1CSBB

Crystal structure of cathepsin b inhibited with ca030 at 2.1 angstroms resolution: a basis for the design of specific epoxysuccinyl inhibitors
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
205
structure length
205
Chain Sequence
VSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of cathepsin B inhibited with CA030 at 2.0-A resolution: A basis for the design of specific epoxysuccinyl inhibitors.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords CATHEPSIN B light chain
total genus 46
structure length 205
sequence length 205
chains with identical sequence E
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 1994-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1csbB00
3KSEA 1MEGA 1MEMA 1ME4A 1U9QX 4XR7A 4PP1A 1QXPA 5CVOB 4CDFB 2Y6EA 2DCBA 1AYVA 3PW3A 1EF7A 5JA7A 1F2BA 1YK7A 1NB5A 4I04A 3IMAA 2F7DA 3NHEA 4QRVA 2G6DA 4X6IA 5F02A 4YYSA 4N79A 3PBHA 1PIPA 1PCIA 5EF4A 1CPJA 2E02A 1ZIVA 3S3RA 3IUTA 3F5VA 4Q8HA 1BGOA 1STFE 4XUIA 4YVAA 3O1GA 1CTEA 2AUXA 1Y08A 4I07A 2ACTA 1Q6KA 3C9EA 3B79A 1CB5A 2XU1A 3V6CA 3CH2X 4OEMA 3ERVA 3BC3A 2FYEA 3P5VA 2AS8A 4QRXA 1VJVA 4YV8A 1VSNA 4YYWA 1YALA 4OELA 3IOQA 1KHPA 2YJ8A 2E03A 2R9OA 3O0UA 1TLOA 3KFQA 2C0YA 1U9XA 2G8JA 4X6HA 2DJFB 1IWDA 4CZWA 3WXGA 1AU4A 2JQGR 4FJCA 4QBBA 5PADA 3DF0A 4DMYA 2FO5A 3BOWA 4N8WA 1QDQA 3KX1A 1U9VA 2FUDA 3K9MA 4BS6A 2R9NA 4YYRA 1TU6A 4QRGA 1AIMA 1PPPA 2DJGB 1EWLA 3KWZA 3GCBA 3RVWA 3OF9A 4HWYA 1CQDA 3MORA 1MIRA 3QJ3A 3RVVA 1YT7A 3QT4A 2O6XA 2OP3A 4PI3A 1ZCMA 1AYWA 4YYQA 1U9WA 2NQDB 5J94A 1FH0A 1XKGA 3BPFA 1U5IA 3KKUA 4W5CA 4P6GA 3E1ZB 2F1GA 2DC9A 1PPNA 3CH3X 2FQ9A 2HD5A 3PNRA 2NQIA 2YJ2A 4AXMA 1NPZA 4YYUA 3IEJA 3HD3A 2B1NA 3P5WA 3MTNA 5EGWA 4CDEB 3N3KA 1BQIA 4W4UA 1M6DA 4CDCB 1SNKA 2E00A 1ICFA 3OVZA 1KHQA 3CBJA 4PADA 1AU0A 4YYVA 2HHNA 3HHAA 3N3GA 2P7UA 1CSBB 4BQVA 1NLJA 2BDLA 1EWOA 2DCDA 3BPMA 2NQGA 1PPDA 2BDZA 1PE6A 4MZSA 5CHVA 4BPVA 2IBIA 3S3QA 1O0EA 1TL9A 1S4VA 1CJLA 2OZ2A 2E01A 3I06A 5A24A 2R9CA 3LFYA 1NL6A 3V6EA 5JH3A 1Y4HA 1KXRA 2YJCA 2HH5A 1AU2A 3KWBX 1GLOA 3PDFA 2ATOA 2G7YA 2G8EA 3P5XA 1YK8A 2FRAA 2PNSA 3H7DA 1GMYA 2GHUA 3H89A 1CS8A 4G54A 1KFUL 2VHSA 3K24A 3LXSA 1ATKA 3CBKA 8PCHA 1MDWA 1PPOA 2AU1A 2JQFR 1POPA 4DMXA 3H8CA 4WA6A 1BY8A 4W5BA 9PAPA 4Q8GA 1NQCA 2FTDA 1JQPA 3HWNA 1F2CA 4QH6A 2Y5BA 2AVWA 2ARYA 1EWPA 2P0RA 1YVBA 1MHWA 2DC6A 2FRQA 2AIMA 3OVXA 4MZOA 1DF0A 5CVNB 2PBHA 3IV2A 4FIPA 2P86A 2R9FA 1DEUA 3F75A 2R9MA 2DCAA 2XU3A 1CV8A 2PADA 3ZUAA 4BSQA 1ME3A 3RVXA 7PCKA 3MHSA 3I3TA 2CB5A 