1CSBB

Crystal structure of cathepsin b inhibited with ca030 at 2.1 angstroms resolution: a basis for the design of specific epoxysuccinyl inhibitors
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
205
structure length
205
Chain Sequence
VSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of cathepsin B inhibited with CA030 at 2.0-A resolution: A basis for the design of specific epoxysuccinyl inhibitors.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords CATHEPSIN B light chain
total genus 46
structure length 205
sequence length 205
chains with identical sequence E
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 1994-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1csbB00
3H8CA 2B1MA 1BP4A 4G54A 2AS8A 1IWDA 2XU4A 2YJ8A 3P5WA 3RVVA 1ME4A 1BY8A 2P7UA 4W4UA 2BDLA 5J94A 4I05A 3C9EA 1GCBA 1PCIA 1TL9A 2B1NA 8PCHA 1KHPA 1CV8A 3M99A 1PADA 1QXPA 4QRVA 3BOWA 1AU0A 1JQPA 1ME3A 3B79A 1PPNA 3K24A 2E02A 3KWZA 1YVBA 3O1GA 9PAPA 1FH0A 1F29A 3K9MA 1DF0A 1QDQA 2DZZA 4QBBA 2F1GA 1QMYA 3IUTA 3TNXA 3N3KA 3CH3X 1PPOA 1F2CA 3QSDA 2PNSA 1SNKA 2OZ2A 3HHIA 2JQGR 3KSEA 4AXMA 2FRAA 1U9XA 2R9NA 5CVNB 3P5VA 3P5XA 3BPFA 1O0EA 1PPDA 1CQDA 4I07A 3NHEA 1ZIVA 3OISA 1YK7A 1M6DA 5FPWA 2O6XA 2FT2A 1X9YA 3H6SA 4FJCA 3CBKA 1Q6KA 2Y6EA 3IEJA 2E03A 3MORA 2FRQA 1CB5A 4YYRA 3BPMA 4N79A 1TU6A 2GFOA 5F02A 4QRXA 1ICFA 4AXLA 2DCAA 3PBHA 4QRGA 4CZWA 5CVMA 4Q8GA 2DC8A 1CVZA 4MZSA 1YALA 2R9FA 3HWNA 4P6GA 2PADA 2DJFB 1QOLA 2G8EA 1Y08A 1ATKA 4YVAA 7PCKA 2G7YA 3HHAA 2HD5A 1DEUA 1PIPA 4W5BA 3P5UA 1PXVA 3N4CA 3V6EA 3IHPA 2HHNA 3O0UA 2AUXA 1AYWA 1K3BB 3MTNA 2NQIA 2CB5A 4XR7A 1U5IA 2BDZA 2Y5BA 2CIOA 1CS8A 3AI8A 1AIMA 4FIPA 4CDEB 2YJ2A 3F75A 1XKGA 1NL6A 4CDDB 1GMYA 3KW9A 1PE6A 5JA7A 4N8WA 1MS6A 1EF7A 2E01A 1PBHA 4Q8HA 2AYNA 1A6RA 3V6CA 1ITOA 1AYUA 3S3QA 1MEMA 2PBHA 4XUIA 2DC9A 4BSQA 1EWMA 4N4ZA 1U9WA 3IOQA 3QJ3A 2IBIA 1NQCA 3WXFA 4CDCB 2DJGB 3USVA 2DCDA 2OULA 2XU3A 1CJLA 1NB3A 4OEMA 1THEA 1GECE 4YYVA 2YJBA 5EGWA 3CBJA 3PNRA 5CHTA 3U8EA 1TLOA 2DC6A 4X6HA 3WXEA 3CH2X 1AU2A 4PADA 2OP3A 3RVXA 1NB5A 1PPPA 3OF8A 3BWKA 3LFYA 2ARYA 3KFQA 2DZYA 3LXSA 1YT7A 4YYWA 2WBFX 4YV8A 2DC7A 2FUDA 1VJVA 1ZCMA 4FK5A 3PDFA 2AIMA 1U9VA 4X6JA 1F2BA 4RY2A 1MEGA 3KKUA 2G8JA 1YK8A 3H7DA 3OF9A 5A24A 4DMXA 3OVZA 2PREA 2XU1A 4DMYA 2IPPB 4P6EA 4WA6A 2P0RA 3H89A 1MDWA 1STFE 4QH6A 1POPA 1S4VA 1GLOA 2R9MA 2C0YA 4X6IA 1F2AA 1CSBB 2XU5A 3BC3A 1AECA 1EWLA 3DF0A 2YJ9A 4PP2E 4ZUXU 5CVOB 1BGOA 3F5VA 3H8BA 1KFXL 2DCBA 2G6DA 4BS6A 3OVXA 1AU3A 4YYQA 