1CSBB

Crystal structure of cathepsin b inhibited with ca030 at 2.1 angstroms resolution: a basis for the design of specific epoxysuccinyl inhibitors
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
205
structure length
205
Chain Sequence
VSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATHEPSIN B light chain
publication title Crystal structure of cathepsin B inhibited with CA030 at 2.0-A resolution: A basis for the design of specific epoxysuccinyl inhibitors.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 46
structure length 205
sequence length 205
chains with identical sequence E
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 1994-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1csbB00
1A6RA 1VJVA 1QMYA 2AVWA 2GFOA 1BY8A 3CH3X 1EWLA 3ERVA 1JQPA 1ZIVA 1KHPA 1QDQA 3IEJA 5PADA 1Y08A 1U9VA 2YJ8A 1K3BB 2DC9A 3P5UA 4PP2E 3LFYA 1FH0A 4PADA 4BPVA 1BGOA 4CDFB 2BDLA 3GCBA 2B1NA 2CB5A 1EWMA 2AU1A 1ZCMA 5F02A 1EF7A 1QOLA 1AU2A 5CVOB 4MSXA 5CVNB 4HWYA 4BS6A 3DF0A 2O6XA 3KX1A 2DJGB 2ACTA 2XU3A 3IHPA 2H7JA 4YYVA 4QRGA 1KXRA 2R9CA 4YYSA 2E02A 4QRXA 3PDFA 2G7YA 3S3QA 3H8BA 4I07A 9PAPA 2OULA 3CBKA 3V6CA 5J94A 1ICFA 1PPNA 2B1MA 5JA7A 2FYEA 3WXGA 4RY2A 2NQIA 3KWBX 1KHQA 2HXZA 1TLOA 3N3KA 2DCBA 3OVZA 3HHAA 3B79A 4BS5A 2G6DA 1NL6A 3RVVA 4KLBA 2AIMA 1PPPA 2AS8A 1YK8A 3I06A 4ZUXU 1ME4A 1AU0A 2VHFA 5FPWA 2R9MA 3QT4A 1AYUA 1BP4A 3K8UA 1AIMA 1NPZA 2AYOA 3KW9A 1PPOA 8PCHA 1ATKA 1AECA 2HHNA 3WXEA 4Q8GA 4P6EA 2DC7A 1TU6A 4FJCA 2XU4A 5EF4A 3H6SA 2JQGR 1PPDA 7PCKA 1CB5A 4XUIA 3I3TA 1KFXL 1X9YA 1PCIA 1PXVA 2DC6A 1SNKA 1QXPA 2OP3A 3P5XA 2Y5BA 1ITOA 3RVXA 4YYRA 3K9MA 3BWKA 3QJ3A 3MORA 3KFQA 3H8CA 2DJFB 2ARYA 4MZSA 1CS8A 3F5VA 3CBJA 2DZYA 2HH5A 3AI8A 4G54A 1O0EA 3OISA 2DCAA 1VSNA 3IUTA 3HWNA 1CV8A 4DMXA 1NB5A 1GECE 4X6HA 2FRQA 4OEMA 4WA6A 3RVWA 5CHTA 3KWZA 1F29A 4DMYA 4YYQA 3V6EA 3K24A 1HUCB 4BSQA 4CDCB 1MEMA 1CPJA 4FK5A 4AXLA 1CVZA 4N4ZA 2GHUA 3LXSA 2JQFR 3N3GA 3PNRA 1CTEA 1NQCA 2WBFX 1DEUA 1AU4A 3BPFA 3BCNA 3QSDA 1PBHA 4QBBA 4PP1A 2FO5A 1PE6A 5JH3A 2XU5A 3O1GA 4YV8A 1U5IA 3MHSA 1MEGA 4FIPA 2AUXA 3KKUA 1PADA 1CSBB 4N79A 2ATOA 3BPMA 2YJ9A 1THEA 4QH6A 4XR7A 2YJCA 3H89A 4YYWA 1PIPA 4Q8HA 2PADA 4N8WA 4OELA 1YVBA 4W5BA 4W4UA 2F1GA 1Q6KA 4YYUA 3S3RA 3WXFA 3P5VA 2YJ2A 1BQIA 2F7DA 1CJLA 3O0UA 2DZZA 1F2AA 3HHIA 3IOQA 1GMYA 1DF0A 2YJBA 2OZ2A 2VHSA 2FT2A 3PW3A 3H7DA 3P5WA 1STFE 3BC3A 3IV2A 1XKGA 3NHEA 3IMAA 1F2CA 2P7UA 1YALA 4PI3A 2PNSA 4YVAA 1MDWA 1Y4HA 5CHVA 1EWOA 1KFUL 1GLOA 4X6JA 2BDZA 