2FUDA

Human cathepsin s with inhibitor cra-27566
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
218
structure length
218
Chain Sequence
ILPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords cathepsin S
publication title Human Cathepsin S with Inhibitor CRA-27566
rcsb
source organism Homo sapiens
total genus 69
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2006-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2fudA00
2YJ8A 1Y4HA 2PNSA 3H6SA 1AYVA 3IOQA 3CBJA 2B1NA 5A24A 5K16A 3HHAA 1MIRA 4N8WA 2PBHA 1M6DA 5J94A 2G8JA 2DCDA 3N3GA 4YYQA 3I3TA 2NQGA 5JA7A 2VHSA 1KFUL 4Q8HA 4BS5A 4CDEB 4X6IA 2FT2A 1BQIA 4CDCB 1BY8A 3PW3A 3K8UA 2DCCA 2DC9A 4QRXA 1EWOA 3PBHA 1TLOA 2E00A 3MTNA 4MSXA 4K7CA 1X9YA 1GECE 1BGOA 3PDFA 1VSNA 3U8EA 1U5IA 1THEA 1YK8A 1ZIVA 3V6CA 1S4VA 3S3QA 2GFOA 3WXEA 1NPZA 2G7YA 2DCBA 3OVXA 3IEJA 4CDDB 1CSBB 2YJBA 5F02A 2AYOA 2DJGB 3K9MA 4YV8A 4QBBA 3KFQA 4YVAA 1MHWA 2BDZA 1IWDA 1CB5A 1F2BA 2BDLA 2R9NA 3CBKA 3C9EA 3I06A 2VHFA 3O0UA 2NQDB 9PAPA 2B1MA 1AU2A 2G8EA 2Y5BA 4BPVA 4CZWA 3WXFA 3CH2X 4BSQA 4KLBA 1SNKA 2PREA 4QRGA 3WXGA 3CH3X 3QSDA 1U9QX 1XKGA 2P86A 1CPJA 3N3KA 1HUCB 1POPA 4MZOA 3KWZA 4MZSA 1U9WA 1K3BB 2OP3A 2DC7A 1F2CA 1O0EA 2AVWA 2DCAA 4FK5A 2WBFX 4N4ZA 4BQVA 1U9VA 3H8CA 2XU3A 3HHIA 2CIOA 1AIMA 3F5VA 4G54A 2XU5A 3P5WA 3BOWA 1ATKA 4P6EA 3F75A 1PBHA 1AYWA 1QOLA 3BCNA 8PCHA 4DMXA 1MEGA 2AIMA 2XU4A 4FJCA 1NLJA 3BPFA 2HH5A 4X6HA 2DC6A 1KHQA 1MDWA 3NHEA 1QXPA 4HWYA 2YJCA 3IUTA 1AU0A 3MHSA 6PADA 2IBIA 1CS8A 4YYWA 1MEMA 3S3RA 1YALA 2PADA 2IPPB 3DF0A 2AUZA 4XUIA 2E01A 1PPPA 2HHNA 4N79A 2Y6EA 1AU3A 1TL9A 1NB5A 1CTEA 4CDFB 1NQCA 4YYUA 3AI8A 1MS6A 2OULA 1PPNA 2G6DA 3KKUA 1PIPA 4W5BA 3OVZA 1GMYA 4RY2A 2R6NA 3OF9A 2AS8A 3K24A 2F7DA 2JQGR 1ITOA 3PNRA 4Q8GA 1PE6A 2NQIA 3P5VA 3D6SA 3B79A 2FYEA 1CV8A 4PP1A 3USVA 2C0YA 2XU1A 3MHHA 1EWMA 2JQFR 2FRQA 3MORA 3KW9A 1YT7A 2O6XA 2OZ2A 4XR7A 1DEUA 5CVNB 2P0RA 4I05A 1AYUA 1AECA 2HXZA 2ATOA 3N4CA 4X6JA 1CJLA 1EWPA 1ME3A 1NB3A 3QT4A 3RVWA 3OF8A 2AYNA 1ZCMA 3H89A 1EF7A 1A6RA 4PI3A 3KWBX 2P7UA 1NL6A 5EGWA 4QH6A 1Y08A 4YYRA 3KX1A 2YJ9A 3M99A 2YJ2A 5CVOB 2AUXA 2R9OA 3H8BA 1AU4A 4AXLA 3E1ZB 4P6GA 1PXVA 2DC8A 4PP2E 1YK7A 5CHVA 2H7JA 2DZYA 1CQDA 1KFXL 1QDQA 4PADA 1U9XA 1YVBA 1JQPA 1ME4A 3IHPA 5PADA 3LFYA 2HD5A 4I04A 4BS6A 2R9CA 1F29A 3P5XA 1EWLA 4OELA 3KSEA 5FPWA 1QMYA 1PADA 4QRVA 2F1GA 1BP4A 4ZUXU 3QJ3A 1ICFA 3BPMA 1F2AA 5CHTA 2NQAA 5EF4A 5CVMA 4WA6A 2AU1A 3GCBA 3RVXA 2FO5A 4OEMA 2ARYA 1KXRA 7PCKA 3HD3A 2FRAA 1VJVA 1GLOA 1KHPA 4DMYA 2R9MA 3BWKA 2DZZA 1CVZA 5JH3A 1PPOA 4FIPA 3V6EA 2CB5A 3O1GA 3HWNA 3BC3A 3P5UA 4YYVA 2E02A 3TNXA 4W5CA 4AXMA 3IV2A 1Q6KA 1FH0A 3ZUAA 4I07A 1PCIA 3H7DA 3IMAA 2DJFB 2FUDA 2FTDA 2R9FA 1STFE 2E03A 1DF0A 1SP4B 3ERVA 1GCBA 4YYSA 2ACTA 2FQ9A 3LXSA 2GHUA 3RVVA 1TU6A 4W4UA 1PPDA 3OISA
