2FUDA

Human cathepsin s with inhibitor cra-27566
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
218
structure length
218
Chain Sequence
ILPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human Cathepsin S with Inhibitor CRA-27566
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords cathepsin S
total genus 69
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2006-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2fudA00
1U9VA 2FT2A 3RVWA 2CIOA 4FK5A 3KX1A 3K24A 1M6DA 4HWYA 4G54A 4ZUXU 1GLOA 1MEGA 2PREA 3IMAA 8PCHA 2NQIA 4YYVA 2OULA 3S3RA 1Q6KA 2DZZA 4N8WA 2P86A 1F2BA 1QOLA 3C9EA 1KHPA 1KXRA 2H7JA 1CVZA 2HH5A 1AU0A 3USVA 2VHSA 3B79A 5FPWA 2E01A 3TNXA 2HXZA 2JQGR 2FRAA 2OZ2A 1DF0A 4QH6A 3IV2A 1AYWA 3HHIA 4KLBA 1QDQA 4CDDB 2Y5BA 3U8EA 4Q8GA 3PBHA 1CTEA 2AYNA 1MS6A 1XKGA 3KW9A 1AIMA 4W5BA 9PAPA 2DC7A 4YYUA 4OELA 2YJCA 3KFQA 4YYSA 1F2CA 3PNRA 2FO5A 2ACTA 2AVWA 4I05A 4X6IA 2F1GA 4AXLA 4CZWA 4AXMA 2E03A 2G8JA 4DMYA 1ME4A 2DCDA 1PPDA 1TLOA 3IEJA 1STFE 2IBIA 4X6HA 2G7YA 4Q8HA 3H7DA 2FYEA 5K16A 3MORA 1F2AA 2XU5A 3WXFA 1KFUL 1FH0A 3OISA 4QBBA 1PPPA 4K7CA 2DJGB 2GHUA 2Y6EA 3N3GA 3K8UA 4XR7A 2AIMA 1PCIA 2ARYA 4YYWA 3I3TA 4MZOA 1AYVA 1BP4A 1VSNA 2PADA 1U9XA 4YYQA 1U9QX 5CVNB 4I07A 1NPZA 1Y08A 1YVBA 1ICFA 1AYUA 3NHEA 4CDFB 1MEMA 1AU4A 2BDZA 1BY8A 3OVXA 3P5VA 5J94A 4W4UA 2F7DA 1CSBB 3QT4A 3IOQA 5CVOB 2NQDB 2PNSA 4PI3A 2AS8A 3OF9A 3CH3X 5EGWA 1EWLA 1ME3A 3H89A 3QJ3A 4N4ZA 5JA7A 2HD5A 4MSXA 3O1GA 1SNKA 1YK7A 1S4VA 3BPMA 1GECE 4FIPA 3ZUAA 2NQGA 4I04A 7PCKA 1DEUA 4PP1A 2DZYA 2JQFR 3QSDA 2FUDA 1TU6A 3H8BA 2BDLA 5JH3A 3N3KA 4OEMA 1NLJA 1CS8A 3AI8A 3CBKA 3D6SA 1ZCMA 4BS6A 1YALA 1PIPA 1K3BB 2XU3A 3MHHA 3KKUA 1CPJA 4QRXA 2YJ2A 3HWNA 3O0UA 2G8EA 1ATKA 3V6EA 2DJFB 5PADA 2DC6A 4X6JA 1VJVA 2YJ8A 1BGOA 1KHQA 4P6GA 1NB5A 2AU1A 2FTDA 2FRQA 2VHFA 2ATOA 3WXEA 2DC9A 3MHSA 3P5WA 1EF7A 2R9MA 1YT7A 1CQDA 2NQAA 