3N4CA 2AYNA 2DC8A 1U9WA 4CZWA 2G8JA 1U9QX 2DCCA 2FTDA 2AUZA 1AYWA 3OVXA 1S4VA 3U8EA 2CIOA 3MHHA 1U9XA 1YK7A 1IWDA 4I04A 3MTNA 2DCDA 1F2BA 3HD3A 1TL9A 4P6GA 4CDDB 3KSEA 2NQDB 2C0YA 3C9EA 5EGWA 2Y6EA 2G8EA 2IPPB 4X6IA 1EWPA 1AU3A 1ME3A 5CVMA 3D6SA 3PBHA 1GCBA 2HD5A 2XU1A 4BQVA 3CH2X 1NLJA 2E01A 1MIRA 2R9NA 1MS6A 3ZUAA 1M6DA 2R6NA 4K7CA 2PREA 1MHWA 2R9OA 4W5CA 3M99A 2E00A 2R9FA 3OF8A 3BOWA 1POPA 1CQDA 2P0RA 3F75A 2E03A 4AXMA 1NB3A 2NQGA 3E1ZB 3USVA 3OF9A 4MZOA 1AYVA 2FUDA 6PADA 2P86A 2NQAA 4QRVA 1SP4B 2FRAA 2PBHA 5K16A 4CDEB 2FQ9A 2IBIA 1YT7A 4I05A 5A24A 3TNXA
chains in the Genus database with same CATH superfamily
1A6RA 1VJVA 1QMYA 2AVWA 2GFOA 1BY8A 3CH3X 1EWLA 4HXDB 3ERVA 4REZA 1JQPA 1ZIVA 1KHPA 1QDQA 3IEJA 5PADA 2HWKA 1Y08A 1U9VA 2YJ8A 1K3BB 3PHWA 2DC9A 3C0RA 3P5UA 4PP2E 4GUAA 3LFYA 2J7QC 1FH0A 4PADA 4BPVA 1BGOA 4CDFB 2BDLA 3GCBA 2B1NA 2CB5A 1EWMA 2AU1A 1ZCMA 5F02A 4RF1A 1EF7A 1QOLA 1AU2A 5CVOB 3B21A 1DKIA 4MSXA 5CVNB 3TRKA 4HWYA 4BS6A 2BTWA 3DF0A 2O6XA 3KX1A 2DJGB 2ACTA 2AGAA 2XU3A 2H7JA 3IHPA 4YYVA 4QRGA 1KXRA 2R9CA 4YYSA 2E02A 3OQCA 4QRXA 3PDFA 2G7YA 3S3QA 3H8BA 4P16A 4I07A 9PAPA 2OULA 4RNAA 3CBKA 3V6CA 4BOUA 4D8BA 5J94A 1ICFA 2JRIA 1PPNA 2B1MA 5JA7A 2FYEA 3WXGA 4RY2A 2NQIA 5JZEA 3O65A 3KWBX 1KHQA 2HXZA 4R3DA 1TLOA 3N3KA 4OVZA 2DCBA 3OVZA 5EZQA 2J7QA 3B79A 3HHAA 4BS5A 2G6DA 1NL6A 3RVVA 4D8EA 4KLBA 2AIMA 1PPPA 2AS8A 1YK8A 3I06A 4ZUXU 1ME4A 1AU0A 1UKFA 2VHFA 3PRPA 3RNVA 4ZTBA 5FPWA 1PVJA 2R9MA 3QT4A 1AYUA 3PHUA 1BP4A 3K8UA 1AIMA 1NPZA 3E9SA 2AYOA 3KW9A 1PPOA 8PCHA 1ATKA 1AECA 3MP2A 2HHNA 3WXEA 4Q8GA 4P6EA 2DC7A 2BTWB 1TU6A 4FJCA 2XU4A 5EF4A 3H6SA 2JQGR 1PPDA 7PCKA 1CB5A 4XUIA 3I3TA 1KFXL 1X9YA 1PCIA 1PXVA 2DC6A 1SNKA 1QXPA 2OP3A 4XZXA 3P5XA 2Y5BA 1ITOA 3RVXA 4YYRA 2FE8A 3K9MA 3BWKA 3QJ3A 3MORA 3KFQA 3H8CA 2DJFB 2ARYA 4RKXA 3IFUA 4MZSA 4A5UA 1CS8A 3F5VA 4OVZB 3CBJA 2DZYA 2UZJA 2HH5A 4MM3B 3AI8A 4G54A 1O0EA 3OISA 2DCAA 1VSNA 3IUTA 3HWNA 1CV8A 4DMXA 1NB5A 1GECE 4X6HA 2FRQA 4OEMA 4WA6A 3RVWA 5CHTA 3KWZA 3PHXA 1F29A 4DMYA 4YYQA 3V6EA 3K24A 1HUCB 4BSQA 4CDCB 1MEMA 1CPJA 4FK5A 3PRMA 4AXLA 1CVZA 4N4ZA 2GHUA 3LXSA 2JQFR 3N3GA 3BY4A 3PNRA 1CTEA 1NQCA 2WBFX 1DEUA 1AU4A 3BPFA 3BCNA 3QSDA 1PBHA 4QBBA 4PP1A 2FO5A 1PE6A 5JH3A 4IUMA 1YZBA 2XU5A 4PT5A 3O1GA 4YV8A 1U5IA 3MHSA 1MEGA 4FIPA 2AUXA 4IP3A 4MI7A 3KKUA 1PADA 1CSBB 4N79A 2ATOA 3BPMA 2YJ9A 1THEA 4QH6A 4XR7A 2YJCA 3H89A 4WURA 5EZSA 4YYWA 1PIPA 4Q8HA 2PADA 4N8WA 4OELA 4BOPA 1YVBA 4W5BA 4W4UA 2F1GA 4BOZA 1Q6KA 4YYUA 3S3RA 3WXFA 5KO3A 3P5VA 