4MSXA 2NQDB 1Y4HA 4PP1A 3KWBX 3ZUAA 2FQ9A 1MIRA 1AYVA 3GCBA 3ERVA 1KXRA 1KFUL 1EWOA 3K8UA 4W5CA 4MZOA 4BPVA 1MHWA 1VSNA 4PI3A 1NLJA 2HXZA 2JQFR 5JH3A 1SP4B 4BS5A 2R9OA 2ATOA 3I3TA 4YYUA 4K7CA 4HWYA 1AU4A 3N3GA 2AUZA 2FYEA 2FO5A 2YJCA 4OELA 2AU1A 3QT4A 2ACTA 2H7JA 1HUCB 3MHSA 2VHSA 1CTEA 1EWPA 2F7DA 2P86A 4I04A 2NQGA 2AVWA 3KX1A 1U9QX 3IMAA 1KHQA 4KLBA 1BQIA 4YYSA 2R9CA 3MHHA 5K16A 2FTDA 3PW3A 2NQAA 2R6NA 3WXGA 3BCNA 2DCCA 5CHVA 3S3RA 1CPJA 3D6SA 2GHUA 5EF4A 2VHFA 3IV2A 4CDFB 6PADA 2AYOA 4BQVA 3I06A 3RVWA 2E00A 1NPZA 3E1ZB 5PADA 2HH5A 3HD3A
chains in the Genus database with same CATH superfamily
3H8CA 2B1MA 1BP4A 4G54A 2AS8A 1IWDA 2XU4A 2YJ8A 3P5WA 3RVVA 1ME4A 1BY8A 2P7UA 4W4UA 4D8IA 4MM3B 5E6JA 2BDLA 5J94A 4I05A 3C9EA 1GCBA 4HXDB 3B21A 2HWKA 1PCIA 1TL9A 2B1NA 8PCHA 3BBAA 1KHPA 1CV8A 3M99A 1PADA 1QXPA 4QRVA 3BOWA 1AU0A 1JQPA 1ME3A 3B79A 1PPNA 3K24A 4D8EA 2E02A 3KWZA 1YVBA 3O1GA 9PAPA 1FH0A 1F29A 3K9MA 5EZQA 3MTVA 1DF0A 1QDQA 2DZZA 4QBBA 2F1GA 1QMYA 3IUTA 3TNXA 4BOUA 3N3KA 3CH3X 1PPOA 1F2CA 3QSDA 2PNSA 1SNKA 2OZ2A 3HHIA 3KSEA 2JQGR 4AXMA 2FRAA 1U9XA 2R9NA 4M0WA 5CVNB 3P5VA 3P5XA 3W31A 3BPFA 1O0EA 1PPDA 1CQDA 4I07A 3NHEA 1ZIVA 3OISA 1YK7A 1M6DA 3PRMA 5FPWA 2O6XA 2FT2A 4BOZA 1X9YA 4FJCA 3H6SA 3CBKA 4R3DA 5KO3A 1Q6KA 2Y6EA 3IEJA 2E03A 3MORA 2FRQA 1CB5A 4YYRA 3BPMA 4N79A 4OW0A 4PT5A 1TU6A 2GFOA 3W30A 5F02A 4QRXA 1ICFA 4AXLA 4RNAA 2DCAA 3PBHA 4QRGA 4CZWA 5CVMA 4Q8GA 2DC8A 1CVZA 4MZSA 1YALA 2R9FA 3HWNA 4P6GA 2PADA 2J7QA 2DJFB 1QOLA 2G8EA 1Y08A 1ATKA 4YVAA 7PCKA 2G7YA 3HHAA 4IUMA 2HD5A 1DEUA 2BU3A 1PIPA 4W5BA 3P5UA 3MP2A 1PXVA 3N4CA 3V6EA 2DOSA 3IHPA 2HHNA 3C0RA 3O0UA 2AUXA 3ZNHA 1AYWA 2UZJA 1K3BB 3MTNA 2NQIA 2CB5A 4XR7A 1U5IA 2BDZA 2FE8A 2Y5BA 2CIOA 1CS8A 2BTWA 3AI8A 4OVZA 1AIMA 4FIPA 4CDEB 4OVZB 2YJ2A 3F75A 1XKGA 1NL6A 4CDDB 1GMYA 3KW9A 1PE6A 5JA7A 4N8WA 1MS6A 1EF7A 2E01A 1PBHA 4Q8HA 2AYNA 1A6RA 2BTWB 3V6CA 1ITOA 1AYUA 3PHWA 2JRIA 3S3QA 1MEMA 2PBHA 4XUIA 2DC9A 4BSQA 1EWMA 4N4ZA 1U9WA 3IOQA 4RF1A 3QJ3A 4IP3A 2IBIA 1NQCA 3WXFA 3PRPA 4CDCB 3PSEA 2DJGB 3USVA 2DCDA 2OULA 2XU3A 1CJLA 5EZSA 1NB3A 4OEMA 1THEA 1GECE 4YYVA 2YJBA 5EGWA 3CBJA 4MI7A 3PNRA 5CHTA 3U8EA 2Z84A 1TLOA 2DC6A 4X6HA 3WXEA 3CH2X 1AU2A 4PADA 2OP3A 3RVXA 1NB5A 3BB7A 4RF0A 1PPPA 3OF8A 3BWKA 3LFYA 2ARYA 4A5UA 3KFQA 2DZYA 3LXSA 1YT7A 4D8BA 2WBFX 4YYWA 4YV8A 2DC7A 2FUDA 1VJVA 1ZCMA 4FK5A 3PDFA 3MJ5A 2AIMA 1U9VA 4X6JA 3OQCA 1F2BA 4RY2A 1MEGA 3KKUA 2G8JA 3O65A 1YK8A 3H7DA 3OF9A 5A24A 4DMXA 3OVZA 2PREA 2XU1A 4DMYA 2IPPB 4P6EA 1DKIA 