chains in the Genus database with same CATH superfamily
2YJ8A 1Y4HA 2PNSA 3H6SA 1AYVA 3IOQA 3CBJA 2B1NA 4ZTBA 5A24A 3PRMA 5K16A 3HHAA 1MIRA 4N8WA 2PBHA 1M6DA 5J94A 4REZA 2G8JA 2DCDA 3N3GA 4YYQA 3I3TA 2NQGA 4WURA 5JA7A 2VHSA 1KFUL 4Q8HA 4R3DA 4BS5A 4CDEB 4X6IA 2FT2A 3PHWA 1BQIA 4CDCB 1BY8A 3PW3A 3K8UA 2DCCA 2DC9A 4QRXA 1EWOA 2BU3A 3PBHA 2Z84A 1TLOA 2E00A 3BY4A 3MTNA 4XZXA 4RNAA 4MSXA 4BOZA 4K7CA 1X9YA 3O65A 1GECE 1BGOA 3PDFA 1UKFA 1VSNA 3U8EA 1U5IA 1THEA 1YK8A 1ZIVA 3V6CA 1S4VA 3S3QA 2GFOA 3WXEA 1NPZA 2G7YA 2DCBA 5EZQA 3TRKA 3OVXA 3IEJA 4CDDB 1CSBB 2YJBA 5F02A 2AYOA 2DJGB 3K9MA 4YV8A 4BOQA 4QBBA 3KFQA 4YVAA 1MHWA 2BDZA 1IWDA 1CB5A 4HXDB 1F2BA 2BDLA 2R9NA 3CBKA 3C9EA 2AGAA 3I06A 2VHFA 3O0UA 2NQDB 9PAPA 2B1MA 1AU2A 2G8EA 4A5UA 4IP3A 2Y5BA 4BPVA 4CZWA 3WXFA 3CH2X 4MI7A 3OQCA 4BSQA 4KLBA 1SNKA 2PREA 2FE8A 4QRGA 3MP2A 3WXGA 3CH3X 3QSDA 2J7QC 1U9QX 1XKGA 2P86A 1CPJA 3N3KA 1HUCB 1POPA 4MZOA 3KWZA 4MZSA 1U9WA 1K3BB 2OP3A 3TMPA 2DC7A 1F2CA 1O0EA 2AVWA 2DCAA 4FK5A 2WBFX 4N4ZA 3ZNHA 4BQVA 1U9VA 3H8CA 2XU3A 3HHIA 2CIOA 1AIMA 3F5VA 4G54A 2XU5A 3P5WA 3BOWA 4BOUA 1ATKA 4P6EA 3F75A 1PBHA 1AYWA 1QOLA 4PT5A 3BCNA 8PCHA 4DMXA 1MEGA 2AIMA 5JZEA 2XU4A 2JTCA 4FJCA 1NLJA 3BPFA 2HH5A 4X6HA 2DC6A 1KHQA 1MDWA 3NHEA 1QXPA 4HWYA 2YJCA 2HWKA 3IUTA 1AU0A 3MHSA 6PADA 2IBIA 1CS8A 4YYWA 1MEMA 3S3RA 1YALA 2PADA 2IPPB 3DF0A 2AUZA 4XUIA 2E01A 1PPPA 2HHNA 4N79A 2Y6EA 1AU3A 1TL9A 1NB5A 1CTEA 4CDFB 1NQCA 4YYUA 4RF1A 3AI8A 1MS6A 3PT2A 3MJ5A 2OULA 1PPNA 2G6DA 3KKUA 5EZSA 1PIPA 4W5BA 3OVZA 1GMYA 4RY2A 2R6NA 3OF9A 2AS8A 3K24A 2F7DA 2JQGR 1ITOA 3PNRA 4Q8GA 4RF0A 1PE6A 2NQIA 3P5VA 3D6SA 3B79A 2FYEA 1CV8A 4PP1A 3USVA 2C0YA 2XU1A 3MHHA 1EWMA 2JQFR 4IUMA 2FRQA 3MORA 3KW9A 1YT7A 2O6XA 3PHUA 2OZ2A 4XR7A 1DEUA 5CVNB 2P0RA 4I05A 1AYUA 1AECA 4OW0A 2HXZA 2ATOA 3N4CA 4X6JA 1CJLA 1EWPA 1ME3A 1NB3A 3QT4A 3RVWA 3OF8A 2AYNA 1ZCMA 3MTVA 3BBAA 3IFUA 3PSEA 3H89A 1EF7A 3W31A 1A6RA 4PI3A 3PHXA 3KWBX 2P7UA 1NL6A 5EGWA 4MM3B 4QH6A 1Y08A 4YYRA 3KX1A 2YJ9A 3M99A 2YJ2A 5CVOB 2AUXA 2R9OA 3H8BA 1AU4A 4AXLA 2BTWB 3E1ZB 4P6GA 3BB7A 1DKIA 1PXVA 2DC8A 4PP2E 1YK7A 5CHVA 2H7JA 2DZYA 1CQDA 1KFXL 1QDQA 3W30A 