2YJ2A 1BQIA 2F7DA 4M0WA 1CJLA 3O0UA 3W31A 2DZZA 4D8IA 1F2AA 3HHIA 3IOQA 1GMYA 1DF0A 2YJBA 2OZ2A 2VHSA 2FT2A 3PW3A 3H7DA 2DOSA 3P5WA 3MJ5A 1STFE 3BC3A 3IV2A 1XKGA 3NHEA 2JTCA 3MTVA 3IMAA 1F2CA 2P7UA 1YALA 4OW0A 4PI3A 2PNSA 4YVAA 1MDWA 1Y4HA 5CHVA 1EWOA 4BOSA 1KFUL 1GLOA 4X6JA 2BDZA 3N4CA 2AYNA 2DC8A 1U9WA 4CZWA 2G8JA 4BOQA 1U9QX 2DCCA 2FTDA 2AUZA 1AYWA 3OVXA 1S4VA 3U8EA 2CIOA 3MHHA 3PSEA 1U9XA 1YK7A 1IWDA 4I04A 4RF0A 3MTNA 2DCDA 1F2BA 3HD3A 3W30A 1TL9A 3ZNHA 4P6GA 4CDDB 3TMPA 3KSEA 2NQDB 2C0YA 3C9EA 5EGWA 2Y6EA 2G8EA 2IPPB 4X6IA 1EWPA 1AU3A 1ME3A 5CVMA 3D6SA 3PBHA 1GCBA 2HD5A 2XU1A 4BQVA 3CH2X 1NLJA 2E01A 3PT2A 1MIRA 2R9NA 1MS6A 3ZUAA 1M6DA 2R6NA 4K7CA 2PREA 1MHWA 2R9OA 4W5CA 3M99A 2E00A 2R9FA 3OF8A 3BOWA 2Z84A 1POPA 1CQDA 2P0RA 3F75A 2E03A 3BBAA 4AXMA 1NB3A 2NQGA 3BB7A 3E1ZB 5E6JA 2BU3A 3OF9A 4MZOA 3USVA 1AYVA 2FUDA 6PADA 2P86A 2NQAA 4QRVA 1SP4B 2FRAA 2PBHA 5K16A 4CDEB 2FQ9A 2IBIA 1YT7A 4I05A 5A24A 3TNXA
chains in the Genus database with same CATH topology
1A6RA 1VJVA 1QMYA 2AVWA 2GFOA 1BY8A 3CH3X 1EWLA 3ERVA 4C5PA 4BGFA 1JQPA 1ZIVA 1KHPA 1QDQA 3IEJA 5PADA 3D9WA 1Y08A 1U9VA 2YJ8A 1K3BB 2DC9A 3P5UA 4PP2E 3LFYA 1FH0A 4PADA 4BPVA 1BGOA 4CDFB 2BDLA 3GCBA 2B1NA 2CB5A 1EWMA 2AU1A 1ZCMA 5F02A 1EF7A 1QOLA 1AU2A 5CVOB 4MSXA 5CVNB 4HWYA 4BS6A 3DF0A 2O6XA 3KX1A 2DJGB 2ACTA 2XU3A 3IHPA 2H7JA 4YYVA 4QRGA 1KXRA 2R9CA 2VFBA 4YYSA 2E02A 4QRXA 3PDFA 2G7YA 3S3QA 3H8BA 4I07A 9PAPA 2OULA 3CBKA 3V6CA 5J94A 1ICFA 1PPNA 2B1MA 2BSZA 5JA7A 2FYEA 3WXGA 4RY2A 2NQIA 3KWBX 1KHQA 2HXZA 1TLOA 3N3KA 2DCBA 3OVZA 3HHAA 3B79A 4BS5A 2G6DA 1NL6A 3RVVA 4KLBA 2AIMA 1PPPA 2AS8A 1YK8A 3I06A 4ZUXU 1ME4A 1AU0A 2VHFA 5FPWA 2R9MA 3QT4A 1AYUA 1BP4A 3K8UA 1AIMA 1NPZA 2AYOA 3KW9A 1PPOA 8PCHA 1ATKA 1AECA 2HHNA 3WXEA 4Q8GA 4P6EA 2DC7A 1TU6A 4FJCA 1GX3A 2XU4A 5EF4A 3H6SA 2JQGR 1PPDA 7PCKA 1CB5A 4XUIA 3I3TA 1KFXL 1X9YA 1PCIA 1PXVA 2DC6A 1SNKA 2VFCA 1QXPA 2OP3A 3P5XA 2Y5BA 1ITOA 3RVXA 4YYRA 3K9MA 3BWKA 3QJ3A 3MORA 3KFQA 3H8CA 2DJFB 2ARYA 4MZSA 1CS8A 3F5VA 3CBJA 2DZYA 2HH5A 3AI8A 4G54A 1O0EA 3OISA 2DCAA 1VSNA 3IUTA 3HWNA 1CV8A 4DMXA 1NB5A 1GECE 4X6HA 2FRQA 4OEMA 4WA6A 3RVWA 5CHTA 3KWZA 1F29A 4DMYA 4YYQA 3V6EA 3K24A 1HUCB 4BSQA 4CDCB 1MEMA 1CPJA 4FK5A 4AXLA 1CVZA 4N4ZA 3LTWA 2GHUA 3LXSA 2JQFR 3N3GA 3PNRA 1E2TA 1CTEA 1NQCA 2WBFX 1DEUA 1AU4A 3BPFA 3BCNA 3QSDA 1PBHA 1W6FA 4QBBA 4PP1A 2FO5A 1PE6A 5JH3A 2XU5A 3O1GA 4YV8A 1U5IA 3MHSA 1MEGA 4FIPA 2AUXA 3KKUA 1PADA 1CSBB 4N79A 2ATOA 3BPMA 2YJ9A 1THEA 4QH6A 4XR7A 2YJCA 3H89A 4YYWA 1PIPA 4Q8HA 