1YZBA 3BY4A 4WA6A 2P0RA 3PT2A 3H89A 1MDWA 1STFE 4QH6A 1POPA 1S4VA 1GLOA 2R9MA 2C0YA 4X6IA 1F2AA 1CSBB 1PVJA 2XU5A 3BC3A 1AECA 1EWLA 3DF0A 2YJ9A 4PP2E 4ZUXU 5CVOB 1BGOA 3F5VA 4GUAA 3H8BA 1KFXL 2DCBA 2G6DA 4BS6A 3OVXA 1AU3A 4YYQA 4MSXA 2JTCA 1Y4HA 2NQDB 4PP1A 3KWBX 3ZUAA 2FQ9A 1MIRA 1AYVA 3GCBA 3ERVA 1KXRA 1KFUL 3K8UA 1EWOA 4W5CA 3E9SA 4MZOA 4WURA 2J7QC 4BPVA 1MHWA 5JZEA 1VSNA 4PI3A 1NLJA 2HXZA 2JQFR 5JH3A 1SP4B 4BS5A 2R9OA 2ATOA 3I3TA 4YYUA 4K7CA 4HWYA 4REZA 1AU4A 3N3GA 3PHUA 2AUZA 2FYEA 2FO5A 2YJCA 4OELA 2AU1A 3QT4A 2ACTA 2H7JA 1HUCB 3TRKA 3MHSA 2VHSA 3IFUA 1CTEA 1UKFA 1EWPA 2F7DA 2P86A 4I04A 4XZXA 2NQGA 2AVWA 3KX1A 1U9QX 4P16A 4BOPA 3IMAA 1KHQA 4BOSA 4KLBA 4ZTBA 1BQIA 3TMPA 4YYSA 2R9CA 3MHHA 5K16A 3PHXA 2FTDA 3PW3A 4RKXA 2NQAA 2R6NA 3WXGA 3BCNA 2DCCA 5CHVA 3S3RA 1CPJA 3D6SA 2GHUA 5EF4A 2VHFA 3IV2A 4CDFB 6PADA 2AYOA 4BQVA 4BOQA 3RNVA 3I06A 3RVWA 2AGAA 2E00A 1NPZA 3E1ZB 5PADA 2HH5A 3HD3A
chains in the Genus database with same CATH topology
3H8CA 2B1MA 1BP4A 4G54A 2AS8A 1IWDA 2XU4A 2YJ8A 3P5WA 3RVVA 1ME4A 1BY8A 2P7UA 4W4UA 4BGFA 2BDLA 5J94A 4I05A 3C9EA 1GCBA 1PCIA 1TL9A 2B1NA 8PCHA 1KHPA 1CV8A 3M99A 1PADA 1QXPA 4QRVA 3BOWA 1AU0A 1JQPA 1ME3A 3D9WA 3B79A 1PPNA 2VFCA 3K24A 2E02A 3KWZA 1YVBA 3O1GA 9PAPA 1FH0A 1F29A 3K9MA 1DF0A 1QDQA 2DZZA 4QBBA 2F1GA 1QMYA 3IUTA 3TNXA 3N3KA 3CH3X 1PPOA 1W6FA 1F2CA 3QSDA 2PNSA 1SNKA 2OZ2A 3HHIA 2JQGR 3KSEA 4AXMA 2FRAA 1U9XA 2R9NA 5CVNB 3P5VA 3P5XA 3BPFA 1O0EA 1PPDA 1CQDA 4I07A 3NHEA 1ZIVA 3OISA 1YK7A 1M6DA 5FPWA 2O6XA 2FT2A 1X9YA 3H6SA 4FJCA 3CBKA 1Q6KA 2Y6EA 3IEJA 2E03A 3MORA 2FRQA 1CB5A 4YYRA 3BPMA 4N79A 1TU6A 2GFOA 5F02A 4QRXA 1ICFA 4AXLA 2DCAA 3PBHA 4QRGA 4CZWA 5CVMA 4Q8GA 2DC8A 1CVZA 4MZSA 1YALA 2R9FA 3HWNA 4P6GA 2PADA 2DJFB 1QOLA 2G8EA 1Y08A 1ATKA 4YVAA 7PCKA 2G7YA 3HHAA 2HD5A 1GX3A 1DEUA 1PIPA 4W5BA 3P5UA 1PXVA 3N4CA 3V6EA 3IHPA 2HHNA 3O0UA 2AUXA 1AYWA 1K3BB 3MTNA 2NQIA 2CB5A 4XR7A 1U5IA 2BDZA 2Y5BA 2CIOA 1CS8A 3AI8A 1AIMA 4NV8A 4FIPA 4CDEB 2YJ2A 3F75A 1XKGA 1NL6A 4CDDB 1GMYA 3KW9A 1PE6A 5JA7A 4N8WA 1MS6A 1EF7A 2E01A 1PBHA 4Q8HA 2AYNA 1A6RA 3V6CA 1ITOA 1AYUA 3S3QA 1MEMA 2PBHA 4XUIA 2DC9A 3LTWA 4BSQA 4C5PA 1EWMA 4N4ZA 1U9WA 3IOQA 1W5RA 3QJ3A 2IBIA 1NQCA 3WXFA 4CDCB 2DJGB 3USVA 2DCDA 2OULA 2XU3A 1CJLA 1NB3A 4OEMA 1THEA 1GECE 4YYVA 2YJBA 5EGWA 3CBJA 3PNRA 5CHTA 3U8EA 1TLOA 2DC6A 4X6HA 3WXEA 3CH2X 1AU2A 4PADA 2OP3A 3RVXA 2BSZA 1NB5A 1PPPA 3OF8A 3BWKA 3LFYA 2ARYA 3KFQA 2DZYA 3LXSA 1YT7A 4YYWA 2WBFX 4YV8A 2DC7A 2FUDA 1VJVA 1ZCMA 4FK5A 3PDFA 2AIMA 