1F2AA 1BP4A 3IHPA 4RY2A 5CVMA 3WXEA 3TNXA 1KFXL 4P6EA 1A6RA 4MSXA 3BWKA 1PBHA 2VHFA 4AXLA 1EWMA 2XU4A 2IPPB 5K16A 3H6SA 1QMYA 4X6JA 3N4CA 2CIOA 4KLBA 3MHHA 4K7CA 2XU5A 2DC7A 3AI8A 6PADA 4BS5A 2YJBA 4CDDB 5CHTA 2B1MA 3HHIA 2H7JA 2AUZA 3D6SA 1HUCB 4PP2E 2PREA 3WXFA 1PXVA 2WBFX 1MS6A 1GCBA 1QOLA 3QSDA 3KW9A 2DZYA 3OF8A 1CVZA 2NQAA 3H8BA 2AYNA 4ZUXU 1NB3A 1AECA 2GFOA 3OISA 2FT2A 2YJ9A 1K3BB 3K8UA 1F29A 4FK5A 4I05A 3USVA 2DZZA 1AYUA 2DC8A 4N4ZA 2AYOA 1X9YA 2HXZA 1ITOA 3M99A 3P5UA 2DCCA 1AU3A 5FPWA 1GECE 3BCNA 1THEA 1PADA 2OULA 2R6NA 1SP4B 3U8EA
chains in the Genus database with same CATH superfamily
3KSEA 1MEGA 1MEMA 1ME4A 1U9QX 4XR7A 4PP1A 1QXPA 4A5UA 3TMPA 5CVOB 4CDFB 2Y6EA 2DCBA 1AYVA 3PW3A 1EF7A 5JA7A 1F2BA 1YK7A 1NB5A 4I04A 3IMAA 3B21A 2F7DA 3W31A 3NHEA 4QRVA 2G6DA 4X6IA 5F02A 4YYSA 4N79A 3PBHA 1PIPA 1PCIA 5EF4A 1CPJA 2E02A 3RNVA 2HWKA 1ZIVA 2AGAA 2UZJA 3S3RA 3IUTA 3F5VA 4Q8HA 1BGOA 1STFE 4XUIA 4YVAA 3O1GA 1CTEA 2AUXA 1Y08A 5EZQA 4I07A 2ACTA 1Q6KA 3C9EA 3B79A 1CB5A 2XU1A 3V6CA 3CH2X 4OEMA 3ERVA 3BC3A 2FYEA 3P5VA 2AS8A 4QRXA 1VJVA 4YV8A 1VSNA 4YYWA 4OW0A 1YALA 3PRMA 5JZEA 4OELA 3IOQA 3PHWA 1KHPA 2YJ8A 2E03A 2R9OA 3O0UA 1TLOA 3KFQA 2C0YA 1U9XA 2G8JA 4X6HA 2DJFB 4REZA 1IWDA 4CZWA 3WXGA 1AU4A 2JQGR 4FJCA 4QBBA 5PADA 3DF0A 4DMYA 2FO5A 3BOWA 4N8WA 1QDQA 2DOSA 3KX1A 1U9VA 2FUDA 3K9MA 4BS6A 2R9NA 4YYRA 1TU6A 3C0RA 4QRGA 1AIMA 1PPPA 2DJGB 1EWLA 5E6JA 3KWZA 4BOUA 3GCBA 3RVWA 3OF9A 4RNAA 4HWYA 1CQDA 3MORA 1MIRA 3TRKA 3QJ3A 3RVVA 3E9SA 1YT7A 3QT4A 2O6XA 2OP3A 4PI3A 1ZCMA 3OQCA 1AYWA 4YYQA 1U9WA 2NQDB 5J94A 1FH0A 1XKGA 3BPFA 4ZTBA 1U5IA 3KKUA 4W5CA 2J7QC 3MTVA 4P6GA 3E1ZB 4BOZA 2F1GA 2DC9A 1PPNA 3CH3X 2FQ9A 2HD5A 3PNRA 2NQIA 2YJ2A 4AXMA 1NPZA 4YYUA 3IEJA 3HD3A 1YZBA 2B1NA 3P5WA 2Z84A 3MTNA 5EGWA 4CDEB 3N3KA 2JRIA 1BQIA 3PSEA 4W4UA 5KO3A 4IUMA 1M6DA 4CDCB 1SNKA 2E00A 4D8IA 1ICFA 3OVZA 1KHQA 2JTCA 3CBJA 4PADA 4M0WA 1AU0A 4YYVA 2HHNA 4IP3A 3HHAA 4WURA 3N3GA 2P7UA 1CSBB 4BQVA 1NLJA 2BDLA 4RF0A 1EWOA 2DCDA 3BPMA 2NQGA 1PPDA 2BDZA 1PE6A 4MZSA 5CHVA 4BPVA 2IBIA 3S3QA 1O0EA 1TL9A 1S4VA 1CJLA 4R3DA 4MM3B 2OZ2A 2E01A 3I06A 5A24A 2R9CA 3LFYA 1NL6A 3V6EA 5JH3A 3IFUA 1Y4HA 1KXRA 3ZNHA 2YJCA 2HH5A 1AU2A 3KWBX 1GLOA 3PDFA 2ATOA 2G7YA 4GUAA 2G8EA 3P5XA 4BOPA 1YK8A 2FRAA 2PNSA 3H7DA 3PRPA 1GMYA 3MJ5A 2GHUA 3H89A 1CS8A 4G54A 1KFUL 4MI7A 2VHSA 3K24A 3W30A 4D8BA 3LXSA 1ATKA 3CBKA 3BY4A 8PCHA 1MDWA 1PPOA 4PT5A 2AU1A 2JQFR 1POPA 4DMXA 4OVZB 3H8CA 4WA6A 1BY8A 4W5BA 9PAPA 4Q8GA 1NQCA 2FE8A 2FTDA 1JQPA 3MP2A 3HWNA 