2PADA 4N8WA 4OELA 1YVBA 4W5BA 4W4UA 2F1GA 1Q6KA 4YYUA 3S3RA 3WXFA 3P5VA 2YJ2A 1BQIA 2F7DA 1CJLA 3O0UA 2DZZA 1F2AA 3HHIA 3IOQA 1GMYA 1DF0A 2YJBA 2OZ2A 2VHSA 2FT2A 3PW3A 3H7DA 3P5WA 1STFE 3BC3A 3IV2A 1XKGA 3NHEA 3IMAA 1F2CA 2P7UA 1YALA 4PI3A 2PNSA 4YVAA 1MDWA 1Y4HA 5CHVA 1EWOA 1KFUL 1GLOA 4X6JA 2BDZA 3N4CA 2AYNA 2DC8A 1U9WA 4CZWA 4NV7A 2G8JA 1U9QX 2DCCA 2FTDA 2AUZA 1AYWA 3OVXA 1W5RA 1S4VA 3U8EA 2CIOA 3MHHA 1U9XA 1YK7A 4GUZA 1IWDA 4I04A 3MTNA 2DCDA 1F2BA 3HD3A 1TL9A 4NV8A 4P6GA 4CDDB 3KSEA 2NQDB 2C0YA 3C9EA 5EGWA 2Y6EA 2G8EA 2IPPB 4X6IA 1EWPA 1AU3A 1ME3A 5CVMA 3D6SA 3PBHA 1GCBA 2HD5A 2XU1A 4BQVA 3CH2X 1NLJA 2E01A 1MIRA 2R9NA 1MS6A 3ZUAA 1M6DA 2R6NA 4K7CA 2PREA 1MHWA 2R9OA 4W5CA 3M99A 2E00A 2R9FA 3OF8A 3BOWA 1POPA 1CQDA 2P0RA 3F75A 4B55A 2E03A 1W4TA 4AXMA 1NB3A 2NQGA 3E1ZB 3USVA 3OF9A 4MZOA 1AYVA 2FUDA 6PADA 2P86A 2NQAA 4QRVA 1SP4B 2FRAA 2PBHA 5K16A 4CDEB 2FQ9A 2IBIA 1YT7A 4I05A 5A24A 3TNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A6R A;  1VJV A;  1QMY A;  2AVW A;  2GFO A;  1BY8 A;  3CH3 X;  1EWL A;  3ERV A;  1JQP A;  1ZIV A;  1KHP A;  1QDQ A;  3IEJ A;  5PAD A;  1Y08 A;  1U9V A;  2YJ8 A;  1K3B B;  2DC9 A;  3P5U A;  4PP2 E;  3LFY A;  1FH0 A;  4PAD A;  4BPV A;  1BGO A;  4CDF B;  2BDL A;  3GCB A;  2B1N A;  2CB5 A;  1EWM A;  2AU1 A;  1ZCM A;  5F02 A;  1EF7 A;  1QOL A;  1AU2 A;  5CVO B;  4MSX A;  5CVN B;  4HWY A;  4BS6 A;  3DF0 A;  2O6X A;  3KX1 A;  2DJG B;  2ACT A;  2XU3 A;  3IHP A;  2H7J A;  4YYV A;  4QRG A;  1KXR A;  2R9C A;  4YYS A;  2E02 A;  4QRX A;  3PDF A;  2G7Y A;  3S3Q A;  3H8B A;  4I07 A;  9PAP A;  2OUL A;  3CBK A;  3V6C A;  5J94 A;  1ICF A;  1PPN A;  2B1M A;  5JA7 A;  2FYE A;  3WXG A;  4RY2 A;  2NQI A;  3KWB X;  1KHQ A;  2HXZ A;  1TLO A;  3N3K A;  2DCB A;  3OVZ A;  3HHA A;  3B79 A;  4BS5 A;  2G6D A;  1NL6 A;  3RVV A;  4KLB A;  2AIM A;  1PPP A;  2AS8 A;  1YK8 A;  3I06 A;  4ZUX U;  1ME4 A;  1AU0 A;  2VHF A;  5FPW A;  2R9M A;  3QT4 A;  1AYU A;  1BP4 A;  3K8U A;  1AIM A;  1NPZ A;  2AYO A;  3KW9 A;  1PPO A;  8PCH A;  1ATK A;  1AEC A;  2HHN A;  3WXE A;  4Q8G A;  4P6E A;  2DC7 A;  1TU6 A;  4FJC A;  2XU4 A;  5EF4 A;  3H6S A;  2JQG R;  1PPD A;  7PCK A;  1CB5 A;  4XUI A;  3I3T A;  1KFX L;  1X9Y A;  1PCI A;  1PXV A;  2DC6 A;  1SNK A;  1QXP A;  2OP3 A;  3P5X A;  2Y5B A;  1ITO A;  3RVX A;  4YYR A;  3K9M A;  3BWK A;  3QJ3 A;  3MOR A;  3KFQ A;  3H8C A;  2DJF B;  2ARY A;  4MZS A;  1CS8 A;  3F5V A;  3CBJ A;  2DZY A;  2HH5 A;  3AI8 A;  4G54 A;  1O0E A;  3OIS A;  2DCA A;  1VSN A;  