1U9VA 4X6JA 1F2BA 4RY2A 1MEGA 3KKUA 2G8JA 1YK8A 3H7DA 3OF9A 5A24A 4DMXA 3OVZA 2PREA 2XU1A 4DMYA 2IPPB 4P6EA 4WA6A 2P0RA 3H89A 1MDWA 1STFE 4QH6A 1POPA 1S4VA 1GLOA 2R9MA 2C0YA 4X6IA 1F2AA 1CSBB 2XU5A 3BC3A 1AECA 1EWLA 3DF0A 2YJ9A 1E2TA 2VFBA 4PP2E 4ZUXU 5CVOB 1BGOA 3F5VA 3H8BA 4NV7A 1KFXL 2DCBA 2G6DA 4BS6A 3OVXA 1AU3A 1W4TA 4YYQA 4MSXA 2NQDB 1Y4HA 4PP1A 3KWBX 3ZUAA 2FQ9A 1MIRA 1AYVA 3GCBA 3ERVA 1KXRA 1KFUL 1EWOA 3K8UA 4W5CA 4MZOA 4BPVA 1MHWA 1VSNA 4PI3A 1NLJA 2HXZA 2JQFR 5JH3A 1SP4B 4BS5A 2R9OA 2ATOA 3I3TA 4YYUA 4K7CA 4HWYA 1AU4A 3N3GA 2AUZA 2FYEA 2FO5A 2YJCA 4OELA 2AU1A 3QT4A 2ACTA 2H7JA 1HUCB 3MHSA 2VHSA 1CTEA 1EWPA 2F7DA 2P86A 4I04A 2NQGA 2AVWA 3KX1A 1U9QX 3IMAA 1KHQA 4KLBA 1BQIA 4YYSA 2R9CA 3MHHA 5K16A 2FTDA 3PW3A 2NQAA 2R6NA 3WXGA 3BCNA 4B55A 2DCCA 5CHVA 3S3RA 1CPJA 3D6SA 2GHUA 5EF4A 4GUZA 2VHFA 3IV2A 4CDFB 6PADA 2AYOA 4BQVA 3I06A 3RVWA 2E00A 1NPZA 3E1ZB 5PADA 2HH5A 3HD3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H8C A;  2B1M A;  1BP4 A;  4G54 A;  2AS8 A;  1IWD A;  2XU4 A;  2YJ8 A;  3P5W A;  3RVV A;  1ME4 A;  1BY8 A;  2P7U A;  4W4U A;  2BDL A;  5J94 A;  4I05 A;  3C9E A;  1GCB A;  1PCI A;  1TL9 A;  2B1N A;  8PCH A;  1KHP A;  1CV8 A;  3M99 A;  1PAD A;  1QXP A;  4QRV A;  3BOW A;  1AU0 A;  1JQP A;  1ME3 A;  3B79 A;  1PPN A;  3K24 A;  2E02 A;  3KWZ A;  1YVB A;  3O1G A;  9PAP A;  1FH0 A;  1F29 A;  3K9M A;  1DF0 A;  1QDQ A;  2DZZ A;  4QBB A;  2F1G A;  1QMY A;  3IUT A;  3TNX A;  3N3K A;  3CH3 X;  1PPO A;  1F2C A;  3QSD A;  2PNS A;  1SNK A;  2OZ2 A;  3HHI A;  2JQG R;  3KSE A;  4AXM A;  2FRA A;  1U9X A;  2R9N A;  5CVN B;  3P5V A;  3P5X A;  3BPF A;  1O0E A;  1PPD A;  1CQD A;  4I07 A;  3NHE A;  1ZIV A;  3OIS A;  1YK7 A;  1M6D A;  5FPW A;  2O6X A;  2FT2 A;  1X9Y A;  3H6S A;  4FJC A;  3CBK A;  1Q6K A;  2Y6E A;  3IEJ A;  2E03 A;  3MOR A;  2FRQ A;  1CB5 A;  4YYR A;  3BPM A;  4N79 A;  1TU6 A;  2GFO A;  5F02 A;  4QRX A;  1ICF A;  4AXL A;  2DCA A;  3PBH A;  4QRG A;  4CZW A;  5CVM A;  4Q8G A;  2DC8 A;  1CVZ A;  4MZS A;  1YAL A;  2R9F A;  3HWN A;  4P6G A;  2PAD A;  2DJF B;  1QOL A;  2G8E A;  1Y08 A;  1ATK A;  4YVA A;  7PCK A;  2G7Y A;  3HHA A;  2HD5 A;  1DEU A;  1PIP A;  4W5B A;  3P5U A;  1PXV A;  3N4C A;  3V6E A;  3IHP A;  2HHN A;  3O0U A;  2AUX A;  1AYW A;  1K3B B;  3MTN A;  2NQI A;  2CB5 A;  4XR7 A;  1U5I A;  2BDZ A;  2Y5B A;  2CIO A;  1CS8 A;  3AI8 A;  1AIM A;  4FIP A;  4CDE B;  2YJ2 A;  3F75 A;  1XKG A;  1NL6 A;  4CDD B;  1GMY A;  3KW9 A;  1PE6 A;  5JA7 A;  4N8W A;  1MS6 A;  1EF7 