1F2CA 4QH6A 2Y5BA 2AVWA 2ARYA 1EWPA 2P0RA 2J7QA 1YVBA 1MHWA 2DC6A 2FRQA 2AIMA 3OVXA 4MZOA 1DF0A 3PHXA 1PVJA 5CVNB 2PBHA 3IV2A 4FIPA 2P86A 2R9FA 4BOQA 1DEUA 3F75A 1UKFA 2R9MA 2DCAA 2XU3A 1CV8A 2PADA 3ZUAA 4BSQA 1ME3A 3RVXA 7PCKA 3MHSA 3I3TA 2CB5A 1F2AA 2BU3A 1BP4A 3IHPA 4RY2A 5CVMA 3WXEA 3TNXA 1KFXL 4P6EA 1A6RA 4MSXA 3BWKA 4HXDB 1PBHA 2VHFA 4AXLA 1EWMA 2XU4A 2IPPB 5K16A 3H6SA 1QMYA 3PT2A 4X6JA 2CIOA 4KLBA 3MHHA 4K7CA 4RKXA 4RF1A 2XU5A 2DC7A 3AI8A 3O65A 4OVZA 6PADA 4BS5A 2YJBA 4CDDB 5CHTA 2B1MA 4BOSA 3HHIA 2BTWA 2H7JA 2AUZA 3D6SA 1HUCB 4PP2E 2PREA 3WXFA 1PXVA 2WBFX 1MS6A 1GCBA 1QOLA 3QSDA 3KW9A 2DZYA 3BB7A 3OF8A 1CVZA 2NQAA 3H8BA 4XZXA 2AYNA 4ZUXU 1NB3A 5EZSA 1AECA 2GFOA 3BBAA 3OISA 2FT2A 2YJ9A 1K3BB 3K8UA 1F29A 4FK5A 4I05A 3USVA 2DZZA 1AYUA 2DC8A 4N4ZA 3PHUA 4P16A 2BTWB 4D8EA 2AYOA 1X9YA 1DKIA 2HXZA 1ITOA 3M99A 3U8EA 3P5UA 2DCCA 1AU3A 5FPWA 1GECE 3BCNA 1THEA 1PADA 2OULA 2R6NA 1SP4B 3N4CA
chains in the Genus database with same CATH topology
3KSEA 1MEGA 1MEMA 1ME4A 1U9QX 4XR7A 4PP1A 1QXPA 5CVOB 4CDFB 2Y6EA 2DCBA 1AYVA 3PW3A 1EF7A 5JA7A 1F2BA 1YK7A 1NB5A 4I04A 3IMAA 2F7DA 3NHEA 4QRVA 2G6DA 4X6IA 5F02A 4YYSA 4N79A 3PBHA 1PIPA 1PCIA 5EF4A 1CPJA 2E02A 1ZIVA 3S3RA 3IUTA 3F5VA 4Q8HA 1BGOA 1STFE 4XUIA 4YVAA 3O1GA 1CTEA 2AUXA 1Y08A 4I07A 2ACTA 1Q6KA 3C9EA 3B79A 1CB5A 2XU1A 3V6CA 3CH2X 4OEMA 3ERVA 3BC3A 2FYEA 3P5VA 2AS8A 4QRXA 1VJVA 1W6FA 2VFBA 4YV8A 1VSNA 4YYWA 1YALA 4OELA 3IOQA 1KHPA 2YJ8A 2E03A 2R9OA 3O0UA 1TLOA 3KFQA 2C0YA 1U9XA 2G8JA 4X6HA 2DJFB 1IWDA 4CZWA 3WXGA 1AU4A 2JQGR 4FJCA 4QBBA 5PADA 3DF0A 4DMYA 2FO5A 3BOWA 4N8WA 1QDQA 3KX1A 1U9VA 2FUDA 3K9MA 4BS6A 2R9NA 4YYRA 1TU6A 4QRGA 1AIMA 1PPPA 2DJGB 1EWLA 3KWZA 3GCBA 3RVWA 3OF9A 4HWYA 1CQDA 3MORA 1MIRA 1W4TA 3QJ3A 3RVVA 1YT7A 3QT4A 2O6XA 2OP3A 4PI3A 1ZCMA 1AYWA 4YYQA 1U9WA 2NQDB 5J94A 1FH0A 1XKGA 3BPFA 1U5IA 3KKUA 4W5CA 4P6GA 3E1ZB 2F1GA 2DC9A 1PPNA 3CH3X 2FQ9A 2HD5A 3PNRA 2NQIA 2YJ2A 1GX3A 4AXMA 4C5PA 1NPZA 4YYUA 3IEJA 3HD3A 2B1NA 3P5WA 3D9WA 3MTNA 5EGWA 4CDEB 3N3KA 1BQIA 4W4UA 1M6DA 4CDCB 1SNKA 2E00A 1ICFA 3OVZA 1KHQA 3CBJA 4PADA 1AU0A 4YYVA 2HHNA 3HHAA 3N3GA 2P7UA 1CSBB 4BQVA 1NLJA 2BDLA 1EWOA 2DCDA 3BPMA 2NQGA 1PPDA 2BDZA 1PE6A 4MZSA 5CHVA 4BPVA 2IBIA 3S3QA 1O0EA 1TL9A 1S4VA 1CJLA 2OZ2A 2E01A 3I06A 5A24A 2R9CA 3LFYA 1NL6A 3V6EA 5JH3A 1Y4HA 1KXRA 2BSZA 2YJCA 2HH5A 1AU2A 3KWBX 1GLOA 3PDFA 2ATOA 2G7YA 2G8EA 3P5XA 1YK8A 2FRAA 2PNSA 3H7DA 1GMYA 2GHUA 3H89A 1CS8A 4G54A 4BGFA 1KFUL 2VHSA 3K24A 3LXSA 1W5RA 1ATKA 3CBKA 8PCHA 1MDWA 1PPOA 