3RNVA 5KO3A 4PADA 1U9XA 1YVBA 1JQPA 1ME4A 2DOSA 3IHPA 5PADA 3LFYA 2HD5A 4I04A 4BS6A 2R9CA 1F29A 3P5XA 1EWLA 4OELA 3KSEA 5FPWA 4BOSA 1QMYA 1PADA 4QRVA 2F1GA 1BP4A 4ZUXU 3QJ3A 1ICFA 3B21A 3BPMA 1F2AA 5CHTA 2NQAA 5EF4A 4OVZB 5CVMA 4WA6A 1PVJA 2AU1A 3GCBA 2BTWA 3RVXA 4P16A 2FO5A 4GUAA 3C0RA 4OEMA 2ARYA 1KXRA 5E6JA 7PCKA 3HD3A 1YZBA 2FRAA 1VJVA 1GLOA 1KHPA 4DMYA 2R9MA 3BWKA 2DZZA 1CVZA 5JH3A 1PPOA 2UZJA 4FIPA 4M0WA 4D8EA 3V6EA 2CB5A 3O1GA 4D8BA 3HWNA 3BC3A 3P5UA 4BOPA 3E9SA 4YYVA 2E02A 3TNXA 4W5CA 4AXMA 4D8IA 3IV2A 1Q6KA 1FH0A 3PRPA 3ZUAA 4I07A 1PCIA 4OVZA 3H7DA 3IMAA 2DJFB 2FUDA 2FTDA 2J7QA 2R9FA 1STFE 2E03A 1DF0A 1SP4B 2JRIA 3ERVA 1GCBA 4YYSA 2ACTA 2FQ9A 3LXSA 2GHUA 3RVVA 1TU6A 4W4UA 1PPDA 4RKXA 3OISA
chains in the Genus database with same CATH topology
2YJ8A 1Y4HA 2PNSA 3H6SA 1AYVA 3IOQA 3CBJA 2B1NA 5A24A 5K16A 3HHAA 1MIRA 4N8WA 2PBHA 1M6DA 5J94A 2G8JA 2DCDA 1W6FA 3N3GA 4YYQA 3I3TA 2NQGA 5JA7A 2VHSA 1KFUL 4Q8HA 4BS5A 4CDEB 4X6IA 2FT2A 1BQIA 4CDCB 1BY8A 3PW3A 3K8UA 2DCCA 2DC9A 4QRXA 1EWOA 3PBHA 1TLOA 2E00A 3MTNA 4MSXA 4K7CA 1X9YA 1GECE 1BGOA 3PDFA 1VSNA 3U8EA 1U5IA 1THEA 1YK8A 1ZIVA 3V6CA 1W5RA 1S4VA 3S3QA 2GFOA 3WXEA 1NPZA 2G7YA 2DCBA 3OVXA 1E2TA 3IEJA 4CDDB 1CSBB 2YJBA 5F02A 2AYOA 2DJGB 3K9MA 4YV8A 4QBBA 3KFQA 4YVAA 1MHWA 2BDZA 1IWDA 1CB5A 1F2BA 2BDLA 2R9NA 3CBKA 3C9EA 3I06A 2VHFA 3O0UA 2NQDB 9PAPA 2B1MA 1AU2A 2G8EA 3LTWA 2Y5BA 4BPVA 2VFBA 4CZWA 3WXFA 3CH2X 4BSQA 4KLBA 1SNKA 2PREA 4QRGA 3WXGA 3CH3X 3QSDA 1U9QX 1XKGA 2P86A 1CPJA 3N3KA 1HUCB 1POPA 4MZOA 3KWZA 4MZSA 1U9WA 1K3BB 2OP3A 2DC7A 1F2CA 1O0EA 2AVWA 2DCAA 4FK5A 2WBFX 4N4ZA 4BQVA 1U9VA 3H8CA 3D9WA 2XU3A 3HHIA 2CIOA 1AIMA 3F5VA 4G54A 2XU5A 3P5WA 3BOWA 1ATKA 4P6EA 3F75A 1PBHA 1AYWA 1QOLA 3BCNA 8PCHA 4DMXA 1MEGA 2AIMA 2XU4A 4FJCA 1NLJA 3BPFA 2HH5A 4X6HA 2DC6A 1KHQA 1MDWA 3NHEA 1QXPA 4HWYA 2YJCA 3IUTA 1AU0A 3MHSA 6PADA 2IBIA 1CS8A 4YYWA 1MEMA 3S3RA 1YALA 2PADA 2IPPB 3DF0A 2AUZA 4XUIA 2E01A 1PPPA 2HHNA 4N79A 2Y6EA 1AU3A 1TL9A 1NB5A 2BSZA 4NV8A 1CTEA 4CDFB 1NQCA 4B55A 4YYUA 3AI8A 1MS6A 2OULA 1PPNA 2G6DA 3KKUA 1PIPA 4W5BA 3OVZA 1GMYA 2VFCA 4RY2A 2R6NA 3OF9A 2AS8A 3K24A 1GX3A 4BGFA 2F7DA 2JQGR 1ITOA 3PNRA 4Q8GA 1PE6A 2NQIA 3P5VA 3D6SA 3B79A 2FYEA 1CV8A 4PP1A 3USVA 2C0YA 4NV7A 2XU1A 3MHHA 1EWMA 2JQFR 2FRQA 3MORA 3KW9A 1YT7A 2O6XA 2OZ2A 4XR7A 1DEUA 5CVNB 2P0RA 4I05A 1AYUA 1AECA 2HXZA 2ATOA 3N4CA 4X6JA 1CJLA 1EWPA 1ME3A 1NB3A 3QT4A 3RVWA 3OF8A 2AYNA 1ZCMA 3H89A 1EF7A 1A6RA 4PI3A 3KWBX 2P7UA 1NL6A 5EGWA 