2XU1A

Cathepsin l with a nitrile inhibitor
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
220
structure length
215
Chain Sequence
APRSVDWREKGYVTPVKNQGQCGSCWAFSATGALEGQMFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDYAFQYVQDNGGLDSEESYPYEATEESCKYNPKYSVANDAGFVDIPKQEKALMKAVATVGPISVAIDAGHESFLFYKEGIYFEPDCSSEDMDHGVLVVGYGFENNKYWLVKNSWGEEWGMGGYVKMAKDRRNHCGIASAASYPTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CATHEPSIN L1
publication title Systematic Investigation of Halogen Bonding in Protein-Ligand Interactions.
pubmed doi rcsb
source organism Homo sapiens
total genus 70
structure length 215
sequence length 220
chains with identical sequence B, C, D
ec nomenclature ec 3.4.22.15: Cathepsin L.
pdb deposition date 2010-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2xu1A00
5JH3A 2NQDB 3N3GA 1CTEA 3S3QA 1CJLA 1EWLA 2AYOA 3MTNA 1FH0A 3MHHA 1SNKA 1CV8A 2H7JA 4WA6A 3B79A 1QOLA 1CVZA 2VHFA 2B1MA 4YYSA 2E01A 2BDZA 2IBIA 4AXLA 2PNSA 2OULA 4P6EA 3CH2X 2FT2A 4FK5A 4I05A 1U9QX 2YJCA 2R6NA 4MZOA 5F02A 1NB3A 3BPMA 2HD5A 2YJBA 2DC8A 1PPPA 4X6IA 2FQ9A 4N4ZA 1CS8A 2B1NA 2G8JA 4MSXA 1CQDA 1YK8A 3GCBA 1KFXL 2E02A 2AVWA 2F1GA 1BP4A 2ACTA 1ICFA 2R9CA 1NB5A 1U9WA 1U9XA 2WBFX 4QRVA 3CH3X 3KWBX 3BPFA 1BGOA 4G54A 2O6XA 1KXRA 3S3RA 2R9OA 1VJVA 3OISA 1Y4HA 2AUZA 3KX1A 2F7DA 1Y08A 2AS8A 4Q8GA 3RVXA 2DCAA 3D6SA 1A6RA 1CPJA 2YJ8A 3V6CA 3P5UA 4OELA 3PDFA 1AECA 4YYWA 1MS6A 2XU5A 7PCKA 2BDLA 2R9NA 1U5IA 1IWDA 3TNXA 3PNRA 5CVMA 1HUCB 3IHPA 1MEMA 3OVXA 1PPNA 2AYNA 4X6JA 1QDQA 3PW3A 3KKUA 5CHTA 4BS6A 1F2CA 2E00A 4P6GA 3IMAA 3P5XA 4QH6A 1PPOA 2P0RA 4HWYA 2NQGA 1S4VA 2G8EA 5CVOB 4OEMA 2FYEA 2OZ2A 1EWPA 4AXMA 1F2AA 4W5CA 2DC9A 3BC3A 4BSQA 2DCBA 4PI3A 9PAPA 2AU1A 3N4CA 2FUDA 2DCCA 3OF9A 3DF0A 5A24A 3AI8A 4X6HA 2PREA 2GFOA 3RVWA 1X9YA 5K16A 1YVBA 3KWZA 3OF8A 1YT7A 1MDWA 1JQPA 4CDCB 1KFUL 2E03A 3O0UA 5JA7A 1TL9A 4BQVA 2XU4A 1MEGA 2NQIA 4BS5A 2NQAA 4XR7A 1GMYA 1MIRA 3CBJA 3ZUAA 2PADA 3HWNA 1BQIA 3H89A 1QMYA 4YYUA 3BWKA 4W4UA 5CVNB 3KSEA 4DMYA 2DC6A 4YYRA 2AUXA 5EGWA 4CDFB 4QRGA 4FIPA 4FJCA 3ERVA 2IPPB 3E1ZB 3MHSA 1K3BB 2DZZA 3BOWA 6PADA 1AYUA 1NL6A 3KFQA 2OP3A 1F29A 2R9MA 2JQFR 1ATKA 1STFE 2Y6EA 4CDDB 3N3KA 1GLOA 1ZCMA 4PP1A 2XU1A 4MZSA 1PPDA 4RY2A 4CZWA 3QJ3A 5CHVA 1EWOA 4Q8HA 3H6SA 2ATOA 3V6EA 2R9FA 1CB5A 2DZYA 1THEA 3U8EA 3K9MA 5J94A 4DMXA 5EF4A 1SP4B 1EF7A 4YYQA 3H7DA 2DJGB 1YK7A 1BY8A 3H8BA 3KW9A 2DCDA 1NPZA 1AYWA 3I06A 3HHAA 2PBHA 1PE6A 1TLOA 3I3TA 1XKGA 2HHNA 4I07A 4XUIA 1EWMA 5FPWA 4QRXA 3K24A 4N8WA 