2AU1A 2JQFR 1POPA 4DMXA 2VFCA 3H8CA 4WA6A 1BY8A 4W5BA 9PAPA 4Q8GA 1NQCA 2FTDA 1JQPA 3HWNA 1F2CA 4QH6A 2Y5BA 2AVWA 2ARYA 1EWPA 2P0RA 1YVBA 1MHWA 2DC6A 2FRQA 2AIMA 3OVXA 4MZOA 1DF0A 5CVNB 2PBHA 3IV2A 4FIPA 2P86A 2R9FA 1DEUA 3F75A 2R9MA 2DCAA 2XU3A 1CV8A 2PADA 3ZUAA 4BSQA 1ME3A 3RVXA 7PCKA 3MHSA 3I3TA 2CB5A 1F2AA 1BP4A 3IHPA 4RY2A 5CVMA 3WXEA 3TNXA 1KFXL 4P6EA 1A6RA 4MSXA 3BWKA 1PBHA 2VHFA 4AXLA 1EWMA 2XU4A 2IPPB 5K16A 3H6SA 1QMYA 4X6JA 2CIOA 4KLBA 3MHHA 4K7CA 2XU5A 2DC7A 3AI8A 6PADA 4BS5A 2YJBA 4CDDB 5CHTA 2B1MA 3HHIA 4GUZA 2H7JA 2AUZA 3D6SA 1HUCB 4PP2E 2PREA 3WXFA 1PXVA 2WBFX 1MS6A 1GCBA 1QOLA 3QSDA 3KW9A 2DZYA 3OF8A 1CVZA 2NQAA 3H8BA 2AYNA 4ZUXU 1NB3A 1AECA 4NV8A 2GFOA 3OISA 2FT2A 2YJ9A 1K3BB 3K8UA 4B55A 1F29A 4FK5A 4I05A 3USVA 2DZZA 1AYUA 2DC8A 4N4ZA 2AYOA 1X9YA 2HXZA 1ITOA 3M99A 3U8EA 3P5UA 2DCCA 1AU3A 5FPWA 3LTWA 1GECE 1E2TA 3BCNA 1THEA 1PADA 2OULA 2R6NA 1SP4B 4NV7A 3N4CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KSE A;  1MEG A;  1MEM A;  1ME4 A;  1U9Q X;  4XR7 A;  4PP1 A;  1QXP A;  5CVO B;  4CDF B;  2Y6E A;  2DCB A;  1AYV A;  3PW3 A;  1EF7 A;  5JA7 A;  1F2B A;  1YK7 A;  1NB5 A;  4I04 A;  3IMA A;  2F7D A;  3NHE A;  4QRV A;  2G6D A;  4X6I A;  5F02 A;  4YYS A;  4N79 A;  3PBH A;  1PIP A;  1PCI A;  5EF4 A;  1CPJ A;  2E02 A;  1ZIV A;  3S3R A;  3IUT A;  3F5V A;  4Q8H A;  1BGO A;  1STF E;  4XUI A;  4YVA A;  3O1G A;  1CTE A;  2AUX A;  1Y08 A;  4I07 A;  2ACT A;  1Q6K A;  3C9E A;  3B79 A;  1CB5 A;  2XU1 A;  3V6C A;  3CH2 X;  4OEM A;  3ERV A;  3BC3 A;  2FYE A;  3P5V A;  2AS8 A;  4QRX A;  1VJV A;  4YV8 A;  1VSN A;  4YYW A;  1YAL A;  4OEL A;  3IOQ A;  1KHP A;  2YJ8 A;  2E03 A;  2R9O A;  3O0U A;  1TLO A;  3KFQ A;  2C0Y A;  1U9X A;  2G8J A;  4X6H A;  2DJF B;  1IWD A;  4CZW A;  3WXG A;  1AU4 A;  2JQG R;  4FJC A;  4QBB A;  5PAD A;  3DF0 A;  4DMY A;  2FO5 A;  3BOW A;  4N8W A;  1QDQ A;  3KX1 A;  1U9V A;  2FUD A;  3K9M A;  4BS6 A;  2R9N A;  4YYR A;  1TU6 A;  4QRG A;  1AIM A;  1PPP A;  2DJG B;  1EWL A;  3KWZ A;  3GCB A;  3RVW A;  3OF9 A;  4HWY A;  1CQD A;  3MOR A;  1MIR A;  3QJ3 A;  3RVV A;  1YT7 A;  3QT4 A;  2O6X A;  2OP3 A;  4PI3 A;  1ZCM A;  1AYW A;  4YYQ A;  1U9W A;  2NQD B;  5J94 A;  1FH0 A;  1XKG A;  3BPF A;  1U5I A;  3KKU A;  4W5C A;  4P6G A;  3E1Z B;  2F1G A;  2DC9 A;  1PPN A;  3CH3 X;  2FQ9 A;  2HD5 A;  3PNR A;  2NQI A;  2YJ2 A;  4AXM A;  1NPZ A;  4YYU A;  3IEJ A;  3HD3 A;  2B1N A;  3P5W A;  3MTN A;  5EGW A;  4CDE B;  3N3K A;  1BQI A;  4W4U A;  1M6D A;  4CDC B;  1SNK A;  2E00 