4QH6A 1Y08A 4YYRA 3KX1A 2YJ9A 3M99A 2YJ2A 5CVOB 2AUXA 2R9OA 3H8BA 1AU4A 4AXLA 3E1ZB 4P6GA 1PXVA 2DC8A 4PP2E 1YK7A 5CHVA 2H7JA 2DZYA 1CQDA 1KFXL 1QDQA 4PADA 1U9XA 1YVBA 1JQPA 1ME4A 3IHPA 5PADA 3LFYA 2HD5A 4I04A 4BS6A 2R9CA 1F29A 3P5XA 1EWLA 4OELA 3KSEA 5FPWA 1QMYA 1PADA 4QRVA 2F1GA 1BP4A 4ZUXU 3QJ3A 1ICFA 3BPMA 1F2AA 5CHTA 2NQAA 5EF4A 5CVMA 4WA6A 2AU1A 3GCBA 3RVXA 2FO5A 4OEMA 2ARYA 1KXRA 7PCKA 3HD3A 2FRAA 1VJVA 1GLOA 4C5PA 1KHPA 4DMYA 2R9MA 3BWKA 2DZZA 1CVZA 5JH3A 1PPOA 4FIPA 3V6EA 1W4TA 2CB5A 3O1GA 3HWNA 3BC3A 3P5UA 4YYVA 2E02A 3TNXA 4W5CA 4AXMA 3IV2A 1Q6KA 1FH0A 3ZUAA 4I07A 1PCIA 3H7DA 3IMAA 2DJFB 2FUDA 2FTDA 2R9FA 1STFE 2E03A 1DF0A 1SP4B 3ERVA 1GCBA 4YYSA 2ACTA 2FQ9A 3LXSA 2GHUA 3RVVA 1TU6A 4W4UA 1PPDA 4GUZA 3OISA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YJ8 A;  1Y4H A;  2PNS A;  3H6S A;  1AYV A;  3IOQ A;  3CBJ A;  2B1N A;  5A24 A;  5K16 A;  3HHA A;  1MIR A;  4N8W A;  2PBH A;  1M6D A;  5J94 A;  2G8J A;  2DCD A;  3N3G A;  4YYQ A;  3I3T A;  2NQG A;  5JA7 A;  2VHS A;  1KFU L;  4Q8H A;  4BS5 A;  4CDE B;  4X6I A;  2FT2 A;  1BQI A;  4CDC B;  1BY8 A;  3PW3 A;  3K8U A;  2DCC A;  2DC9 A;  4QRX A;  1EWO A;  3PBH A;  1TLO A;  2E00 A;  3MTN A;  4MSX A;  4K7C A;  1X9Y A;  1GEC E;  1BGO A;  3PDF A;  1VSN A;  3U8E A;  1U5I A;  1THE A;  1YK8 A;  1ZIV A;  3V6C A;  1S4V A;  3S3Q A;  2GFO A;  3WXE A;  1NPZ A;  2G7Y A;  2DCB A;  3OVX A;  3IEJ A;  4CDD B;  1CSB B;  2YJB A;  5F02 A;  2AYO A;  2DJG B;  3K9M A;  4YV8 A;  4QBB A;  3KFQ A;  4YVA A;  1MHW A;  2BDZ A;  1IWD A;  1CB5 A;  1F2B A;  2BDL A;  2R9N A;  3CBK A;  3C9E A;  3I06 A;  2VHF A;  3O0U A;  2NQD B;  9PAP A;  2B1M A;  1AU2 A;  2G8E A;  2Y5B A;  4BPV A;  4CZW A;  3WXF A;  3CH2 X;  4BSQ A;  4KLB A;  1SNK A;  2PRE A;  4QRG A;  3WXG A;  3CH3 X;  3QSD A;  1U9Q X;  1XKG A;  2P86 A;  1CPJ A;  3N3K A;  1HUC B;  1POP A;  4MZO A;  3KWZ A;  4MZS A;  1U9W A;  1K3B B;  2OP3 A;  2DC7 A;  1F2C A;  1O0E A;  2AVW A;  2DCA A;  4FK5 A;  2WBF X;  4N4Z A;  4BQV A;  1U9V A;  3H8C A;  2XU3 A;  3HHI A;  2CIO A;  1AIM A;  3F5V A;  4G54 A;  2XU5 A;  3P5W A;  3BOW A;  1ATK A;  4P6E A;  3F75 A;  1PBH A;  1AYW A;  1QOL A;  3BCN A;  8PCH A;  4DMX A;  1MEG A;  2AIM A;  2XU4 A;  4FJC A;  1NLJ A;  3BPF A;  2HH5 A;  4X6H A;  2DC6 A;  1KHQ A;  1MDW A;  3NHE A;  1QXP A;  4HWY A;  2YJC A;  3IUT A;  1AU0 A;  3MHS A;  6PAD A;  2IBI A;  1CS8 A;  4YYW A;  1MEM A;  3S3R A;  1YAL A;  2PAD A;  2IPP B;  3DF0 A;  2AUZ A;  4XUI A;  2E01 