3IUT A;  3HWN A;  1CV8 A;  4DMX A;  1NB5 A;  1GEC E;  4X6H A;  2FRQ A;  4OEM A;  4WA6 A;  3RVW A;  5CHT A;  3KWZ A;  1F29 A;  4DMY A;  4YYQ A;  3V6E A;  3K24 A;  1HUC B;  4BSQ A;  4CDC B;  1MEM A;  1CPJ A;  4FK5 A;  4AXL A;  1CVZ A;  4N4Z A;  2GHU A;  3LXS A;  2JQF R;  3N3G A;  3PNR A;  1CTE A;  1NQC A;  2WBF X;  1DEU A;  1AU4 A;  3BPF A;  3BCN A;  3QSD A;  1PBH A;  4QBB A;  4PP1 A;  2FO5 A;  1PE6 A;  5JH3 A;  2XU5 A;  3O1G A;  4YV8 A;  1U5I A;  3MHS A;  1MEG A;  4FIP A;  2AUX A;  3KKU A;  1PAD A;  1CSB B;  4N79 A;  2ATO A;  3BPM A;  2YJ9 A;  1THE A;  4QH6 A;  4XR7 A;  2YJC A;  3H89 A;  4YYW A;  1PIP A;  4Q8H A;  2PAD A;  4N8W A;  4OEL A;  1YVB A;  4W5B A;  4W4U A;  2F1G A;  1Q6K A;  4YYU A;  3S3R A;  3WXF A;  3P5V A;  2YJ2 A;  1BQI A;  2F7D A;  1CJL A;  3O0U A;  2DZZ A;  1F2A A;  3HHI A;  3IOQ A;  1GMY A;  1DF0 A;  2YJB A;  2OZ2 A;  2VHS A;  2FT2 A;  3PW3 A;  3H7D A;  3P5W A;  1STF E;  3BC3 A;  3IV2 A;  1XKG A;  3NHE A;  3IMA A;  1F2C A;  2P7U A;  1YAL A;  4PI3 A;  2PNS A;  4YVA A;  1MDW A;  1Y4H A;  5CHV A;  1EWO A;  1KFU L;  1GLO A;  4X6J A;  2BDZ A;  3N4C A;  2AYN A;  2DC8 A;  1U9W A;  4CZW A;  2G8J A;  1U9Q X;  2DCC A;  2FTD A;  2AUZ A;  1AYW A;  3OVX A;  1S4V A;  3U8E A;  2CIO A;  3MHH A;  1U9X A;  1YK7 A;  1IWD A;  4I04 A;  3MTN A;  2DCD A;  1F2B A;  3HD3 A;  1TL9 A;  4P6G A;  4CDD B;  3KSE A;  2NQD B;  2C0Y A;  3C9E A;  5EGW A;  2Y6E A;  2G8E A;  2IPP B;  4X6I A;  1EWP A;  1AU3 A;  1ME3 A;  5CVM A;  3D6S A;  3PBH A;  1GCB A;  2HD5 A;  2XU1 A;  4BQV A;  3CH2 X;  1NLJ A;  2E01 A;  1MIR A;  2R9N A;  1MS6 A;  3ZUA A;  1M6D A;  2R6N A;  4K7C A;  2PRE A;  1MHW A;  2R9O A;  4W5C A;  3M99 A;  2E00 A;  2R9F A;  3OF8 A;  3BOW A;  1POP A;  1CQD A;  2P0R A;  3F75 A;  2E03 A;  4AXM A;  1NB3 A;  2NQG A;  3E1Z B;  3USV A;  3OF9 A;  4MZO A;  1AYV A;  2FUD A;  6PAD A;  2P86 A;  2NQA A;  4QRV A;  1SP4 B;  2FRA A;  2PBH A;  5K16 A;  4CDE B;  2FQ9 A;  2IBI A;  1YT7 A;  4I05 A;  5A24 A;  3TNX A; 
#chains in the Genus database with same CATH topology
 1A6R A;  1VJV A;  1QMY A;  2AVW A;  2GFO A;  1BY8 A;  3CH3 X;  1EWL A;  4HXD B;  3ERV A;  4REZ A;  1JQP A;  1ZIV A;  1KHP A;  1QDQ A;  3IEJ A;  5PAD A;  2HWK A;  1Y08 A;  1U9V A;  2YJ8 A;  1K3B B;  3PHW A;  2DC9 A;  3C0R A;  3P5U A;  4PP2 E;  4GUA A;  3LFY A;  2J7Q C;  1FH0 A;  4PAD A;  4BPV A;  1BGO A;  4CDF B;  2BDL A;  3GCB A;  2B1N A;  2CB5 A;  1EWM A;  2AU1 A;  1ZCM A;  5F02 A;  4RF1 A;  1EF7 A;  1QOL A;  1AU2 A;  5CVO B;  3B21 A;  1DKI A;  