A;  1ICF A;  3OVZ A;  1KHQ A;  3CBJ A;  4PAD A;  1AU0 A;  4YYV A;  2HHN A;  3HHA A;  3N3G A;  2P7U A;  1CSB B;  4BQV A;  1NLJ A;  2BDL A;  1EWO A;  2DCD A;  3BPM A;  2NQG A;  1PPD A;  2BDZ A;  1PE6 A;  4MZS A;  5CHV A;  4BPV A;  2IBI A;  3S3Q A;  1O0E A;  1TL9 A;  1S4V A;  1CJL A;  2OZ2 A;  2E01 A;  3I06 A;  5A24 A;  2R9C A;  3LFY A;  1NL6 A;  3V6E A;  5JH3 A;  1Y4H A;  1KXR A;  2YJC A;  2HH5 A;  1AU2 A;  3KWB X;  1GLO A;  3PDF A;  2ATO A;  2G7Y A;  2G8E A;  3P5X A;  1YK8 A;  2FRA A;  2PNS A;  3H7D A;  1GMY A;  2GHU A;  3H89 A;  1CS8 A;  4G54 A;  1KFU L;  2VHS A;  3K24 A;  3LXS A;  1ATK A;  3CBK A;  8PCH A;  1MDW A;  1PPO A;  2AU1 A;  2JQF R;  1POP A;  4DMX A;  3H8C A;  4WA6 A;  1BY8 A;  4W5B A;  9PAP A;  4Q8G A;  1NQC A;  2FTD A;  1JQP A;  3HWN A;  1F2C A;  4QH6 A;  2Y5B A;  2AVW A;  2ARY A;  1EWP A;  2P0R A;  1YVB A;  1MHW A;  2DC6 A;  2FRQ A;  2AIM A;  3OVX A;  4MZO A;  1DF0 A;  5CVN B;  2PBH A;  3IV2 A;  4FIP A;  2P86 A;  2R9F A;  1DEU A;  3F75 A;  2R9M A;  2DCA A;  2XU3 A;  1CV8 A;  2PAD A;  3ZUA A;  4BSQ A;  1ME3 A;  3RVX A;  7PCK A;  3MHS A;  3I3T A;  2CB5 A;  1F2A A;  1BP4 A;  3IHP A;  4RY2 A;  5CVM A;  3WXE A;  3TNX A;  1KFX L;  4P6E A;  1A6R A;  4MSX A;  3BWK A;  1PBH A;  2VHF A;  4AXL A;  1EWM A;  2XU4 A;  2IPP B;  5K16 A;  3H6S A;  1QMY A;  4X6J A;  3N4C A;  2CIO A;  4KLB A;  3MHH A;  4K7C A;  2XU5 A;  2DC7 A;  3AI8 A;  6PAD A;  4BS5 A;  2YJB A;  4CDD B;  5CHT A;  2B1M A;  3HHI A;  2H7J A;  2AUZ A;  3D6S A;  1HUC B;  4PP2 E;  2PRE A;  3WXF A;  1PXV A;  2WBF X;  1MS6 A;  1GCB A;  1QOL A;  3QSD A;  3KW9 A;  2DZY A;  3OF8 A;  1CVZ A;  2NQA A;  3H8B A;  2AYN A;  4ZUX U;  1NB3 A;  1AEC A;  2GFO A;  3OIS A;  2FT2 A;  2YJ9 A;  1K3B B;  3K8U A;  1F29 A;  4FK5 A;  4I05 A;  3USV A;  2DZZ A;  1AYU A;  2DC8 A;  4N4Z A;  2AYO A;  1X9Y A;  2HXZ A;  1ITO A;  3M99 A;  3P5U A;  2DCC A;  1AU3 A;  5FPW A;  1GEC E;  3BCN A;  1THE A;  1PAD A;  2OUL A;  2R6N A;  1SP4 B;  3U8E A; 
#chains in the Genus database with same CATH topology
 3KSE A;  1MEG A;  1MEM A;  1ME4 A;  1U9Q X;  4XR7 A;  4PP1 A;  1QXP A;  4A5U A;  3TMP A;  5CVO B;  4CDF B;  2Y6E A;  2DCB A;  1AYV A;  3PW3 A;  1EF7 A;  5JA7 A;  1F2B A;  1YK7 A;  1NB5 A;  4I04 A;  3IMA A;  3B21 A;  2F7D A;  3W31 A;  3NHE A;  4QRV A;  2G6D A;  4X6I A;  5F02 A;  4YYS A;  4N79 A;  3PBH A;  1PIP A;  1PCI A;  5EF4 A;  1CPJ A;  2E02 A;  3RNV A;  2HWK A;  1ZIV A;  2AGA A;  2UZJ A;  3S3R A;  3IUT A;  3F5V A;  4Q8H A;  1BGO A;  1STF E;  4XUI A;  