A;  2E01 A;  1PBH A;  4Q8H A;  2AYN A;  1A6R A;  3V6C A;  1ITO A;  1AYU A;  3S3Q A;  1MEM A;  2PBH A;  4XUI A;  2DC9 A;  4BSQ A;  1EWM A;  4N4Z A;  1U9W A;  3IOQ A;  3QJ3 A;  2IBI A;  1NQC A;  3WXF A;  4CDC B;  2DJG B;  3USV A;  2DCD A;  2OUL A;  2XU3 A;  1CJL A;  1NB3 A;  4OEM A;  1THE A;  1GEC E;  4YYV A;  2YJB A;  5EGW A;  3CBJ A;  3PNR A;  5CHT A;  3U8E A;  1TLO A;  2DC6 A;  4X6H A;  3WXE A;  3CH2 X;  1AU2 A;  4PAD A;  2OP3 A;  3RVX A;  1NB5 A;  1PPP A;  3OF8 A;  3BWK A;  3LFY A;  2ARY A;  3KFQ A;  2DZY A;  3LXS A;  1YT7 A;  4YYW A;  2WBF X;  4YV8 A;  2DC7 A;  2FUD A;  1VJV A;  1ZCM A;  4FK5 A;  3PDF A;  2AIM A;  1U9V A;  4X6J A;  1F2B A;  4RY2 A;  1MEG A;  3KKU A;  2G8J A;  1YK8 A;  3H7D A;  3OF9 A;  5A24 A;  4DMX A;  3OVZ A;  2PRE A;  2XU1 A;  4DMY A;  2IPP B;  4P6E A;  4WA6 A;  2P0R A;  3H89 A;  1MDW A;  1STF E;  4QH6 A;  1POP A;  1S4V A;  1GLO A;  2R9M A;  2C0Y A;  4X6I A;  1F2A A;  1CSB B;  2XU5 A;  3BC3 A;  1AEC A;  1EWL A;  3DF0 A;  2YJ9 A;  4PP2 E;  4ZUX U;  5CVO B;  1BGO A;  3F5V A;  3H8B A;  1KFX L;  2DCB A;  2G6D A;  4BS6 A;  3OVX A;  1AU3 A;  4YYQ A;  4MSX A;  2NQD B;  1Y4H A;  4PP1 A;  3KWB X;  3ZUA A;  2FQ9 A;  1MIR A;  1AYV A;  3GCB A;  3ERV A;  1KXR A;  1KFU L;  1EWO A;  3K8U A;  4W5C A;  4MZO A;  4BPV A;  1MHW A;  1VSN A;  4PI3 A;  1NLJ A;  2HXZ A;  2JQF R;  5JH3 A;  1SP4 B;  4BS5 A;  2R9O A;  2ATO A;  3I3T A;  4YYU A;  4K7C A;  4HWY A;  1AU4 A;  3N3G A;  2AUZ A;  2FYE A;  2FO5 A;  2YJC A;  4OEL A;  2AU1 A;  3QT4 A;  2ACT A;  2H7J A;  1HUC B;  3MHS A;  2VHS A;  1CTE A;  1EWP A;  2F7D A;  2P86 A;  4I04 A;  2NQG A;  2AVW A;  3KX1 A;  1U9Q X;  3IMA A;  1KHQ A;  4KLB A;  1BQI A;  4YYS A;  2R9C A;  3MHH A;  5K16 A;  2FTD A;  3PW3 A;  2NQA A;  2R6N A;  3WXG A;  3BCN A;  2DCC A;  5CHV A;  3S3R A;  1CPJ A;  3D6S A;  2GHU A;  5EF4 A;  2VHF A;  3IV2 A;  4CDF B;  6PAD A;  2AYO A;  4BQV A;  3I06 A;  3RVW A;  2E00 A;  1NPZ A;  3E1Z B;  5PAD A;  2HH5 A;  3HD3 A; 
#chains in the Genus database with same CATH topology
 3H8C A;  2B1M A;  1BP4 A;  4G54 A;  2AS8 A;  1IWD A;  2XU4 A;  2YJ8 A;  3P5W A;  3RVV A;  1ME4 A;  1BY8 A;  2P7U A;  4W4U A;  4D8I A;  4MM3 B;  5E6J A;  2BDL A;  5J94 A;  4I05 A;  3C9E A;  1GCB A;  4HXD B;  3B21 A;  2HWK A;  1PCI A;  1TL9 A;  2B1N A;  8PCH A;  3BBA A;  1KHP A;  1CV8 A;  3M99 A;  1PAD A;  1QXP A;  4QRV A;  3BOW A;  1AU0 A;  1JQP A;  1ME3 A;  3B79 A;  1PPN A;  3K24 A;  4D8E A;  2E02 A;  3KWZ A;  1YVB A;  3O1G A;  9PAP A;  1FH0 A;  1F29 A;  