4BPVA 2FRQA 1ME4A 2G7YA 4PADA 3LFYA 2P7UA 3H8CA 2CIOA 1GECE 2HXZA 1AU3A 1KHPA 1VSNA 2CB5A 1AU0A 4YVAA 1GCBA 3HHIA 4QBBA 1NQCA 1PCIA 3P5VA 2FO5A 3BCNA 1POPA 4K7CA 1ZIVA 3MORA 2JQGR 3F5VA 1AU2A 4CDEB 2P86A 1DF0A 4YV8A 3USVA 4KLBA 8PCHA 2AIMA 3WXGA 1PADA 4W5BA 1YALA 3IOQA 1O0EA 1PBHA 4I04A 2G6DA 3C9EA 3CBKA 3P5WA 2Y5BA 2FRAA 1AYVA 3F75A 3WXFA 1NLJA 2HH5A 2DJFB 3O1GA 5PADA 3HD3A 1ITOA 2YJ9A 1DEUA 3IEJA 1QXPA 2VHSA 4YYVA 1PXVA 2DC7A 2GHUA 1TU6A 3IV2A 1KHQA 3QSDA 1MHWA 3IUTA 4ZUXU 3NHEA 3RVVA 2XU3A 3M99A 3K8UA 1PIPA 4PP2E 2YJ2A 1U9VA 2ARYA 1CSBB 3PBHA 1AU4A 3WXEA 3LXSA 3OVZA 1Q6KA 1AIMA 3QT4A 4N79A 2C0YA 1F2BA 1M6DA 2FTDA 1ME3A
chains in the Genus database with same CATH superfamily
5JH3A 2NQDB 3N3GA 1CTEA 4P16A 1CJLA 1EWLA 3S3QA 4GUAA 2AYOA 3MTNA 1FH0A 1UKFA 3MHHA 1SNKA 1CV8A 2H7JA 4WA6A 3B79A 2J7QC 1QOLA 1CVZA 2VHFA 2B1MA 4YYSA 2E01A 2BDZA 2IBIA 3IFUA 4AXLA 2PNSA 2OULA 4HXDB 4P6EA 3CH2X 2FT2A 4FK5A 4I05A 1U9QX 2YJCA 2R6NA 4MZOA 5F02A 1NB3A 3BPMA 2HD5A 2YJBA 2DC8A 1PPPA 4X6IA 2FQ9A 4N4ZA 1CS8A 2B1NA 2G8JA 4MSXA 1CQDA 1YK8A 3GCBA 1KFXL 2E02A 2AVWA 2F1GA 1BP4A 2ACTA 1ICFA 2R9CA 1NB5A 1U9WA 1U9XA 2WBFX 4QRVA 3CH3X 3KWBX 3BPFA 1BGOA 4G54A 4BOZA 2O6XA 1KXRA 3S3RA 2R9OA 1VJVA 3OISA 5JZEA 1Y4HA 2AUZA 3KX1A 2F7DA 1Y08A 1PVJA 2AS8A 4Q8GA 3RVXA 2DCAA 3D6SA 1A6RA 1CPJA 2YJ8A 3V6CA 2BTWB 2HWKA 3P5UA 4OELA 2BU3A 3PDFA 1AECA 4YYWA 1MS6A 2XU5A 7PCKA 2BDLA 2R9NA 2Z84A 3W30A 1U5IA 1IWDA 3TNXA 3PNRA 5CVMA 1HUCB 3IHPA 1MEMA 2DOSA 5EZSA 3OVXA 1PPNA 2AYNA 4X6JA 1QDQA 3PW3A 4OW0A 3KKUA 5CHTA 4BS6A 1F2CA 2E00A 4P6GA 3IMAA 3P5XA 4REZA 4QH6A 1PPOA 4D8BA 2P0RA 4HWYA 2NQGA 1S4VA 2G8EA 5CVOB 3MTVA 4OEMA 2FYEA 2OZ2A 1EWPA 4AXMA 1F2AA 4R3DA 4RNAA 4W5CA 2DC9A 3C0RA 4D8IA 3BC3A 4BSQA 4D8EA 4BOPA 2DCBA 4PI3A 9PAPA 2AU1A 3MJ5A 3N4CA 2FUDA 2DCCA 3OF9A 3DF0A 5A24A 3AI8A 4X6HA 2PREA 2GFOA 3RVWA 1X9YA 5K16A 1YVBA 3KWZA 3OF8A 4BOSA 1YT7A 4WURA 1MDWA 1JQPA 4CDCB 1KFUL 2E03A 2AGAA 3O0UA 5JA7A 1TL9A 4BQVA 2XU4A 3W31A 1MEGA 2NQIA 4BS5A 2NQAA 4RF1A 4XR7A 1GMYA 3PSEA 1MIRA 3CBJA 3ZUAA 4RF0A 2PADA 3HWNA 1BQIA 3H89A 4IP3A 3O65A 1QMYA 4YYUA 3BWKA 4W4UA 5CVNB 3PHXA 3KSEA 4DMYA 2DC6A 3PHUA 4YYRA 2AUXA 5EGWA 4CDFB 4QRGA 4FIPA 4FJCA 3ERVA 2IPPB 4BOUA 5E6JA 3E1ZB 3MHSA 1K3BB 2DZZA 3BOWA 6PADA 1AYUA 1NL6A 3KFQA 2OP3A 1F29A 2R9MA 2JQFR 3BY4A 3E9SA 1ATKA 1STFE 2Y6EA 4CDDB 3N3KA 1GLOA 1ZCMA 4PP1A 2XU1A 4MZSA 1PPDA 2BTWA 4RY2A 4CZWA 3QJ3A 4A5UA 5CHVA 1EWOA 4Q8HA 5KO3A 3H6SA 2ATOA 3V6EA 1DKIA 2R9FA 1CB5A 2DZYA 1THEA 3U8EA 4BOQA 3K9MA 5J94A 4DMXA 5EF4A 