4PADA 2P0RA 3F5VA 3HD3A 3IUTA 1CB5A 2AUXA 2AYOA 1NL6A 1IWDA 3WXGA 2R9FA 3KWBX 3F75A 2P7UA 4MZSA 3CH2X 2CB5A 3DF0A 3BPFA 2IPPB 1AU3A 4YVAA 1NQCA 4W5CA 3K9MA 2DCBA 4P6EA 3P5XA 2R9CA 1EWOA 2B1MA 2C0YA 1POPA 3BOWA 1BQIA 2O6XA 1GCBA 1ZIVA 1PPNA 4WA6A 1PPOA 1NB3A 2B1NA 1EWMA 1QXPA 3RVXA 1PE6A 2YJBA 1PBHA 3M99A 6PADA 2HHNA 2R9OA 3LFYA 2YJ9A 3V6CA 5CHTA 3N4CA 1MDWA 2FQ9A 1AU2A 4YYRA 5A24A 1YK8A 3ERVA 1ITOA 1CV8A 3RVVA 1SP4B 3HHAA 4YV8A 1F29A 1A6RA 3PDFA 3PW3A 3P5UA 4PP2E 3BWKA 3H8CA 4XUIA 4QRVA 1CJLA 1MHWA 2XU1A 1QMYA 4FJCA 2AUZA 3E1ZB 5CHVA 2PBHA 4QRGA 1HUCB 3OF8A 3LXSA 2R6NA 2E00A 1PADA 1EWPA 3IHPA 4BQVA 2R9NA 4DMXA 2G6DA 1KFXL 4BSQA 1MIRA 1GMYA 3GCBA 3S3QA 5CVMA 4CDEB 4N79A 3I06A 1JQPA 2OP3A 1U5IA 4CDCB 1Y4HA 3OVZA 1U9WA 2E02A 1AECA 5F02A 3BC3A 2DCCA 2DCAA 3KSEA 2WBFX 2XU4A 5EF4A 2GFOA 2DC8A 3KWZA 4RY2A 3BCNA 1X9YA 3H6SA 1TL9A 1PXVA 3MTNA 3CBJA 1O0EA 4BPVA 4BS5A 1THEA
chains in the Genus database with same CATH superfamily
1U9VA 2FT2A 3RVWA 2CIOA 4FK5A 3KX1A 3K24A 3B21A 3PRPA 1M6DA 4HWYA 4G54A 3W30A 4ZUXU 1GLOA 1MEGA 2PREA 3IMAA 8PCHA 1YZBA 4BOZA 3BBAA 2NQIA 4YYVA 2OULA 3S3RA 1Q6KA 2DZZA 4N8WA 2P86A 1F2BA 1QOLA 3C9EA 1KHPA 2J7QC 1KXRA 2H7JA 1CVZA 2HH5A 1AU0A 3USVA 3PRMA 2VHSA 3B79A 5FPWA 2E01A 4WURA 3TNXA 2HXZA 2JQGR 2FRAA 2OZ2A 1DF0A 4QH6A 3IV2A 1AYWA 3HHIA 4KLBA 1QDQA 4CDDB 2Y5BA 4OVZB 3U8EA 4Q8GA 3PBHA 1CTEA 2AYNA 1MS6A 1XKGA 3KW9A 1AIMA 3TMPA 4W5BA 3PHXA 9PAPA 2DC7A 5JZEA 4YYUA 4OELA 2YJCA 3KFQA 4YYSA 4HXDB 1F2CA 3PNRA 2FO5A 2ACTA 2AVWA 3MTVA 4I05A 4X6IA 2F1GA 4AXLA 4CZWA 4AXMA 2E03A 2G8JA 4DMYA 1ME4A 2DCDA 1PPDA 1TLOA 3IEJA 2BTWA 1STFE 2IBIA 4X6HA 2G7YA 4Q8HA 3H7DA 2FYEA 2AGAA 5K16A 3BY4A 4PT5A 3MORA 1F2AA 2XU5A 3WXFA 4D8IA 1KFUL 1FH0A 3OISA 4QBBA 1PPPA 4K7CA 2DJGB 3BB7A 2GHUA 2Y6EA 3N3GA 3K8UA 4XR7A 2AIMA 1PCIA 2ARYA 4YYWA 3I3TA 4MZOA 1AYVA 1BP4A 3IFUA 1VSNA 2PADA 1U9XA 4YYQA 1U9QX 2BTWB 