3PDF A;  4G54 A;  1QDQ A;  2BDL A;  4N79 A;  2DCA A;  2XU1 A;  2YJC A;  1Y4H A;  3BOW A;  1YK8 A;  3U8E A;  3M99 A;  3QSD A;  1EF7 A;  4YVA A;  2FT2 A;  2HHN A;  2R9O A;  1PAD A;  2VFC A;  3DF0 A;  1BQI A;  2CB5 A;  1AYU A;  3PNR A;  1VJV A;  2R9M A;  1SP4 B;  4CDF B;  3KWB X;  3GCB A;  2G8E A;  4N4Z A;  5CVO B;  3CBJ A;  4YYW A;  5JH3 A;  1CPJ A;  1A6R A;  2P0R A;  7PCK A;  1CJL A;  2DC7 A;  3KFQ A;  2VHS A;  3MTN A;  4I04 A;  1CTE A;  2ACT A;  2BDZ A;  1JQP A;  4FJC A;  1NB5 A;  1KHQ A;  3HWN A;  3LXS A;  3P5W A;  3CH3 X;  2O6X A;  1MDW A;  3F75 A;  4BSQ A;  3H8C A;  3N4C A;  4AXM A;  3BC3 A;  1PCI A;  1PIP A;  2PAD A;  4QBB A;  2FQ9 A;  4QRV A;  4C5P A;  2DZZ A;  1CQD A;  2F7D A;  4BPV A;  3BPM A;  2PBH A;  4I07 A;  1CB5 A;  5F02 A;  3OF9 A;  4YYV A;  3H89 A;  3KSE A;  4WA6 A;  1IWD A;  2E00 A;  1YVB A;  1KXR A;  2C0Y A;  1BGO A;  1MS6 A;  1AEC A;  2AYO A;  3S3Q A;  3WXF A;  3N3K A;  2HXZ A;  4OEM A;  2IBI A;  3IMA A;  3K9M A;  3OVX A;  4W5C A;  3MHS A;  1AU4 A;  3RVX A;  4RY2 A;  3BCN A;  2F1G A;  1AU3 A;  6PAD A;  3D6S A;  1W5R A;  3I06 A;  1PXV A;  2ARY A;  1HUC B;  4FK5 A;  2YJB A;  3V6E A;  4PI3 A;  5PAD A;  5EF4 A;  3F5V A;  2OUL A;  4CDC B;  1PPO A;  3O0U A;  3IUT A;  1DF0 A;  4B55 A;  1AYV A;  4CDD B;  2E02 A;  1QXP A;  2P7U A;  1CS8 A;  1PPD A;  3D9W A;  4NV7 A;  4DMY A;  1MEM A;  4ZUX U;  2DJF B;  1PPN A;  4CZW A;  3HD3 A;  1NB3 A;  2JQF R;  3OIS A;  2NQD B;  3H7D A;  4MZO A;  4XUI A;  4QH6 A;  1ITO A;  1ME4 A;  2PRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...