4MSX A;  5CVN B;  3TRK A;  4HWY A;  4BS6 A;  2BTW A;  3DF0 A;  2O6X A;  3KX1 A;  2DJG B;  2ACT A;  2AGA A;  2XU3 A;  2H7J A;  3IHP A;  4YYV A;  4QRG A;  1KXR A;  2R9C A;  4YYS A;  2E02 A;  3OQC A;  4QRX A;  3PDF A;  2G7Y A;  3S3Q A;  3H8B A;  4P16 A;  4I07 A;  9PAP A;  2OUL A;  4RNA A;  3CBK A;  3V6C A;  4BOU A;  4D8B A;  5J94 A;  1ICF A;  2JRI A;  1PPN A;  2B1M A;  5JA7 A;  2FYE A;  3WXG A;  4RY2 A;  2NQI A;  5JZE A;  3O65 A;  3KWB X;  1KHQ A;  2HXZ A;  4R3D A;  1TLO A;  3N3K A;  4OVZ A;  2DCB A;  3OVZ A;  5EZQ A;  2J7Q A;  3B79 A;  3HHA A;  4BS5 A;  2G6D A;  1NL6 A;  3RVV A;  4D8E A;  4KLB A;  2AIM A;  1PPP A;  2AS8 A;  1YK8 A;  3I06 A;  4ZUX U;  1ME4 A;  1AU0 A;  1UKF A;  2VHF A;  3PRP A;  3RNV A;  4ZTB A;  5FPW A;  1PVJ A;  2R9M A;  3QT4 A;  1AYU A;  3PHU A;  1BP4 A;  3K8U A;  1AIM A;  1NPZ A;  3E9S A;  2AYO A;  3KW9 A;  1PPO A;  8PCH A;  1ATK A;  1AEC A;  3MP2 A;  2HHN A;  3WXE A;  4Q8G A;  4P6E A;  2DC7 A;  2BTW B;  1TU6 A;  4FJC A;  2XU4 A;  5EF4 A;  3H6S A;  2JQG R;  1PPD A;  7PCK A;  1CB5 A;  4XUI A;  3I3T A;  1KFX L;  1X9Y A;  1PCI A;  1PXV A;  2DC6 A;  1SNK A;  1QXP A;  2OP3 A;  4XZX A;  3P5X A;  2Y5B A;  1ITO A;  3RVX A;  4YYR A;  2FE8 A;  3K9M A;  3BWK A;  3QJ3 A;  3MOR A;  3KFQ A;  3H8C A;  2DJF B;  2ARY A;  4RKX A;  3IFU A;  4MZS A;  4A5U A;  1CS8 A;  3F5V A;  4OVZ B;  3CBJ A;  2DZY A;  2UZJ A;  2HH5 A;  4MM3 B;  3AI8 A;  4G54 A;  1O0E A;  3OIS A;  2DCA A;  1VSN A;  3IUT A;  3HWN A;  1CV8 A;  4DMX A;  1NB5 A;  1GEC E;  4X6H A;  2FRQ A;  4OEM A;  4WA6 A;  3RVW A;  5CHT A;  3KWZ A;  3PHX A;  1F29 A;  4DMY A;  4YYQ A;  3V6E A;  3K24 A;  1HUC B;  4BSQ A;  4CDC B;  1MEM A;  1CPJ A;  4FK5 A;  3PRM A;  4AXL A;  1CVZ A;  4N4Z A;  2GHU A;  3LXS A;  2JQF R;  3N3G A;  3BY4 A;  3PNR A;  1CTE A;  1NQC A;  2WBF X;  1DEU A;  1AU4 A;  3BPF A;  3BCN A;  3QSD A;  1PBH A;  4QBB A;  4PP1 A;  2FO5 A;  1PE6 A;  5JH3 A;  4IUM A;  1YZB A;  2XU5 A;  4PT5 A;  3O1G A;  4YV8 A;  1U5I A;  3MHS A;  1MEG A;  4FIP A;  2AUX A;  4IP3 A;  4MI7 A;  3KKU A;  1PAD A;  1CSB B;  4N79 A;  2ATO A;  3BPM A;  2YJ9 A;  1THE A;  4QH6 A;  4XR7 A;  2YJC A;  3H89 A;  4WUR A;  5EZS A;  4YYW A;  1PIP A;  4Q8H A;  2PAD A;  4N8W A;  4OEL A;  4BOP A;  1YVB A;  4W5B A;  4W4U A;  2F1G A;  4BOZ A;  1Q6K A;  4YYU A;  3S3R A;  3WXF A;  5KO3 A;  3P5V A;  2YJ2 A;  1BQI A;  2F7D A;  4M0W A;  1CJL A;  3O0U A;  3W31 A;  2DZZ A;  4D8I A;  1F2A A;  3HHI A;  3IOQ A;  1GMY A;  1DF0 A;  2YJB A;  2OZ2 A;  2VHS A;  2FT2 A;  3PW3 A;  