3K9M A;  5EZQ A;  3MTV A;  1DF0 A;  1QDQ A;  2DZZ A;  4QBB A;  2F1G A;  1QMY A;  3IUT A;  3TNX A;  4BOU A;  3N3K A;  3CH3 X;  1PPO A;  1F2C A;  3QSD A;  2PNS A;  1SNK A;  2OZ2 A;  3HHI A;  3KSE A;  2JQG R;  4AXM A;  2FRA A;  1U9X A;  2R9N A;  4M0W A;  5CVN B;  3P5V A;  3P5X A;  3W31 A;  3BPF A;  1O0E A;  1PPD A;  1CQD A;  4I07 A;  3NHE A;  1ZIV A;  3OIS A;  1YK7 A;  1M6D A;  3PRM A;  5FPW A;  2O6X A;  2FT2 A;  4BOZ A;  1X9Y A;  4FJC A;  3H6S A;  3CBK A;  4R3D A;  5KO3 A;  1Q6K A;  2Y6E A;  3IEJ A;  2E03 A;  3MOR A;  2FRQ A;  1CB5 A;  4YYR A;  3BPM A;  4N79 A;  4OW0 A;  4PT5 A;  1TU6 A;  2GFO A;  3W30 A;  5F02 A;  4QRX A;  1ICF A;  4AXL A;  4RNA A;  2DCA A;  3PBH A;  4QRG A;  4CZW A;  5CVM A;  4Q8G A;  2DC8 A;  1CVZ A;  4MZS A;  1YAL A;  2R9F A;  3HWN A;  4P6G A;  2PAD A;  2J7Q A;  2DJF B;  1QOL A;  2G8E A;  1Y08 A;  1ATK A;  4YVA A;  7PCK A;  2G7Y A;  3HHA A;  4IUM A;  2HD5 A;  1DEU A;  2BU3 A;  1PIP A;  4W5B A;  3P5U A;  3MP2 A;  1PXV A;  3N4C A;  3V6E A;  2DOS A;  3IHP A;  2HHN A;  3C0R A;  3O0U A;  2AUX A;  3ZNH A;  1AYW A;  2UZJ A;  1K3B B;  3MTN A;  2NQI A;  2CB5 A;  4XR7 A;  1U5I A;  2BDZ A;  2FE8 A;  2Y5B A;  2CIO A;  1CS8 A;  2BTW A;  3AI8 A;  4OVZ A;  1AIM A;  4FIP A;  4CDE B;  4OVZ B;  2YJ2 A;  3F75 A;  1XKG A;  1NL6 A;  4CDD B;  1GMY A;  3KW9 A;  1PE6 A;  5JA7 A;  4N8W A;  1MS6 A;  1EF7 A;  2E01 A;  1PBH A;  4Q8H A;  2AYN A;  1A6R A;  2BTW B;  3V6C A;  1ITO A;  1AYU A;  3PHW A;  2JRI A;  3S3Q A;  1MEM A;  2PBH A;  4XUI A;  2DC9 A;  4BSQ A;  1EWM A;  4N4Z A;  1U9W A;  3IOQ A;  4RF1 A;  3QJ3 A;  4IP3 A;  2IBI A;  1NQC A;  3WXF A;  3PRP A;  4CDC B;  3PSE A;  2DJG B;  3USV A;  2DCD A;  2OUL A;  2XU3 A;  1CJL A;  5EZS A;  1NB3 A;  4OEM A;  1THE A;  1GEC E;  4YYV A;  2YJB A;  5EGW A;  3CBJ A;  4MI7 A;  3PNR A;  5CHT A;  3U8E A;  2Z84 A;  1TLO A;  2DC6 A;  4X6H A;  3WXE A;  3CH2 X;  1AU2 A;  4PAD A;  2OP3 A;  3RVX A;  1NB5 A;  3BB7 A;  4RF0 A;  1PPP A;  3OF8 A;  3BWK A;  3LFY A;  2ARY A;  4A5U A;  3KFQ A;  2DZY A;  3LXS A;  1YT7 A;  4D8B A;  2WBF X;  4YYW A;  4YV8 A;  2DC7 A;  2FUD A;  1VJV A;  1ZCM A;  4FK5 A;  3PDF A;  3MJ5 A;  2AIM A;  1U9V A;  4X6J A;  3OQC A;  1F2B A;  4RY2 A;  1MEG A;  3KKU A;  2G8J A;  3O65 A;  1YK8 A;  3H7D A;  3OF9 A;  5A24 A;  4DMX A;  3OVZ A;  2PRE A;  2XU1 A;  4DMY A;  2IPP B;  4P6E A;  1DKI A;  1YZB A;  3BY4 A;  4WA6 A;  2P0R A;  3PT2 A;  3H89 A;  1MDW A;  1STF E;  4QH6 A;  1POP A;  1S4V A;  1GLO A;  2R9M A;  2C0Y A;  4X6I A;  1F2A A;  1CSB