5CVNB 4I07A 1NPZA 4D8EA 1Y08A 4P16A 1YVBA 1ICFA 1AYUA 3NHEA 4CDFB 1MEMA 1AU4A 2BDZA 1BY8A 2HWKA 3OVXA 3P5VA 5EZQA 5J94A 4W4UA 2F7DA 1CSBB 3QT4A 3PT2A 3IOQA 5CVOB 2NQDB 5EZSA 2PNSA 3ZNHA 4PI3A 2AS8A 3OF9A 3CH3X 5EGWA 1EWLA 1ME3A 2Z84A 3H89A 3QJ3A 4N4ZA 5JA7A 2HD5A 4MSXA 3O1GA 1SNKA 4BOUA 1YK7A 1S4VA 3BPMA 1GECE 4FIPA 3ZUAA 2NQGA 4I04A 4OVZA 7PCKA 1DEUA 4PP1A 2DZYA 2JQFR 3QSDA 2FUDA 1TU6A 3H8BA 2BDLA 5JH3A 3N3KA 4OEMA 1NLJA 1CS8A 3AI8A 3CBKA 3D6SA 1ZCMA 4BOSA 4BS6A 1YALA 1PIPA 1K3BB 4MI7A 2XU3A 3MHHA 3KKUA 1CPJA 4QRXA 2YJ2A 1PVJA 3HWNA 2G8EA 1ATKA 3O0UA 3PHWA 3V6EA 2DJFB 4R3DA 4OW0A 5PADA 2DC6A 4X6JA 1VJVA 2YJ8A 1THEA 1BGOA 1KHQA 4P6GA 1NB5A 2AU1A 2FTDA 2FRQA 2VHFA 2ATOA 3WXEA 2DC9A 4M0WA 3MHSA 3P5WA 1EF7A 2R9MA 1YT7A 1CQDA 2NQAA 4PADA 2P0RA 3F5VA 3HD3A 3IUTA 1CB5A 2AUXA 2AYOA 3RNVA 1NL6A 1IWDA 3WXGA 4BOPA 1UKFA 2R9FA 3KWBX 3F75A 2JTCA 2P7UA 4MZSA 3CH2X 2CB5A 3DF0A 3BPFA 2IPPB 1AU3A 4YVAA 1NQCA 4W5CA 3K9MA 2J7QA 2DCBA 4P6EA 3P5XA 2R9CA 4REZA 1EWOA 2B1MA 2C0YA 3PSEA 1POPA 3BOWA 1BQIA 2O6XA 1GCBA 1ZIVA 3TRKA 1PPNA 4WA6A 1PPOA 1NB3A 2B1NA 1EWMA 1QXPA 3RVXA 4D8BA 1DKIA 1PE6A 2YJBA 1PBHA 3M99A 4A5UA 6PADA 2HHNA 2R9OA 3LFYA 2DOSA 2YJ9A 3V6CA 5CHTA 3N4CA 3PHUA 1MDWA 2FQ9A 1AU2A 4YYRA 5A24A 1YK8A 3ERVA 1ITOA 1CV8A 3RVVA 3O65A 1SP4B 4BOQA 2FE8A 3HHAA 4YV8A 3C0RA 4MM3B 4IP3A 1F29A 1A6RA 3PDFA 3PW3A 3P5UA 4PP2E 3BWKA 3H8CA 4XUIA 5E6JA 4QRVA 1CJLA 1MHWA 3W31A 2XU1A 1QMYA 4FJCA 2AUZA 3E1ZB 5CHVA 2PBHA 4QRGA 1HUCB 4IUMA 3OF8A 3LXSA 2R6NA 2E00A 1PADA 1EWPA 3IHPA 4BQVA 4RKXA 2R9NA 4DMXA 2G6DA 4RNAA 1KFXL 4BSQA 1MIRA 1GMYA 3E9SA 3GCBA 3S3QA 5CVMA 4CDEB 4N79A 3I06A 1JQPA 2OP3A 4RF0A 1U5IA 4CDCB 4GUAA 1Y4HA 3OVZA 1U9WA 2E02A 1AECA 2JRIA 4RF1A 3MJ5A 5F02A 3BC3A 3MP2A 2UZJA 2DCCA 2DCAA 3KSEA 2WBFX 2BU3A 2XU4A 2GFOA 5EF4A 2DC8A 3KWZA 4ZTBA 4RY2A 3BCNA 1X9YA 3H6SA 1TL9A 4XZXA 1PXVA 3MTNA 3CBJA 1O0EA 4BPVA 4BS5A 3OQCA 5KO3A