1SP4B 1EF7A 4YYQA 3B21A 3H7DA 2DJGB 1YK7A 1BY8A 3H8BA 3BB7A 3KW9A 2DCDA 1NPZA 1AYWA 3I06A 3HHAA 2PBHA 1PE6A 1TLOA 3I3TA 3RNVA 3PHWA 1XKGA 2HHNA 4I07A 4XUIA 1EWMA 5FPWA 1YZBA 4PT5A 4QRXA 3K24A 4N8WA 4BPVA 2FRQA 1ME4A 4IUMA 2G7YA 4PADA 3LFYA 3OQCA 4ZTBA 2P7UA 3H8CA 3ZNHA 2CIOA 3TMPA 1GECE 2HXZA 1AU3A 1KHPA 3BBAA 1VSNA 2CB5A 1AU0A 4YVAA 1GCBA 3HHIA 4QBBA 1NQCA 4OVZB 1PCIA 3P5VA 2FO5A 3BCNA 1POPA 4K7CA 1ZIVA 3MORA 2JQGR 3F5VA 1AU2A 4CDEB 4XZXA 2P86A 1DF0A 2UZJA 4YV8A 3USVA 4RKXA 4KLBA 4MI7A 8PCHA 2AIMA 4OVZA 3WXGA 1PADA 4W5BA 1YALA 3IOQA 1O0EA 1PBHA 4I04A 2G6DA 3C9EA 3CBKA 3P5WA 3PRPA 2Y5BA 2FRAA 1AYVA 3F75A 3WXFA 1NLJA 2HH5A 2DJFB 3O1GA 4M0WA 5PADA 3HD3A 1ITOA 2YJ9A 1DEUA 3IEJA 1QXPA 2VHSA 4YYVA 3MP2A 1PXVA 2DC7A 2GHUA 1TU6A 2JTCA 3IV2A 1KHQA 3QSDA 1MHWA 2J7QA 4MM3B 3IUTA 4ZUXU 3NHEA 5EZQA 2FE8A 3RVVA 2XU3A 3M99A 3K8UA 1PIPA 4PP2E 3PT2A 3TRKA 2YJ2A 1U9VA 2ARYA 1CSBB 3PBHA 2JRIA 1AU4A 3WXEA 3LXSA 3PRMA 3OVZA 1Q6KA 1AIMA 3QT4A 4N79A 2C0YA 1F2BA 1M6DA 2FTDA 1ME3A
chains in the Genus database with same CATH topology
5JH3A 2NQDB 3N3GA 1CTEA 3S3QA 1CJLA 1EWLA 2AYOA 3MTNA 1FH0A 3MHHA 1SNKA 1CV8A 2H7JA 4WA6A 3B79A 1QOLA 1CVZA 2VHFA 2B1MA 4YYSA 2E01A 2BDZA 2IBIA 4AXLA 2PNSA 2OULA 4P6EA 3CH2X 2FT2A 4FK5A 4I05A 1U9QX 2YJCA 2R6NA 4MZOA 5F02A 1NB3A 3BPMA 2HD5A 2YJBA 2DC8A 1PPPA 4X6IA 2FQ9A 4N4ZA 1CS8A 2B1NA 2G8JA 4MSXA 1CQDA 1YK8A 3GCBA 1KFXL 2E02A 1GX3A 2AVWA 2F1GA 1BP4A 2ACTA 1ICFA 2R9CA 1NB5A 1U9WA 1U9XA 2WBFX 4QRVA 3CH3X 3KWBX 3BPFA 1BGOA 4G54A 2O6XA 1KXRA 3D9WA 3S3RA 2R9OA 1VJVA 3OISA 1Y4HA 2AUZA 3KX1A 2F7DA 1Y08A 1E2TA 2AS8A 4Q8GA 3RVXA 2DCAA 3D6SA 1A6RA 1CPJA 2YJ8A 3V6CA 3P5UA 4OELA 3PDFA 1AECA 4YYWA 1MS6A 2XU5A 7PCKA 2BDLA 2R9NA 1U5IA 1IWDA 3TNXA 3PNRA 5CVMA 1HUCB 3IHPA 1MEMA 3OVXA 1PPNA 2AYNA 4X6JA 4BGFA 1QDQA 3PW3A 3KKUA 5CHTA 4BS6A 1F2CA 2E00A 4P6GA 3IMAA 3P5XA 4QH6A 1PPOA 2P0RA 4HWYA 2NQGA 1S4VA 2G8EA 5CVOB 4OEMA 2FYEA 2OZ2A 1EWPA 4AXMA 1F2AA 2VFCA 4GUZA 4W5CA 2DC9A 3BC3A 4BSQA 2DCBA 4PI3A 9PAPA 2AU1A 3N4CA 2FUDA 2DCCA 3OF9A 3DF0A 5A24A 3AI8A 4X6HA 2PREA 2GFOA 3RVWA 1X9YA 5K16A 1YVBA 3KWZA 3OF8A 1YT7A 1MDWA 1JQPA 4CDCB 1W6FA 1KFUL 2E03A 3O0UA 5JA7A 1TL9A 4BQVA 4B55A 2XU4A 3LTWA 1MEGA 2NQIA 4BS5A 2NQAA 4XR7A 1GMYA 4NV8A 1MIRA 3CBJA 3ZUAA 2PADA 3HWNA 1BQIA 3H89A 1QMYA 4YYUA 3BWKA 4W4UA 5CVNB 3KSEA 4DMYA 1W5RA 2DC6A 4YYRA 2AUXA 5EGWA 4CDFB 4QRGA 4FIPA 4FJCA 3ERVA 2IPPB 3E1ZB 2BSZA 3MHSA 1K3BB 2DZZA 3BOWA 6PADA 1AYUA 1NL6A 3KFQA 2OP3A 1F29A 2R9MA 2JQFR 1ATKA 1STFE 2Y6EA 4CDDB 3N3KA 1GLOA 1ZCMA 