B;  1PVJ A;  2XU5 A;  3BC3 A;  1AEC A;  1EWL A;  3DF0 A;  2YJ9 A;  4PP2 E;  4ZUX U;  5CVO B;  1BGO A;  3F5V A;  4GUA A;  3H8B A;  1KFX L;  2DCB A;  2G6D A;  4BS6 A;  3OVX A;  1AU3 A;  4YYQ A;  4MSX A;  2JTC A;  1Y4H A;  2NQD B;  4PP1 A;  3KWB X;  3ZUA A;  2FQ9 A;  1MIR A;  1AYV A;  3GCB A;  3ERV A;  1KXR A;  1KFU L;  3K8U A;  1EWO A;  4W5C A;  3E9S A;  4MZO A;  4WUR A;  2J7Q C;  4BPV A;  1MHW A;  5JZE A;  1VSN A;  4PI3 A;  1NLJ A;  2HXZ A;  2JQF R;  5JH3 A;  1SP4 B;  4BS5 A;  2R9O A;  2ATO A;  3I3T A;  4YYU A;  4K7C A;  4HWY A;  4REZ A;  1AU4 A;  3N3G A;  3PHU A;  2AUZ A;  2FYE A;  2FO5 A;  2YJC A;  4OEL A;  2AU1 A;  3QT4 A;  2ACT A;  2H7J A;  1HUC B;  3TRK A;  3MHS A;  2VHS A;  3IFU A;  1CTE A;  1UKF A;  1EWP A;  2F7D A;  2P86 A;  4I04 A;  4XZX A;  2NQG A;  2AVW A;  3KX1 A;  1U9Q X;  4P16 A;  4BOP A;  3IMA A;  1KHQ A;  4BOS A;  4KLB A;  4ZTB A;  1BQI A;  3TMP A;  4YYS A;  2R9C A;  3MHH A;  5K16 A;  3PHX A;  2FTD A;  3PW3 A;  4RKX A;  2NQA A;  2R6N A;  3WXG A;  3BCN A;  2DCC A;  5CHV A;  3S3R A;  1CPJ A;  3D6S A;  2GHU A;  5EF4 A;  2VHF A;  3IV2 A;  4CDF B;  6PAD A;  2AYO A;  4BQV A;  4BOQ A;  3RNV A;  3I06 A;  3RVW A;  2AGA A;  2E00 A;  1NPZ A;  3E1Z B;  5PAD A;  2HH5 A;  3HD3 A; 
#chains in the Genus database with same CATH homology
 3H8C A;  2B1M A;  1BP4 A;  4G54 A;  2AS8 A;  1IWD A;  2XU4 A;  2YJ8 A;  3P5W A;  3RVV A;  1ME4 A;  1BY8 A;  2P7U A;  4W4U A;  4BGF A;  2BDL A;  5J94 A;  4I05 A;  3C9E A;  1GCB A;  1PCI A;  1TL9 A;  2B1N A;  8PCH A;  1KHP A;  1CV8 A;  3M99 A;  1PAD A;  1QXP A;  4QRV A;  3BOW A;  1AU0 A;  1JQP A;  1ME3 A;  3D9W A;  3B79 A;  1PPN A;  2VFC A;  3K24 A;  2E02 A;  3KWZ A;  1YVB A;  3O1G A;  9PAP A;  1FH0 A;  1F29 A;  3K9M A;  1DF0 A;  1QDQ A;  2DZZ A;  4QBB A;  2F1G A;  1QMY A;  3IUT A;  3TNX A;  3N3K A;  3CH3 X;  1PPO A;  1W6F A;  1F2C A;  3QSD A;  2PNS A;  1SNK A;  2OZ2 A;  3HHI A;  2JQG R;  3KSE A;  4AXM A;  2FRA A;  1U9X A;  2R9N A;  5CVN B;  3P5V A;  3P5X A;  3BPF A;  1O0E A;  1PPD A;  1CQD A;  4I07 A;  3NHE A;  1ZIV A;  3OIS A;  1YK7 A;  1M6D A;  5FPW A;  2O6X A;  2FT2 A;  1X9Y A;  3H6S A;  4FJC A;  3CBK A;  1Q6K A;  2Y6E A;  3IEJ A;  2E03 A;  3MOR A;  2FRQ A;  1CB5 A;  4YYR A;  3BPM A;  4N79 A;  1TU6 A;  2GFO A;  5F02 A;  4QRX A;  1ICF A;  4AXL A;  2DCA A;  3PBH A;  4QRG A;  4CZW A;  5CVM A;  4Q8G A;  2DC8 A;  1CVZ A;  4MZS A;  1YAL A;  2R9F A;  3HWN A;  4P6G A;  2PAD A;  2DJF B;  1QOL A;  2G8E A;  1Y08 A;  1ATK A;  4YVA A;  7PCK A;  2G7Y A;  