3H7D A;  2DOS A;  3P5W A;  3MJ5 A;  1STF E;  3BC3 A;  3IV2 A;  1XKG A;  3NHE A;  2JTC A;  3MTV A;  3IMA A;  1F2C A;  2P7U A;  1YAL A;  4OW0 A;  4PI3 A;  2PNS A;  4YVA A;  1MDW A;  1Y4H A;  5CHV A;  1EWO A;  4BOS A;  1KFU L;  1GLO A;  4X6J A;  2BDZ A;  3N4C A;  2AYN A;  2DC8 A;  1U9W A;  4CZW A;  2G8J A;  4BOQ A;  1U9Q X;  2DCC A;  2FTD A;  2AUZ A;  1AYW A;  3OVX A;  1S4V A;  3U8E A;  2CIO A;  3MHH A;  3PSE A;  1U9X A;  1YK7 A;  1IWD A;  4I04 A;  4RF0 A;  3MTN A;  2DCD A;  1F2B A;  3HD3 A;  3W30 A;  1TL9 A;  3ZNH A;  4P6G A;  4CDD B;  3TMP A;  3KSE A;  2NQD B;  2C0Y A;  3C9E A;  5EGW A;  2Y6E A;  2G8E A;  2IPP B;  4X6I A;  1EWP A;  1AU3 A;  1ME3 A;  5CVM A;  3D6S A;  3PBH A;  1GCB A;  2HD5 A;  2XU1 A;  4BQV A;  3CH2 X;  1NLJ A;  2E01 A;  3PT2 A;  1MIR A;  2R9N A;  1MS6 A;  3ZUA A;  1M6D A;  2R6N A;  4K7C A;  2PRE A;  1MHW A;  2R9O A;  4W5C A;  3M99 A;  2E00 A;  2R9F A;  3OF8 A;  3BOW A;  2Z84 A;  1POP A;  1CQD A;  2P0R A;  3F75 A;  2E03 A;  3BBA A;  4AXM A;  1NB3 A;  2NQG A;  3BB7 A;  3E1Z B;  5E6J A;  2BU3 A;  3OF9 A;  4MZO A;  3USV A;  1AYV A;  2FUD A;  6PAD A;  2P86 A;  2NQA A;  4QRV A;  1SP4 B;  2FRA A;  2PBH A;  5K16 A;  4CDE B;  2FQ9 A;  2IBI A;  1YT7 A;  4I05 A;  5A24 A;  3TNX A; 
#chains in the Genus database with same CATH homology
 1A6R A;  1VJV A;  1QMY A;  2AVW A;  2GFO A;  1BY8 A;  3CH3 X;  1EWL A;  3ERV A;  4C5P A;  4BGF A;  1JQP A;  1ZIV A;  1KHP A;  1QDQ A;  3IEJ A;  5PAD A;  3D9W A;  1Y08 A;  1U9V A;  2YJ8 A;  1K3B B;  2DC9 A;  3P5U A;  4PP2 E;  3LFY A;  1FH0 A;  4PAD A;  4BPV A;  1BGO A;  4CDF B;  2BDL A;  3GCB A;  2B1N A;  2CB5 A;  1EWM A;  2AU1 A;  1ZCM A;  5F02 A;  1EF7 A;  1QOL A;  1AU2 A;  5CVO B;  4MSX A;  5CVN B;  4HWY A;  4BS6 A;  3DF0 A;  2O6X A;  3KX1 A;  2DJG B;  2ACT A;  2XU3 A;  3IHP A;  2H7J A;  4YYV A;  4QRG A;  1KXR A;  2R9C A;  2VFB A;  4YYS A;  2E02 A;  4QRX A;  3PDF A;  2G7Y A;  3S3Q A;  3H8B A;  4I07 A;  9PAP A;  2OUL A;  3CBK A;  3V6C A;  5J94 A;  1ICF A;  1PPN A;  2B1M A;  2BSZ A;  5JA7 A;  2FYE A;  3WXG A;  4RY2 A;  2NQI A;  3KWB X;  1KHQ A;  2HXZ A;  1TLO A;  3N3K A;  2DCB A;  3OVZ A;  3HHA A;  3B79 A;  4BS5 A;  2G6D A;  1NL6 A;  3RVV A;  4KLB A;  2AIM A;  1PPP A;  2AS8 A;  1YK8 A;  3I06 A;  4ZUX U;  1ME4 A;  1AU0 A;  2VHF A;  5FPW A;  2R9M A;  3QT4 A;  1AYU A;  1BP4 A;  3K8U A;  1AIM A;  1NPZ A;  2AYO A;  3KW9 A;  1PPO A;  8PCH A;  1ATK A;  1AEC A;  2HHN A;  3WXE A;  4Q8G A;  4P6E A;  2DC7 A;  1TU6 A;  4FJC A;  1GX3 A;  2XU4 A;  5EF4 