A;  1PPP A;  2HHN A;  4N79 A;  2Y6E A;  1AU3 A;  1TL9 A;  1NB5 A;  1CTE A;  4CDF B;  1NQC A;  4YYU A;  3AI8 A;  1MS6 A;  2OUL A;  1PPN A;  2G6D A;  3KKU A;  1PIP A;  4W5B A;  3OVZ A;  1GMY A;  4RY2 A;  2R6N A;  3OF9 A;  2AS8 A;  3K24 A;  2F7D A;  2JQG R;  1ITO A;  3PNR A;  4Q8G A;  1PE6 A;  2NQI A;  3P5V A;  3D6S A;  3B79 A;  2FYE A;  1CV8 A;  4PP1 A;  3USV A;  2C0Y A;  2XU1 A;  3MHH A;  1EWM A;  2JQF R;  2FRQ A;  3MOR A;  3KW9 A;  1YT7 A;  2O6X A;  2OZ2 A;  4XR7 A;  1DEU A;  5CVN B;  2P0R A;  4I05 A;  1AYU A;  1AEC A;  2HXZ A;  2ATO A;  3N4C A;  4X6J A;  1CJL A;  1EWP A;  1ME3 A;  1NB3 A;  3QT4 A;  3RVW A;  3OF8 A;  2AYN A;  1ZCM A;  3H89 A;  1EF7 A;  1A6R A;  4PI3 A;  3KWB X;  2P7U A;  1NL6 A;  5EGW A;  4QH6 A;  1Y08 A;  4YYR A;  3KX1 A;  2YJ9 A;  3M99 A;  2YJ2 A;  5CVO B;  2AUX A;  2R9O A;  3H8B A;  1AU4 A;  4AXL A;  3E1Z B;  4P6G A;  1PXV A;  2DC8 A;  4PP2 E;  1YK7 A;  5CHV A;  2H7J A;  2DZY A;  1CQD A;  1KFX L;  1QDQ A;  4PAD A;  1U9X A;  1YVB A;  1JQP A;  1ME4 A;  3IHP A;  5PAD A;  3LFY A;  2HD5 A;  4I04 A;  4BS6 A;  2R9C A;  1F29 A;  3P5X A;  1EWL A;  4OEL A;  3KSE A;  5FPW A;  1QMY A;  1PAD A;  4QRV A;  2F1G A;  1BP4 A;  4ZUX U;  3QJ3 A;  1ICF A;  3BPM A;  1F2A A;  5CHT A;  2NQA A;  5EF4 A;  5CVM A;  4WA6 A;  2AU1 A;  3GCB A;  3RVX A;  2FO5 A;  4OEM A;  2ARY A;  1KXR A;  7PCK A;  3HD3 A;  2FRA A;  1VJV A;  1GLO A;  1KHP A;  4DMY A;  2R9M A;  3BWK A;  2DZZ A;  1CVZ A;  5JH3 A;  1PPO A;  4FIP A;  3V6E A;  2CB5 A;  3O1G A;  3HWN A;  3BC3 A;  3P5U A;  4YYV A;  2E02 A;  3TNX A;  4W5C A;  4AXM A;  3IV2 A;  1Q6K A;  1FH0 A;  3ZUA A;  4I07 A;  1PCI A;  3H7D A;  3IMA A;  2DJF B;  2FUD A;  2FTD A;  2R9F A;  1STF E;  2E03 A;  1DF0 A;  1SP4 B;  3ERV A;  1GCB A;  4YYS A;  2ACT A;  2FQ9 A;  3LXS A;  2GHU A;  3RVV A;  1TU6 A;  4W4U A;  1PPD A;  3OIS A; 
#chains in the Genus database with same CATH topology
 2YJ8 A;  1Y4H A;  2PNS A;  3H6S A;  1AYV A;  3IOQ A;  3CBJ A;  2B1N A;  4ZTB A;  5A24 A;  3PRM A;  5K16 A;  3HHA A;  1MIR A;  4N8W A;  2PBH A;  1M6D A;  5J94 A;  4REZ A;  2G8J A;  2DCD A;  3N3G A;  4YYQ A;  3I3T A;  2NQG A;  4WUR A;  5JA7 A;  2VHS A;  1KFU L;  4Q8H A;  4R3D A;  4BS5 A;  4CDE B;  4X6I A;  2FT2 A;  3PHW A;  1BQI A;  4CDC B;  1BY8 A;  3PW3 A;  3K8U A;  2DCC A;  2DC9 A;  4QRX A;  1EWO A;  2BU3 A;  3PBH A;  2Z84 A;  1TLO A;  2E00 A;  3BY4 A;  3MTN A;  4XZX A;  4RNA A;  4MSX A;  4BOZ A;  4K7C A;  1X9Y A;  3O65 A;  1GEC E;  1BGO A;  3PDF