3HHA A;  2HD5 A;  1GX3 A;  1DEU A;  1PIP A;  4W5B A;  3P5U A;  1PXV A;  3N4C A;  3V6E A;  3IHP A;  2HHN A;  3O0U A;  2AUX A;  1AYW A;  1K3B B;  3MTN A;  2NQI A;  2CB5 A;  4XR7 A;  1U5I A;  2BDZ A;  2Y5B A;  2CIO A;  1CS8 A;  3AI8 A;  1AIM A;  4NV8 A;  4FIP A;  4CDE B;  2YJ2 A;  3F75 A;  1XKG A;  1NL6 A;  4CDD B;  1GMY A;  3KW9 A;  1PE6 A;  5JA7 A;  4N8W A;  1MS6 A;  1EF7 A;  2E01 A;  1PBH A;  4Q8H A;  2AYN A;  1A6R A;  3V6C A;  1ITO A;  1AYU A;  3S3Q A;  1MEM A;  2PBH A;  4XUI A;  2DC9 A;  3LTW A;  4BSQ A;  4C5P A;  1EWM A;  4N4Z A;  1U9W A;  3IOQ A;  1W5R A;  3QJ3 A;  2IBI A;  1NQC A;  3WXF A;  4CDC B;  2DJG B;  3USV A;  2DCD A;  2OUL A;  2XU3 A;  1CJL A;  1NB3 A;  4OEM A;  1THE A;  1GEC E;  4YYV A;  2YJB A;  5EGW A;  3CBJ A;  3PNR A;  5CHT A;  3U8E A;  1TLO A;  2DC6 A;  4X6H A;  3WXE A;  3CH2 X;  1AU2 A;  4PAD A;  2OP3 A;  3RVX A;  2BSZ A;  1NB5 A;  1PPP A;  3OF8 A;  3BWK A;  3LFY A;  2ARY A;  3KFQ A;  2DZY A;  3LXS A;  1YT7 A;  4YYW A;  2WBF X;  4YV8 A;  2DC7 A;  2FUD A;  1VJV A;  1ZCM A;  4FK5 A;  3PDF A;  2AIM A;  1U9V A;  4X6J A;  1F2B A;  4RY2 A;  1MEG A;  3KKU A;  2G8J A;  1YK8 A;  3H7D A;  3OF9 A;  5A24 A;  4DMX A;  3OVZ A;  2PRE A;  2XU1 A;  4DMY A;  2IPP B;  4P6E A;  4WA6 A;  2P0R A;  3H89 A;  1MDW A;  1STF E;  4QH6 A;  1POP A;  1S4V A;  1GLO A;  2R9M A;  2C0Y A;  4X6I A;  1F2A A;  1CSB B;  2XU5 A;  3BC3 A;  1AEC A;  1EWL A;  3DF0 A;  2YJ9 A;  1E2T A;  2VFB A;  4PP2 E;  4ZUX U;  5CVO B;  1BGO A;  3F5V A;  3H8B A;  4NV7 A;  1KFX L;  2DCB A;  2G6D A;  4BS6 A;  3OVX A;  1AU3 A;  1W4T A;  4YYQ A;  4MSX A;  2NQD B;  1Y4H A;  4PP1 A;  3KWB X;  3ZUA A;  2FQ9 A;  1MIR A;  1AYV A;  3GCB A;  3ERV A;  1KXR A;  1KFU L;  1EWO A;  3K8U A;  4W5C A;  4MZO A;  4BPV A;  1MHW A;  1VSN A;  4PI3 A;  1NLJ A;  2HXZ A;  2JQF R;  5JH3 A;  1SP4 B;  4BS5 A;  2R9O A;  2ATO A;  3I3T A;  4YYU A;  4K7C A;  4HWY A;  1AU4 A;  3N3G A;  2AUZ A;  2FYE A;  2FO5 A;  2YJC A;  4OEL A;  2AU1 A;  3QT4 A;  2ACT A;  2H7J A;  1HUC B;  3MHS A;  2VHS A;  1CTE A;  1EWP A;  2F7D A;  2P86 A;  4I04 A;  2NQG A;  2AVW A;  3KX1 A;  1U9Q X;  3IMA A;  1KHQ A;  4KLB A;  1BQI A;  4YYS A;  2R9C A;  3MHH A;  5K16 A;  2FTD A;  3PW3 A;  2NQA A;  2R6N A;  3WXG A;  3BCN A;  4B55 A;  2DCC A;  5CHV A;  3S3R A;  1CPJ A;  3D6S A;  2GHU A;  5EF4 A;  4GUZ A;  2VHF A;  3IV2 A;  4CDF B;  6PAD A;  2AYO A;  4BQV A;  3I06 A;  3RVW A;  2E00 A;  1NPZ A;  3E1Z B;  5PAD A;  2HH5 A;  3HD3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...