4PP1A 2XU1A 4MZSA 1PPDA 4RY2A 4CZWA 3QJ3A 5CHVA 1EWOA 4Q8HA 3H6SA 2ATOA 3V6EA 2R9FA 1CB5A 2DZYA 1THEA 3U8EA 3K9MA 5J94A 4DMXA 5EF4A 1SP4B 1EF7A 4YYQA 3H7DA 2DJGB 1YK7A 1BY8A 3H8BA 3KW9A 2DCDA 1NPZA 1AYWA 3I06A 3HHAA 2PBHA 1PE6A 1TLOA 3I3TA 1XKGA 2HHNA 4I07A 4XUIA 1EWMA 5FPWA 4QRXA 3K24A 4N8WA 4BPVA 2FRQA 1ME4A 4C5PA 2G7YA 4PADA 3LFYA 2P7UA 3H8CA 2CIOA 1GECE 2HXZA 1AU3A 1KHPA 1VSNA 2CB5A 1AU0A 4YVAA 1GCBA 3HHIA 4QBBA 1NQCA 1PCIA 3P5VA 2FO5A 3BCNA 1POPA 4K7CA 1ZIVA 3MORA 2JQGR 3F5VA 1AU2A 4CDEB 2P86A 1DF0A 4YV8A 3USVA 4KLBA 8PCHA 2AIMA 3WXGA 4NV7A 1PADA 4W5BA 1YALA 3IOQA 1O0EA 1PBHA 4I04A 2G6DA 3C9EA 3CBKA 3P5WA 2Y5BA 2FRAA 1AYVA 3F75A 3WXFA 1NLJA 2HH5A 2DJFB 3O1GA 5PADA 3HD3A 1ITOA 2YJ9A 1DEUA 3IEJA 1QXPA 2VHSA 4YYVA 1PXVA 2DC7A 2GHUA 1TU6A 3IV2A 1KHQA 3QSDA 1MHWA 3IUTA 4ZUXU 3NHEA 3RVVA 2XU3A 3M99A 3K8UA 1PIPA 4PP2E 2YJ2A 1U9VA 2ARYA 2VFBA 1CSBB 3PBHA 1W4TA 1AU4A 3WXEA 3LXSA 3OVZA 1Q6KA 1AIMA 3QT4A 4N79A 2C0YA 1F2BA 1M6DA 2FTDA 1ME3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JH3 A;  2NQD B;  3N3G A;  1CTE A;  3S3Q A;  1CJL A;  1EWL A;  2AYO A;  3MTN A;  1FH0 A;  3MHH A;  1SNK A;  1CV8 A;  2H7J A;  4WA6 A;  3B79 A;  1QOL A;  1CVZ A;  2VHF A;  2B1M A;  4YYS A;  2E01 A;  2BDZ A;  2IBI A;  4AXL A;  2PNS A;  2OUL A;  4P6E A;  3CH2 X;  2FT2 A;  4FK5 A;  4I05 A;  1U9Q X;  2YJC A;  2R6N A;  4MZO A;  5F02 A;  1NB3 A;  3BPM A;  2HD5 A;  2YJB A;  2DC8 A;  1PPP A;  4X6I A;  2FQ9 A;  4N4Z A;  1CS8 A;  2B1N A;  2G8J A;  4MSX A;  1CQD A;  1YK8 A;  3GCB A;  1KFX L;  2E02 A;  2AVW A;  2F1G A;  1BP4 A;  2ACT A;  1ICF A;  2R9C A;  1NB5 A;  1U9W A;  1U9X A;  2WBF X;  4QRV A;  3CH3 X;  3KWB X;  3BPF A;  1BGO A;  4G54 A;  2O6X A;  1KXR A;  3S3R A;  2R9O A;  1VJV A;  3OIS A;  1Y4H A;  2AUZ A;  3KX1 A;  2F7D A;  1Y08 A;  2AS8 A;  4Q8G A;  3RVX A;  2DCA A;  3D6S A;  1A6R A;  1CPJ A;  2YJ8 A;  3V6C A;  3P5U A;  4OEL A;  3PDF A;  1AEC A;  4YYW A;  1MS6 A;  2XU5 A;  7PCK A;  2BDL A;  2R9N A;  1U5I A;  1IWD A;  3TNX A;  3PNR A;  5CVM A;  1HUC B;  3IHP A;  1MEM A;  3OVX A;  1PPN A;  2AYN A;  4X6J A;  1QDQ A;  3PW3 A;  3KKU A;  5CHT A;  4BS6 A;  1F2C A;  2E00 A;  4P6G A;  3IMA A;  3P5X A;  4QH6 A;  1PPO A;  2P0R A;  4HWY A;  2NQG A;  1S4V A;  2G8E A;  5CVO B;  4OEM A;  2FYE A;  2OZ2 A;  1EWP A;  4AXM A;  1F2A A;  4W5C A;  2DC9 A;  3BC3 A;  4BSQ A;  2DCB A;  4PI3 A;  9PAP A;  2AU1 A;  3N4C A;  2FUD A;  2DCC A;  3OF9 A;  3DF0 A;  5A24 A;  3AI8 A;  4X6H A;  2PRE A;  2GFO A;  3RVW A;  1X9Y A;  5K16 A;  1YVB A;  