A;  1UKF A;  1VSN A;  3U8E A;  1U5I A;  1THE A;  1YK8 A;  1ZIV A;  3V6C A;  1S4V A;  3S3Q A;  2GFO A;  3WXE A;  1NPZ A;  2G7Y A;  2DCB A;  5EZQ A;  3TRK A;  3OVX A;  3IEJ A;  4CDD B;  1CSB B;  2YJB A;  5F02 A;  2AYO A;  2DJG B;  3K9M A;  4YV8 A;  4BOQ A;  4QBB A;  3KFQ A;  4YVA A;  1MHW A;  2BDZ A;  1IWD A;  1CB5 A;  4HXD B;  1F2B A;  2BDL A;  2R9N A;  3CBK A;  3C9E A;  2AGA A;  3I06 A;  2VHF A;  3O0U A;  2NQD B;  9PAP A;  2B1M A;  1AU2 A;  2G8E A;  4A5U A;  4IP3 A;  2Y5B A;  4BPV A;  4CZW A;  3WXF A;  3CH2 X;  4MI7 A;  3OQC A;  4BSQ A;  4KLB A;  1SNK A;  2PRE A;  2FE8 A;  4QRG A;  3MP2 A;  3WXG A;  3CH3 X;  3QSD A;  2J7Q C;  1U9Q X;  1XKG A;  2P86 A;  1CPJ A;  3N3K A;  1HUC B;  1POP A;  4MZO A;  3KWZ A;  4MZS A;  1U9W A;  1K3B B;  2OP3 A;  3TMP A;  2DC7 A;  1F2C A;  1O0E A;  2AVW A;  2DCA A;  4FK5 A;  2WBF X;  4N4Z A;  3ZNH A;  4BQV A;  1U9V A;  3H8C A;  2XU3 A;  3HHI A;  2CIO A;  1AIM A;  3F5V A;  4G54 A;  2XU5 A;  3P5W A;  3BOW A;  4BOU A;  1ATK A;  4P6E A;  3F75 A;  1PBH A;  1AYW A;  1QOL A;  4PT5 A;  3BCN A;  8PCH A;  4DMX A;  1MEG A;  2AIM A;  5JZE A;  2XU4 A;  2JTC A;  4FJC A;  1NLJ A;  3BPF A;  2HH5 A;  4X6H A;  2DC6 A;  1KHQ A;  1MDW A;  3NHE A;  1QXP A;  4HWY A;  2YJC A;  2HWK A;  3IUT A;  1AU0 A;  3MHS A;  6PAD A;  2IBI A;  1CS8 A;  4YYW A;  1MEM A;  3S3R A;  1YAL A;  2PAD A;  2IPP B;  3DF0 A;  2AUZ A;  4XUI A;  2E01 A;  1PPP A;  2HHN A;  4N79 A;  2Y6E A;  1AU3 A;  1TL9 A;  1NB5 A;  1CTE A;  4CDF B;  1NQC A;  4YYU A;  4RF1 A;  3AI8 A;  1MS6 A;  3PT2 A;  3MJ5 A;  2OUL A;  1PPN A;  2G6D A;  3KKU A;  5EZS A;  1PIP A;  4W5B A;  3OVZ A;  1GMY A;  4RY2 A;  2R6N A;  3OF9 A;  2AS8 A;  3K24 A;  2F7D A;  2JQG R;  1ITO A;  3PNR A;  4Q8G A;  4RF0 A;  1PE6 A;  2NQI A;  3P5V A;  3D6S A;  3B79 A;  2FYE A;  1CV8 A;  4PP1 A;  3USV A;  2C0Y A;  2XU1 A;  3MHH A;  1EWM A;  2JQF R;  4IUM A;  2FRQ A;  3MOR A;  3KW9 A;  1YT7 A;  2O6X A;  3PHU A;  2OZ2 A;  4XR7 A;  1DEU A;  5CVN B;  2P0R A;  4I05 A;  1AYU A;  1AEC A;  4OW0 A;  2HXZ A;  2ATO A;  3N4C A;  4X6J A;  1CJL A;  1EWP A;  1ME3 A;  1NB3 A;  3QT4 A;  3RVW A;  3OF8 A;  2AYN A;  1ZCM A;  3MTV A;  3BBA A;  3IFU A;  3PSE A;  3H89 A;  1EF7 A;  3W31 A;  1A6R A;  4PI3 A;  3PHX A;  3KWB X;  2P7U A;  1NL6 A;  5EGW A;  4MM3 B;  4QH6 A;  1Y08 A;  4YYR A;  3KX1 A;  2YJ9 A;  3M99 A;  2YJ2 A;  5CVO B;  2AUX A;  2R9O A;  3H8B A;  1AU4 A;  4AXL A;  2BTW B;  3E1Z B;  4P6G A;  3BB7 A;  1DKI A;  1PXV A;  2DC8 A;  4PP2 