4YVA A;  3O1G A;  1CTE A;  2AUX A;  1Y08 A;  5EZQ A;  4I07 A;  2ACT A;  1Q6K A;  3C9E A;  3B79 A;  1CB5 A;  2XU1 A;  3V6C A;  3CH2 X;  4OEM A;  3ERV A;  3BC3 A;  2FYE A;  3P5V A;  2AS8 A;  4QRX A;  1VJV A;  4YV8 A;  1VSN A;  4YYW A;  4OW0 A;  1YAL A;  3PRM A;  5JZE A;  4OEL A;  3IOQ A;  3PHW A;  1KHP A;  2YJ8 A;  2E03 A;  2R9O A;  3O0U A;  1TLO A;  3KFQ A;  2C0Y A;  1U9X A;  2G8J A;  4X6H A;  2DJF B;  4REZ A;  1IWD A;  4CZW A;  3WXG A;  1AU4 A;  2JQG R;  4FJC A;  4QBB A;  5PAD A;  3DF0 A;  4DMY A;  2FO5 A;  3BOW A;  4N8W A;  1QDQ A;  2DOS A;  3KX1 A;  1U9V A;  2FUD A;  3K9M A;  4BS6 A;  2R9N A;  4YYR A;  1TU6 A;  3C0R A;  4QRG A;  1AIM A;  1PPP A;  2DJG B;  1EWL A;  5E6J A;  3KWZ A;  4BOU A;  3GCB A;  3RVW A;  3OF9 A;  4RNA A;  4HWY A;  1CQD A;  3MOR A;  1MIR A;  3TRK A;  3QJ3 A;  3RVV A;  3E9S A;  1YT7 A;  3QT4 A;  2O6X A;  2OP3 A;  4PI3 A;  1ZCM A;  3OQC A;  1AYW A;  4YYQ A;  1U9W A;  2NQD B;  5J94 A;  1FH0 A;  1XKG A;  3BPF A;  4ZTB A;  1U5I A;  3KKU A;  4W5C A;  2J7Q C;  3MTV A;  4P6G A;  3E1Z B;  4BOZ A;  2F1G A;  2DC9 A;  1PPN A;  3CH3 X;  2FQ9 A;  2HD5 A;  3PNR A;  2NQI A;  2YJ2 A;  4AXM A;  1NPZ A;  4YYU A;  3IEJ A;  3HD3 A;  1YZB A;  2B1N A;  3P5W A;  2Z84 A;  3MTN A;  5EGW A;  4CDE B;  3N3K A;  2JRI A;  1BQI A;  3PSE A;  4W4U A;  5KO3 A;  4IUM A;  1M6D A;  4CDC B;  1SNK A;  2E00 A;  4D8I A;  1ICF A;  3OVZ A;  1KHQ A;  2JTC A;  3CBJ A;  4PAD A;  4M0W A;  1AU0 A;  4YYV A;  2HHN A;  4IP3 A;  3HHA A;  4WUR A;  3N3G A;  2P7U A;  1CSB B;  4BQV A;  1NLJ A;  2BDL A;  4RF0 A;  1EWO A;  2DCD A;  3BPM A;  2NQG A;  1PPD A;  2BDZ A;  1PE6 A;  4MZS A;  5CHV A;  4BPV A;  2IBI A;  3S3Q A;  1O0E A;  1TL9 A;  1S4V A;  1CJL A;  4R3D A;  4MM3 B;  2OZ2 A;  2E01 A;  3I06 A;  5A24 A;  2R9C A;  3LFY A;  1NL6 A;  3V6E A;  5JH3 A;  3IFU A;  1Y4H A;  1KXR A;  3ZNH A;  2YJC A;  2HH5 A;  1AU2 A;  3KWB X;  1GLO A;  3PDF A;  2ATO A;  2G7Y A;  4GUA A;  2G8E A;  3P5X A;  4BOP A;  1YK8 A;  2FRA A;  2PNS A;  3H7D A;  3PRP A;  1GMY A;  3MJ5 A;  2GHU A;  3H89 A;  1CS8 A;  4G54 A;  1KFU L;  4MI7 A;  2VHS A;  3K24 A;  3W30 A;  4D8B A;  3LXS A;  1ATK A;  3CBK A;  3BY4 A;  8PCH A;  1MDW A;  1PPO A;  4PT5 A;  2AU1 A;  2JQF R;  1POP A;  4DMX A;  4OVZ B;  3H8C A;  4WA6 A;  1BY8 A;  4W5B A;  9PAP A;  4Q8G A;  1NQC A;  2FE8 A;  2FTD A;  1JQP A;  3MP2 A;  3HWN A;  1F2C A;  4QH6 A;  2Y5B A;  2AVW A;  2ARY A;  1EWP A;  2P0R A;  2J7Q A;  1YVB A;  1MHW A;  2DC6 A;  2FRQ A;  2AIM A;  3OVX A;  4MZO A;  1DF0 A;  3PHX