3KWZ A;  3OF8 A;  1YT7 A;  1MDW A;  1JQP A;  4CDC B;  1KFU L;  2E03 A;  3O0U A;  5JA7 A;  1TL9 A;  4BQV A;  2XU4 A;  1MEG A;  2NQI A;  4BS5 A;  2NQA A;  4XR7 A;  1GMY A;  1MIR A;  3CBJ A;  3ZUA A;  2PAD A;  3HWN A;  1BQI A;  3H89 A;  1QMY A;  4YYU A;  3BWK A;  4W4U A;  5CVN B;  3KSE A;  4DMY A;  2DC6 A;  4YYR A;  2AUX A;  5EGW A;  4CDF B;  4QRG A;  4FIP A;  4FJC A;  3ERV A;  2IPP B;  3E1Z B;  3MHS A;  1K3B B;  2DZZ A;  3BOW A;  6PAD A;  1AYU A;  1NL6 A;  3KFQ A;  2OP3 A;  1F29 A;  2R9M A;  2JQF R;  1ATK A;  1STF E;  2Y6E A;  4CDD B;  3N3K A;  1GLO A;  1ZCM A;  4PP1 A;  2XU1 A;  4MZS A;  1PPD A;  4RY2 A;  4CZW A;  3QJ3 A;  5CHV A;  1EWO A;  4Q8H A;  3H6S A;  2ATO A;  3V6E A;  2R9F A;  1CB5 A;  2DZY A;  1THE A;  3U8E A;  3K9M A;  5J94 A;  4DMX A;  5EF4 A;  1SP4 B;  1EF7 A;  4YYQ A;  3H7D A;  2DJG B;  1YK7 A;  1BY8 A;  3H8B A;  3KW9 A;  2DCD A;  1NPZ A;  1AYW A;  3I06 A;  3HHA A;  2PBH A;  1PE6 A;  1TLO A;  3I3T A;  1XKG A;  2HHN A;  4I07 A;  4XUI A;  1EWM A;  5FPW A;  4QRX A;  3K24 A;  4N8W A;  4BPV A;  2FRQ A;  1ME4 A;  2G7Y A;  4PAD A;  3LFY A;  2P7U A;  3H8C A;  2CIO A;  1GEC E;  2HXZ A;  1AU3 A;  1KHP A;  1VSN A;  2CB5 A;  1AU0 A;  4YVA A;  1GCB A;  3HHI A;  4QBB A;  1NQC A;  1PCI A;  3P5V A;  2FO5 A;  3BCN A;  1POP A;  4K7C A;  1ZIV A;  3MOR A;  2JQG R;  3F5V A;  1AU2 A;  4CDE B;  2P86 A;  1DF0 A;  4YV8 A;  3USV A;  4KLB A;  8PCH A;  2AIM A;  3WXG A;  1PAD A;  4W5B A;  1YAL A;  3IOQ A;  1O0E A;  1PBH A;  4I04 A;  2G6D A;  3C9E A;  3CBK A;  3P5W A;  2Y5B A;  2FRA A;  1AYV A;  3F75 A;  3WXF A;  1NLJ A;  2HH5 A;  2DJF B;  3O1G A;  5PAD A;  3HD3 A;  1ITO A;  2YJ9 A;  1DEU A;  3IEJ A;  1QXP A;  2VHS A;  4YYV A;  1PXV A;  2DC7 A;  2GHU A;  1TU6 A;  3IV2 A;  1KHQ A;  3QSD A;  1MHW A;  3IUT A;  4ZUX U;  3NHE A;  3RVV A;  2XU3 A;  3M99 A;  3K8U A;  1PIP A;  4PP2 E;  2YJ2 A;  1U9V A;  2ARY A;  1CSB B;  3PBH A;  1AU4 A;  3WXE A;  3LXS A;  3OVZ A;  1Q6K A;  1AIM A;  3QT4 A;  4N79 A;  2C0Y A;  1F2B A;  1M6D A;  2FTD A;  1ME3 A; 
#chains in the Genus database with same CATH topology
 5JH3 A;  2NQD B;  3N3G A;  1CTE A;  4P16 A;  1CJL A;  1EWL A;  3S3Q A;  4GUA A;  2AYO A;  3MTN A;  1FH0 A;  1UKF A;  3MHH A;  1SNK A;  1CV8 A;  2H7J A;  4WA6 A;  3B79 A;  2J7Q C;  1QOL A;  1CVZ A;  2VHF A;  2B1M A;  4YYS A;  2E01 A;  2BDZ A;  2IBI A;  3IFU A;  4AXL A;  2PNS A;  2OUL A;  4HXD B;  4P6E A;  3CH2 X;  2FT2 A;  4FK5 A;  4I05 A;  1U9Q X;  2YJC A;  2R6N A;  4MZO A;  5F02 A;  1NB3 A;  3BPM A;  2HD5 A;  2YJB A;  