E;  1YK7 A;  5CHV A;  2H7J A;  2DZY A;  1CQD A;  1KFX L;  1QDQ A;  3W30 A;  3RNV A;  5KO3 A;  4PAD A;  1U9X A;  1YVB A;  1JQP A;  1ME4 A;  2DOS A;  3IHP A;  5PAD A;  3LFY A;  2HD5 A;  4I04 A;  4BS6 A;  2R9C A;  1F29 A;  3P5X A;  1EWL A;  4OEL A;  3KSE A;  5FPW A;  4BOS A;  1QMY A;  1PAD A;  4QRV A;  2F1G A;  1BP4 A;  4ZUX U;  3QJ3 A;  1ICF A;  3B21 A;  3BPM A;  1F2A A;  5CHT A;  2NQA A;  5EF4 A;  4OVZ B;  5CVM A;  4WA6 A;  1PVJ A;  2AU1 A;  3GCB A;  2BTW A;  3RVX A;  4P16 A;  2FO5 A;  4GUA A;  3C0R A;  4OEM A;  2ARY A;  1KXR A;  5E6J A;  7PCK A;  3HD3 A;  1YZB A;  2FRA A;  1VJV A;  1GLO A;  1KHP A;  4DMY A;  2R9M A;  3BWK A;  2DZZ A;  1CVZ A;  5JH3 A;  1PPO A;  2UZJ A;  4FIP A;  4M0W A;  4D8E A;  3V6E A;  2CB5 A;  3O1G A;  4D8B A;  3HWN A;  3BC3 A;  3P5U A;  4BOP A;  3E9S A;  4YYV A;  2E02 A;  3TNX A;  4W5C A;  4AXM A;  4D8I A;  3IV2 A;  1Q6K A;  1FH0 A;  3PRP A;  3ZUA A;  4I07 A;  1PCI A;  4OVZ A;  3H7D A;  3IMA A;  2DJF B;  2FUD A;  2FTD A;  2J7Q A;  2R9F A;  1STF E;  2E03 A;  1DF0 A;  1SP4 B;  2JRI A;  3ERV A;  1GCB A;  4YYS A;  2ACT A;  2FQ9 A;  3LXS A;  2GHU A;  3RVV A;  1TU6 A;  4W4U A;  1PPD A;  4RKX A;  3OIS A; 
#chains in the Genus database with same CATH homology
 2YJ8 A;  1Y4H A;  2PNS A;  3H6S A;  1AYV A;  3IOQ A;  3CBJ A;  2B1N A;  5A24 A;  5K16 A;  3HHA A;  1MIR A;  4N8W A;  2PBH A;  1M6D A;  5J94 A;  2G8J A;  2DCD A;  1W6F A;  3N3G A;  4YYQ A;  3I3T A;  2NQG A;  5JA7 A;  2VHS A;  1KFU L;  4Q8H A;  4BS5 A;  4CDE B;  4X6I A;  2FT2 A;  1BQI A;  4CDC B;  1BY8 A;  3PW3 A;  3K8U A;  2DCC A;  2DC9 A;  4QRX A;  1EWO A;  3PBH A;  1TLO A;  2E00 A;  3MTN A;  4MSX A;  4K7C A;  1X9Y A;  1GEC E;  1BGO A;  3PDF A;  1VSN A;  3U8E A;  1U5I A;  1THE A;  1YK8 A;  1ZIV A;  3V6C A;  1W5R A;  1S4V A;  3S3Q A;  2GFO A;  3WXE A;  1NPZ A;  2G7Y A;  2DCB A;  3OVX A;  1E2T A;  3IEJ A;  4CDD B;  1CSB B;  2YJB A;  5F02 A;  2AYO A;  2DJG B;  3K9M A;  4YV8 A;  4QBB A;  3KFQ A;  4YVA A;  1MHW A;  2BDZ A;  1IWD A;  1CB5 A;  1F2B A;  2BDL A;  2R9N A;  3CBK A;  3C9E A;  3I06 A;  2VHF A;  3O0U A;  2NQD B;  9PAP A;  2B1M A;  1AU2 A;  2G8E A;  3LTW A;  2Y5B A;  4BPV A;  2VFB A;  4CZW A;  3WXF A;  3CH2 X;  4BSQ A;  4KLB A;  1SNK A;  2PRE A;  4QRG A;  3WXG A;  3CH3 X;  3QSD A;  1U9Q X;  1XKG A;  2P86 A;  1CPJ A;  3N3K A;  1HUC B;  1POP A;  4MZO A;  3KWZ A;  4MZS A;  1U9W A;  1K3B B;  2OP3 A;  2DC7 A;  1F2C A;  1O0E A;  2AVW A;  2DCA A;  4FK5 A;  2WBF X;  4N4Z A;  4BQV