A;  1PVJ A;  5CVN B;  2PBH A;  3IV2 A;  4FIP A;  2P86 A;  2R9F A;  4BOQ A;  1DEU A;  3F75 A;  1UKF A;  2R9M A;  2DCA A;  2XU3 A;  1CV8 A;  2PAD A;  3ZUA A;  4BSQ A;  1ME3 A;  3RVX A;  7PCK A;  3MHS A;  3I3T A;  2CB5 A;  1F2A A;  2BU3 A;  1BP4 A;  3IHP A;  4RY2 A;  5CVM A;  3WXE A;  3TNX A;  1KFX L;  4P6E A;  1A6R A;  4MSX A;  3BWK A;  4HXD B;  1PBH A;  2VHF A;  4AXL A;  1EWM A;  2XU4 A;  2IPP B;  5K16 A;  3H6S A;  1QMY A;  3PT2 A;  4X6J A;  2CIO A;  4KLB A;  3MHH A;  4K7C A;  4RKX A;  4RF1 A;  2XU5 A;  2DC7 A;  3AI8 A;  3O65 A;  4OVZ A;  6PAD A;  4BS5 A;  2YJB A;  4CDD B;  5CHT A;  2B1M A;  4BOS A;  3HHI A;  2BTW A;  2H7J A;  2AUZ A;  3D6S A;  1HUC B;  4PP2 E;  2PRE A;  3WXF A;  1PXV A;  2WBF X;  1MS6 A;  1GCB A;  1QOL A;  3QSD A;  3KW9 A;  2DZY A;  3BB7 A;  3OF8 A;  1CVZ A;  2NQA A;  3H8B A;  4XZX A;  2AYN A;  4ZUX U;  1NB3 A;  5EZS A;  1AEC A;  2GFO A;  3BBA A;  3OIS A;  2FT2 A;  2YJ9 A;  1K3B B;  3K8U A;  1F29 A;  4FK5 A;  4I05 A;  3USV A;  2DZZ A;  1AYU A;  2DC8 A;  4N4Z A;  3PHU A;  4P16 A;  2BTW B;  4D8E A;  2AYO A;  1X9Y A;  1DKI A;  2HXZ A;  1ITO A;  3M99 A;  3U8E A;  3P5U A;  2DCC A;  1AU3 A;  5FPW A;  1GEC E;  3BCN A;  1THE A;  1PAD A;  2OUL A;  2R6N A;  1SP4 B;  3N4C A; 
#chains in the Genus database with same CATH homology
 3KSE A;  1MEG A;  1MEM A;  1ME4 A;  1U9Q X;  4XR7 A;  4PP1 A;  1QXP A;  5CVO B;  4CDF B;  2Y6E A;  2DCB A;  1AYV A;  3PW3 A;  1EF7 A;  5JA7 A;  1F2B A;  1YK7 A;  1NB5 A;  4I04 A;  3IMA A;  2F7D A;  3NHE A;  4QRV A;  2G6D A;  4X6I A;  5F02 A;  4YYS A;  4N79 A;  3PBH A;  1PIP A;  1PCI A;  5EF4 A;  1CPJ A;  2E02 A;  1ZIV A;  3S3R A;  3IUT A;  3F5V A;  4Q8H A;  1BGO A;  1STF E;  4XUI A;  4YVA A;  3O1G A;  1CTE A;  2AUX A;  1Y08 A;  4I07 A;  2ACT A;  1Q6K A;  3C9E A;  3B79 A;  1CB5 A;  2XU1 A;  3V6C A;  3CH2 X;  4OEM A;  3ERV A;  3BC3 A;  2FYE A;  3P5V A;  2AS8 A;  4QRX A;  1VJV A;  1W6F A;  2VFB A;  4YV8 A;  1VSN A;  4YYW A;  1YAL A;  4OEL A;  3IOQ A;  1KHP A;  2YJ8 A;  2E03 A;  2R9O A;  3O0U A;  1TLO A;  3KFQ A;  2C0Y A;  1U9X A;  2G8J A;  4X6H A;  2DJF B;  1IWD A;  4CZW A;  3WXG A;  1AU4 A;  2JQG R;  4FJC A;  4QBB A;  5PAD A;  3DF0 A;  4DMY A;  2FO5 A;  3BOW A;  4N8W A;  1QDQ A;  3KX1 A;  1U9V A;  2FUD A;  3K9M A;  4BS6 A;  2R9N A;  4YYR A;  1TU6 A;  4QRG A;  1AIM A;  1PPP A;  2DJG B;  1EWL A;  3KWZ A;  3GCB A;  3RVW A;  3OF9 A;  4HWY A;  1CQD A;  3MOR A;  1MIR A;  1W4T A;  3QJ3 A;  3RVV A;  1YT7 A;  3QT4 A;  2O6X A;  2OP3 A;  4PI3 A;  1ZCM A;  