2DC8 A;  1PPP A;  4X6I A;  2FQ9 A;  4N4Z A;  1CS8 A;  2B1N A;  2G8J A;  4MSX A;  1CQD A;  1YK8 A;  3GCB A;  1KFX L;  2E02 A;  2AVW A;  2F1G A;  1BP4 A;  2ACT A;  1ICF A;  2R9C A;  1NB5 A;  1U9W A;  1U9X A;  2WBF X;  4QRV A;  3CH3 X;  3KWB X;  3BPF A;  1BGO A;  4G54 A;  4BOZ A;  2O6X A;  1KXR A;  3S3R A;  2R9O A;  1VJV A;  3OIS A;  5JZE A;  1Y4H A;  2AUZ A;  3KX1 A;  2F7D A;  1Y08 A;  1PVJ A;  2AS8 A;  4Q8G A;  3RVX A;  2DCA A;  3D6S A;  1A6R A;  1CPJ A;  2YJ8 A;  3V6C A;  2BTW B;  2HWK A;  3P5U A;  4OEL A;  2BU3 A;  3PDF A;  1AEC A;  4YYW A;  1MS6 A;  2XU5 A;  7PCK A;  2BDL A;  2R9N A;  2Z84 A;  3W30 A;  1U5I A;  1IWD A;  3TNX A;  3PNR A;  5CVM A;  1HUC B;  3IHP A;  1MEM A;  2DOS A;  5EZS A;  3OVX A;  1PPN A;  2AYN A;  4X6J A;  1QDQ A;  3PW3 A;  4OW0 A;  3KKU A;  5CHT A;  4BS6 A;  1F2C A;  2E00 A;  4P6G A;  3IMA A;  3P5X A;  4REZ A;  4QH6 A;  1PPO A;  4D8B A;  2P0R A;  4HWY A;  2NQG A;  1S4V A;  2G8E A;  5CVO B;  3MTV A;  4OEM A;  2FYE A;  2OZ2 A;  1EWP A;  4AXM A;  1F2A A;  4R3D A;  4RNA A;  4W5C A;  2DC9 A;  3C0R A;  4D8I A;  3BC3 A;  4BSQ A;  4D8E A;  4BOP A;  2DCB A;  4PI3 A;  9PAP A;  2AU1 A;  3MJ5 A;  3N4C A;  2FUD A;  2DCC A;  3OF9 A;  3DF0 A;  5A24 A;  3AI8 A;  4X6H A;  2PRE A;  2GFO A;  3RVW A;  1X9Y A;  5K16 A;  1YVB A;  3KWZ A;  3OF8 A;  4BOS A;  1YT7 A;  4WUR A;  1MDW A;  1JQP A;  4CDC B;  1KFU L;  2E03 A;  2AGA A;  3O0U A;  5JA7 A;  1TL9 A;  4BQV A;  2XU4 A;  3W31 A;  1MEG A;  2NQI A;  4BS5 A;  2NQA A;  4RF1 A;  4XR7 A;  1GMY A;  3PSE A;  1MIR A;  3CBJ A;  3ZUA A;  4RF0 A;  2PAD A;  3HWN A;  1BQI A;  3H89 A;  4IP3 A;  3O65 A;  1QMY A;  4YYU A;  3BWK A;  4W4U A;  5CVN B;  3PHX A;  3KSE A;  4DMY A;  2DC6 A;  3PHU A;  4YYR A;  2AUX A;  5EGW A;  4CDF B;  4QRG A;  4FIP A;  4FJC A;  3ERV A;  2IPP B;  4BOU A;  5E6J A;  3E1Z B;  3MHS A;  1K3B B;  2DZZ A;  3BOW A;  6PAD A;  1AYU A;  1NL6 A;  3KFQ A;  2OP3 A;  1F29 A;  2R9M A;  2JQF R;  3BY4 A;  3E9S A;  1ATK A;  1STF E;  2Y6E A;  4CDD B;  3N3K A;  1GLO A;  1ZCM A;  4PP1 A;  2XU1 A;  4MZS A;  1PPD A;  2BTW A;  4RY2 A;  4CZW A;  3QJ3 A;  4A5U A;  5CHV A;  1EWO A;  4Q8H A;  5KO3 A;  3H6S A;  2ATO A;  3V6E A;  1DKI A;  2R9F A;  1CB5 A;  2DZY A;  1THE A;  3U8E A;  4BOQ A;  3K9M A;  5J94 A;  4DMX A;  5EF4 A;  1SP4 B;  1EF7 A;  4YYQ A;  3B21 A;  3H7D A;  2DJG B;  1YK7 A;  1BY8 A;  3H8B A;  3BB7 A;  3KW9 A;  2DCD A;  1NPZ A;  1AYW A;  3I06 A;  3HHA A;  2PBH A;  1PE6 A;  1TLO A;  3I3T A;  3RNV A;  3PHW A;  1XKG A;  2HHN A;  4I07 A;  4XUI A;  