A;  3H6S A;  2JQG R;  1PPD A;  7PCK A;  1CB5 A;  4XUI A;  3I3T A;  1KFX L;  1X9Y A;  1PCI A;  1PXV A;  2DC6 A;  1SNK A;  2VFC A;  1QXP A;  2OP3 A;  3P5X A;  2Y5B A;  1ITO A;  3RVX A;  4YYR A;  3K9M A;  3BWK A;  3QJ3 A;  3MOR A;  3KFQ A;  3H8C A;  2DJF B;  2ARY A;  4MZS A;  1CS8 A;  3F5V A;  3CBJ A;  2DZY A;  2HH5 A;  3AI8 A;  4G54 A;  1O0E A;  3OIS A;  2DCA A;  1VSN A;  3IUT A;  3HWN A;  1CV8 A;  4DMX A;  1NB5 A;  1GEC E;  4X6H A;  2FRQ A;  4OEM A;  4WA6 A;  3RVW A;  5CHT A;  3KWZ A;  1F29 A;  4DMY A;  4YYQ A;  3V6E A;  3K24 A;  1HUC B;  4BSQ A;  4CDC B;  1MEM A;  1CPJ A;  4FK5 A;  4AXL A;  1CVZ A;  4N4Z A;  3LTW A;  2GHU A;  3LXS A;  2JQF R;  3N3G A;  3PNR A;  1E2T A;  1CTE A;  1NQC A;  2WBF X;  1DEU A;  1AU4 A;  3BPF A;  3BCN A;  3QSD A;  1PBH A;  1W6F A;  4QBB A;  4PP1 A;  2FO5 A;  1PE6 A;  5JH3 A;  2XU5 A;  3O1G A;  4YV8 A;  1U5I A;  3MHS A;  1MEG A;  4FIP A;  2AUX A;  3KKU A;  1PAD A;  1CSB B;  4N79 A;  2ATO A;  3BPM A;  2YJ9 A;  1THE A;  4QH6 A;  4XR7 A;  2YJC A;  3H89 A;  4YYW A;  1PIP A;  4Q8H A;  2PAD A;  4N8W A;  4OEL A;  1YVB A;  4W5B A;  4W4U A;  2F1G A;  1Q6K A;  4YYU A;  3S3R A;  3WXF A;  3P5V A;  2YJ2 A;  1BQI A;  2F7D A;  1CJL A;  3O0U A;  2DZZ A;  1F2A A;  3HHI A;  3IOQ A;  1GMY A;  1DF0 A;  2YJB A;  2OZ2 A;  2VHS A;  2FT2 A;  3PW3 A;  3H7D A;  3P5W A;  1STF E;  3BC3 A;  3IV2 A;  1XKG A;  3NHE A;  3IMA A;  1F2C A;  2P7U A;  1YAL A;  4PI3 A;  2PNS A;  4YVA A;  1MDW A;  1Y4H A;  5CHV A;  1EWO A;  1KFU L;  1GLO A;  4X6J A;  2BDZ A;  3N4C A;  2AYN A;  2DC8 A;  1U9W A;  4CZW A;  4NV7 A;  2G8J A;  1U9Q X;  2DCC A;  2FTD A;  2AUZ A;  1AYW A;  3OVX A;  1W5R A;  1S4V A;  3U8E A;  2CIO A;  3MHH A;  1U9X A;  1YK7 A;  4GUZ A;  1IWD A;  4I04 A;  3MTN A;  2DCD A;  1F2B A;  3HD3 A;  1TL9 A;  4NV8 A;  4P6G A;  4CDD B;  3KSE A;  2NQD B;  2C0Y A;  3C9E A;  5EGW A;  2Y6E A;  2G8E A;  2IPP B;  4X6I A;  1EWP A;  1AU3 A;  1ME3 A;  5CVM A;  3D6S A;  3PBH A;  1GCB A;  2HD5 A;  2XU1 A;  4BQV A;  3CH2 X;  1NLJ A;  2E01 A;  1MIR A;  2R9N A;  1MS6 A;  3ZUA A;  1M6D A;  2R6N A;  4K7C A;  2PRE A;  1MHW A;  2R9O A;  4W5C A;  3M99 A;  2E00 A;  2R9F A;  3OF8 A;  3BOW A;  1POP A;  1CQD A;  2P0R A;  3F75 A;  4B55 A;  2E03 A;  1W4T A;  4AXM A;  1NB3 A;  2NQG A;  3E1Z B;  3USV A;  3OF9 A;  4MZO A;  1AYV A;  2FUD A;  6PAD A;  2P86 A;  2NQA A;  4QRV A;  1SP4 B;  2FRA A;  2PBH A;  5K16 A;  4CDE B;  2FQ9 A;  2IBI A;  1YT7 A;  4I05 A;  5A24 A;  3TNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...