1AYW A;  4YYQ A;  1U9W A;  2NQD B;  5J94 A;  1FH0 A;  1XKG A;  3BPF A;  1U5I A;  3KKU A;  4W5C A;  4P6G A;  3E1Z B;  2F1G A;  2DC9 A;  1PPN A;  3CH3 X;  2FQ9 A;  2HD5 A;  3PNR A;  2NQI A;  2YJ2 A;  1GX3 A;  4AXM A;  4C5P A;  1NPZ A;  4YYU A;  3IEJ A;  3HD3 A;  2B1N A;  3P5W A;  3D9W A;  3MTN A;  5EGW A;  4CDE B;  3N3K A;  1BQI A;  4W4U A;  1M6D A;  4CDC B;  1SNK A;  2E00 A;  1ICF A;  3OVZ A;  1KHQ A;  3CBJ A;  4PAD A;  1AU0 A;  4YYV A;  2HHN A;  3HHA A;  3N3G A;  2P7U A;  1CSB B;  4BQV A;  1NLJ A;  2BDL A;  1EWO A;  2DCD A;  3BPM A;  2NQG A;  1PPD A;  2BDZ A;  1PE6 A;  4MZS A;  5CHV A;  4BPV A;  2IBI A;  3S3Q A;  1O0E A;  1TL9 A;  1S4V A;  1CJL A;  2OZ2 A;  2E01 A;  3I06 A;  5A24 A;  2R9C A;  3LFY A;  1NL6 A;  3V6E A;  5JH3 A;  1Y4H A;  1KXR A;  2BSZ A;  2YJC A;  2HH5 A;  1AU2 A;  3KWB X;  1GLO A;  3PDF A;  2ATO A;  2G7Y A;  2G8E A;  3P5X A;  1YK8 A;  2FRA A;  2PNS A;  3H7D A;  1GMY A;  2GHU A;  3H89 A;  1CS8 A;  4G54 A;  4BGF A;  1KFU L;  2VHS A;  3K24 A;  3LXS A;  1W5R A;  1ATK A;  3CBK A;  8PCH A;  1MDW A;  1PPO A;  2AU1 A;  2JQF R;  1POP A;  4DMX A;  2VFC A;  3H8C A;  4WA6 A;  1BY8 A;  4W5B A;  9PAP A;  4Q8G A;  1NQC A;  2FTD A;  1JQP A;  3HWN A;  1F2C A;  4QH6 A;  2Y5B A;  2AVW A;  2ARY A;  1EWP A;  2P0R A;  1YVB A;  1MHW A;  2DC6 A;  2FRQ A;  2AIM A;  3OVX A;  4MZO A;  1DF0 A;  5CVN B;  2PBH A;  3IV2 A;  4FIP A;  2P86 A;  2R9F A;  1DEU A;  3F75 A;  2R9M A;  2DCA A;  2XU3 A;  1CV8 A;  2PAD A;  3ZUA A;  4BSQ A;  1ME3 A;  3RVX A;  7PCK A;  3MHS A;  3I3T A;  2CB5 A;  1F2A A;  1BP4 A;  3IHP A;  4RY2 A;  5CVM A;  3WXE A;  3TNX A;  1KFX L;  4P6E A;  1A6R A;  4MSX A;  3BWK A;  1PBH A;  2VHF A;  4AXL A;  1EWM A;  2XU4 A;  2IPP B;  5K16 A;  3H6S A;  1QMY A;  4X6J A;  2CIO A;  4KLB A;  3MHH A;  4K7C A;  2XU5 A;  2DC7 A;  3AI8 A;  6PAD A;  4BS5 A;  2YJB A;  4CDD B;  5CHT A;  2B1M A;  3HHI A;  4GUZ A;  2H7J A;  2AUZ A;  3D6S A;  1HUC B;  4PP2 E;  2PRE A;  3WXF A;  1PXV A;  2WBF X;  1MS6 A;  1GCB A;  1QOL A;  3QSD A;  3KW9 A;  2DZY A;  3OF8 A;  1CVZ A;  2NQA A;  3H8B A;  2AYN A;  4ZUX U;  1NB3 A;  1AEC A;  4NV8 A;  2GFO A;  3OIS A;  2FT2 A;  2YJ9 A;  1K3B B;  3K8U A;  4B55 A;  1F29 A;  4FK5 A;  4I05 A;  3USV A;  2DZZ A;  1AYU A;  2DC8 A;  4N4Z A;  2AYO A;  1X9Y A;  2HXZ A;  1ITO A;  3M99 A;  3U8E A;  3P5U A;  2DCC A;  1AU3 A;  5FPW A;  3LTW A;  1GEC E;  1E2T A;  3BCN A;  1THE A;  1PAD A;  2OUL A;  2R6N A;  1SP4 B;  4NV7 A;  3N4C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...