1EWM A;  5FPW A;  1YZB A;  4PT5 A;  4QRX A;  3K24 A;  4N8W A;  4BPV A;  2FRQ A;  1ME4 A;  4IUM A;  2G7Y A;  4PAD A;  3LFY A;  3OQC A;  4ZTB A;  2P7U A;  3H8C A;  3ZNH A;  2CIO A;  3TMP A;  1GEC E;  2HXZ A;  1AU3 A;  1KHP A;  3BBA A;  1VSN A;  2CB5 A;  1AU0 A;  4YVA A;  1GCB A;  3HHI A;  4QBB A;  1NQC A;  4OVZ B;  1PCI A;  3P5V A;  2FO5 A;  3BCN A;  1POP A;  4K7C A;  1ZIV A;  3MOR A;  2JQG R;  3F5V A;  1AU2 A;  4CDE B;  4XZX A;  2P86 A;  1DF0 A;  2UZJ A;  4YV8 A;  3USV A;  4RKX A;  4KLB A;  4MI7 A;  8PCH A;  2AIM A;  4OVZ A;  3WXG A;  1PAD A;  4W5B A;  1YAL A;  3IOQ A;  1O0E A;  1PBH A;  4I04 A;  2G6D A;  3C9E A;  3CBK A;  3P5W A;  3PRP A;  2Y5B A;  2FRA A;  1AYV A;  3F75 A;  3WXF A;  1NLJ A;  2HH5 A;  2DJF B;  3O1G A;  4M0W A;  5PAD A;  3HD3 A;  1ITO A;  2YJ9 A;  1DEU A;  3IEJ A;  1QXP A;  2VHS A;  4YYV A;  3MP2 A;  1PXV A;  2DC7 A;  2GHU A;  1TU6 A;  2JTC A;  3IV2 A;  1KHQ A;  3QSD A;  1MHW A;  2J7Q A;  4MM3 B;  3IUT A;  4ZUX U;  3NHE A;  5EZQ A;  2FE8 A;  3RVV A;  2XU3 A;  3M99 A;  3K8U A;  1PIP A;  4PP2 E;  3PT2 A;  3TRK A;  2YJ2 A;  1U9V A;  2ARY A;  1CSB B;  3PBH A;  2JRI A;  1AU4 A;  3WXE A;  3LXS A;  3PRM A;  3OVZ A;  1Q6K A;  1AIM A;  3QT4 A;  4N79 A;  2C0Y A;  1F2B A;  1M6D A;  2FTD A;  1ME3 A; 
#chains in the Genus database with same CATH homology
 5JH3 A;  2NQD B;  3N3G A;  1CTE A;  3S3Q A;  1CJL A;  1EWL A;  2AYO A;  3MTN A;  1FH0 A;  3MHH A;  1SNK A;  1CV8 A;  2H7J A;  4WA6 A;  3B79 A;  1QOL A;  1CVZ A;  2VHF A;  2B1M A;  4YYS A;  2E01 A;  2BDZ A;  2IBI A;  4AXL A;  2PNS A;  2OUL A;  4P6E A;  3CH2 X;  2FT2 A;  4FK5 A;  4I05 A;  1U9Q X;  2YJC A;  2R6N A;  4MZO A;  5F02 A;  1NB3 A;  3BPM A;  2HD5 A;  2YJB A;  2DC8 A;  1PPP A;  4X6I A;  2FQ9 A;  4N4Z A;  1CS8 A;  2B1N A;  2G8J A;  4MSX A;  1CQD A;  1YK8 A;  3GCB A;  1KFX L;  2E02 A;  1GX3 A;  2AVW A;  2F1G A;  1BP4 A;  2ACT A;  1ICF A;  2R9C A;  1NB5 A;  1U9W A;  1U9X A;  2WBF X;  4QRV A;  3CH3 X;  3KWB X;  3BPF A;  1BGO A;  4G54 A;  2O6X A;  1KXR A;  3D9W A;  3S3R A;  2R9O A;  1VJV A;  3OIS A;  1Y4H A;  2AUZ A;  3KX1 A;  2F7D A;  1Y08 A;  1E2T A;  2AS8 A;  4Q8G A;  3RVX A;  2DCA A;  3D6S A;  1A6R A;  1CPJ A;  2YJ8 A;  3V6C A;  3P5U A;  4OEL A;  3PDF A;  1AEC A;  4YYW A;  1MS6 A;  2XU5 A;  7PCK A;  2BDL A;  2R9N A;  1U5I A;  1IWD A;  3TNX A;  3PNR A;  5CVM A;  1HUC B;  3IHP A;  1MEM A;  3OVX A;  1PPN A;  2AYN A;  4X6J A;  4BGF A;  1QDQ A;  3PW3 A;  3KKU A;  5CHT A;  4BS6 A;  1F2C A;  2E00 A;  4P6G A;  3IMA A;  3P5X A;  4QH6 