A;  1U9V A;  3H8C A;  3D9W A;  2XU3 A;  3HHI A;  2CIO A;  1AIM A;  3F5V A;  4G54 A;  2XU5 A;  3P5W A;  3BOW A;  1ATK A;  4P6E A;  3F75 A;  1PBH A;  1AYW A;  1QOL A;  3BCN A;  8PCH A;  4DMX A;  1MEG A;  2AIM A;  2XU4 A;  4FJC A;  1NLJ A;  3BPF A;  2HH5 A;  4X6H A;  2DC6 A;  1KHQ A;  1MDW A;  3NHE A;  1QXP A;  4HWY A;  2YJC A;  3IUT A;  1AU0 A;  3MHS A;  6PAD A;  2IBI A;  1CS8 A;  4YYW A;  1MEM A;  3S3R A;  1YAL A;  2PAD A;  2IPP B;  3DF0 A;  2AUZ A;  4XUI A;  2E01 A;  1PPP A;  2HHN A;  4N79 A;  2Y6E A;  1AU3 A;  1TL9 A;  1NB5 A;  2BSZ A;  4NV8 A;  1CTE A;  4CDF B;  1NQC A;  4B55 A;  4YYU A;  3AI8 A;  1MS6 A;  2OUL A;  1PPN A;  2G6D A;  3KKU A;  1PIP A;  4W5B A;  3OVZ A;  1GMY A;  2VFC A;  4RY2 A;  2R6N A;  3OF9 A;  2AS8 A;  3K24 A;  1GX3 A;  4BGF A;  2F7D A;  2JQG R;  1ITO A;  3PNR A;  4Q8G A;  1PE6 A;  2NQI A;  3P5V A;  3D6S A;  3B79 A;  2FYE A;  1CV8 A;  4PP1 A;  3USV A;  2C0Y A;  4NV7 A;  2XU1 A;  3MHH A;  1EWM A;  2JQF R;  2FRQ A;  3MOR A;  3KW9 A;  1YT7 A;  2O6X A;  2OZ2 A;  4XR7 A;  1DEU A;  5CVN B;  2P0R A;  4I05 A;  1AYU A;  1AEC A;  2HXZ A;  2ATO A;  3N4C A;  4X6J A;  1CJL A;  1EWP A;  1ME3 A;  1NB3 A;  3QT4 A;  3RVW A;  3OF8 A;  2AYN A;  1ZCM A;  3H89 A;  1EF7 A;  1A6R A;  4PI3 A;  3KWB X;  2P7U A;  1NL6 A;  5EGW A;  4QH6 A;  1Y08 A;  4YYR A;  3KX1 A;  2YJ9 A;  3M99 A;  2YJ2 A;  5CVO B;  2AUX A;  2R9O A;  3H8B A;  1AU4 A;  4AXL A;  3E1Z B;  4P6G A;  1PXV A;  2DC8 A;  4PP2 E;  1YK7 A;  5CHV A;  2H7J A;  2DZY A;  1CQD A;  1KFX L;  1QDQ A;  4PAD A;  1U9X A;  1YVB A;  1JQP A;  1ME4 A;  3IHP A;  5PAD A;  3LFY A;  2HD5 A;  4I04 A;  4BS6 A;  2R9C A;  1F29 A;  3P5X A;  1EWL A;  4OEL A;  3KSE A;  5FPW A;  1QMY A;  1PAD A;  4QRV A;  2F1G A;  1BP4 A;  4ZUX U;  3QJ3 A;  1ICF A;  3BPM A;  1F2A A;  5CHT A;  2NQA A;  5EF4 A;  5CVM A;  4WA6 A;  2AU1 A;  3GCB A;  3RVX A;  2FO5 A;  4OEM A;  2ARY A;  1KXR A;  7PCK A;  3HD3 A;  2FRA A;  1VJV A;  1GLO A;  4C5P A;  1KHP A;  4DMY A;  2R9M A;  3BWK A;  2DZZ A;  1CVZ A;  5JH3 A;  1PPO A;  4FIP A;  3V6E A;  1W4T A;  2CB5 A;  3O1G A;  3HWN A;  3BC3 A;  3P5U A;  4YYV A;  2E02 A;  3TNX A;  4W5C A;  4AXM A;  3IV2 A;  1Q6K A;  1FH0 A;  3ZUA A;  4I07 A;  1PCI A;  3H7D A;  3IMA A;  2DJF B;  2FUD A;  2FTD A;  2R9F A;  1STF E;  2E03 A;  1DF0 A;  1SP4 B;  3ERV A;  1GCB A;  4YYS A;  2ACT A;  2FQ9 A;  3LXS A;  2GHU A;  3RVV A;  1TU6 A;  4W4U A;  1PPD A;  4GUZ A;  3OIS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...