A;  1PPO A;  2P0R A;  4HWY A;  2NQG A;  1S4V A;  2G8E A;  5CVO B;  4OEM A;  2FYE A;  2OZ2 A;  1EWP A;  4AXM A;  1F2A A;  2VFC A;  4GUZ A;  4W5C A;  2DC9 A;  3BC3 A;  4BSQ A;  2DCB A;  4PI3 A;  9PAP A;  2AU1 A;  3N4C A;  2FUD A;  2DCC A;  3OF9 A;  3DF0 A;  5A24 A;  3AI8 A;  4X6H A;  2PRE A;  2GFO A;  3RVW A;  1X9Y A;  5K16 A;  1YVB A;  3KWZ A;  3OF8 A;  1YT7 A;  1MDW A;  1JQP A;  4CDC B;  1W6F A;  1KFU L;  2E03 A;  3O0U A;  5JA7 A;  1TL9 A;  4BQV A;  4B55 A;  2XU4 A;  3LTW A;  1MEG A;  2NQI A;  4BS5 A;  2NQA A;  4XR7 A;  1GMY A;  4NV8 A;  1MIR A;  3CBJ A;  3ZUA A;  2PAD A;  3HWN A;  1BQI A;  3H89 A;  1QMY A;  4YYU A;  3BWK A;  4W4U A;  5CVN B;  3KSE A;  4DMY A;  1W5R A;  2DC6 A;  4YYR A;  2AUX A;  5EGW A;  4CDF B;  4QRG A;  4FIP A;  4FJC A;  3ERV A;  2IPP B;  3E1Z B;  2BSZ A;  3MHS A;  1K3B B;  2DZZ A;  3BOW A;  6PAD A;  1AYU A;  1NL6 A;  3KFQ A;  2OP3 A;  1F29 A;  2R9M A;  2JQF R;  1ATK A;  1STF E;  2Y6E A;  4CDD B;  3N3K A;  1GLO A;  1ZCM A;  4PP1 A;  2XU1 A;  4MZS A;  1PPD A;  4RY2 A;  4CZW A;  3QJ3 A;  5CHV A;  1EWO A;  4Q8H A;  3H6S A;  2ATO A;  3V6E A;  2R9F A;  1CB5 A;  2DZY A;  1THE A;  3U8E A;  3K9M A;  5J94 A;  4DMX A;  5EF4 A;  1SP4 B;  1EF7 A;  4YYQ A;  3H7D A;  2DJG B;  1YK7 A;  1BY8 A;  3H8B A;  3KW9 A;  2DCD A;  1NPZ A;  1AYW A;  3I06 A;  3HHA A;  2PBH A;  1PE6 A;  1TLO A;  3I3T A;  1XKG A;  2HHN A;  4I07 A;  4XUI A;  1EWM A;  5FPW A;  4QRX A;  3K24 A;  4N8W A;  4BPV A;  2FRQ A;  1ME4 A;  4C5P A;  2G7Y A;  4PAD A;  3LFY A;  2P7U A;  3H8C A;  2CIO A;  1GEC E;  2HXZ A;  1AU3 A;  1KHP A;  1VSN A;  2CB5 A;  1AU0 A;  4YVA A;  1GCB A;  3HHI A;  4QBB A;  1NQC A;  1PCI A;  3P5V A;  2FO5 A;  3BCN A;  1POP A;  4K7C A;  1ZIV A;  3MOR A;  2JQG R;  3F5V A;  1AU2 A;  4CDE B;  2P86 A;  1DF0 A;  4YV8 A;  3USV A;  4KLB A;  8PCH A;  2AIM A;  3WXG A;  4NV7 A;  1PAD A;  4W5B A;  1YAL A;  3IOQ A;  1O0E A;  1PBH A;  4I04 A;  2G6D A;  3C9E A;  3CBK A;  3P5W A;  2Y5B A;  2FRA A;  1AYV A;  3F75 A;  3WXF A;  1NLJ A;  2HH5 A;  2DJF B;  3O1G A;  5PAD A;  3HD3 A;  1ITO A;  2YJ9 A;  1DEU A;  3IEJ A;  1QXP A;  2VHS A;  4YYV A;  1PXV A;  2DC7 A;  2GHU A;  1TU6 A;  3IV2 A;  1KHQ A;  3QSD A;  1MHW A;  3IUT A;  4ZUX U;  3NHE A;  3RVV A;  2XU3 A;  3M99 A;  3K8U A;  1PIP A;  4PP2 E;  2YJ2 A;  1U9V A;  2ARY A;  2VFB A;  1CSB B;  3PBH A;  1W4T A;  1AU4 A;  3WXE A;  3LXS A;  3OVZ A;  1Q6K A;  1AIM A;  3QT4 A;  4N79 A;  2C0Y A;  1F2B A;  1M6D A;  2FTD A;  1ME3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...