chains in the Genus database with same CATH topology
1U9VA 2FT2A 3RVWA 2CIOA 4FK5A 3KX1A 3K24A 1M6DA 4HWYA 4G54A 4ZUXU 1GLOA 1MEGA 2PREA 3IMAA 8PCHA 2NQIA 4YYVA 2OULA 3S3RA 1Q6KA 2DZZA 4N8WA 2P86A 1F2BA 1QOLA 1E2TA 3C9EA 1KHPA 1KXRA 2H7JA 1CVZA 2HH5A 1AU0A 3USVA 2VHSA 3B79A 5FPWA 2E01A 3TNXA 2HXZA 2JQGR 2FRAA 2OZ2A 1DF0A 4QH6A 3IV2A 1AYWA 4BGFA 3HHIA 4KLBA 1QDQA 4CDDB 2Y5BA 3U8EA 4Q8GA 3PBHA 1CTEA 2AYNA 1MS6A 1XKGA 3KW9A 1AIMA 4W5BA 9PAPA 2DC7A 4YYUA 4OELA 2YJCA 3KFQA 4YYSA 1F2CA 3PNRA 2FO5A 2ACTA 2AVWA 2VFBA 1W5RA 4I05A 4X6IA 2F1GA 4AXLA 4CZWA 4AXMA 2E03A 2G8JA 4DMYA 1ME4A 2DCDA 1PPDA 1TLOA 4B55A 3IEJA 1STFE 2IBIA 4X6HA 2G7YA 4Q8HA 3H7DA 2FYEA 5K16A 3MORA 1F2AA 2XU5A 3WXFA 1KFUL 1FH0A 3OISA 4QBBA 1PPPA 4K7CA 2DJGB 2GHUA 2Y6EA 3N3GA 3K8UA 4XR7A 2AIMA 1PCIA 2ARYA 4YYWA 3I3TA 4MZOA 1AYVA 3LTWA 1BP4A 1VSNA 2PADA 1U9XA 4YYQA 1U9QX 5CVNB 4I07A 1NPZA 1W6FA 1Y08A 1YVBA 1ICFA 1AYUA 3NHEA 4CDFB 1MEMA 1AU4A 2BDZA 1BY8A 3OVXA 3P5VA 5J94A 4W4UA 2F7DA 1CSBB 3QT4A 3IOQA 5CVOB 2NQDB 2PNSA 4PI3A 2AS8A 3OF9A 3CH3X 5EGWA 1EWLA 1ME3A 3H89A 3QJ3A 4N4ZA 5JA7A 2HD5A 4MSXA 3O1GA 1SNKA 1YK7A 1S4VA 3BPMA 1GECE 4FIPA 3ZUAA 2NQGA 4I04A 7PCKA 1DEUA 4PP1A 2DZYA 2JQFR 3QSDA 2FUDA 1TU6A 3H8BA 2BDLA 5JH3A 3N3KA 4OEMA 1NLJA 1CS8A 3AI8A 3CBKA 3D6SA 1ZCMA 2BSZA 4BS6A 1YALA 1PIPA 1K3BB 2XU3A 3MHHA 3KKUA 1CPJA 4QRXA 2YJ2A 3HWNA 3O0UA 2G8EA 1ATKA 4NV8A 3V6EA 2DJFB 5PADA 2DC6A 4X6JA 1VJVA 2YJ8A 1BGOA 1KHQA 4P6GA 1NB5A 2AU1A 2FTDA 2FRQA 2VHFA 2ATOA 3WXEA 2DC9A 3MHSA 3P5WA 1EF7A 2R9MA 1YT7A 1CQDA 2NQAA 4PADA 2P0RA 3F5VA 3HD3A 3IUTA 1CB5A 2AUXA 2AYOA 1NL6A 1IWDA 3WXGA 2R9FA 3KWBX 3F75A 2P7UA 4MZSA 3CH2X 2CB5A 3DF0A 3BPFA 2IPPB 3D9WA 1AU3A 4YVAA 1NQCA 4W5CA 3K9MA 1W4TA 2DCBA 4P6EA 3P5XA 2R9CA 1EWOA 2B1MA 2C0YA 1POPA 3BOWA 1BQIA 2O6XA 1GCBA 1ZIVA 1PPNA 4WA6A 1PPOA 1NB3A 2B1NA 1EWMA 2VFCA 1QXPA 3RVXA 1PE6A 2YJBA 1PBHA 3M99A 4NV7A 6PADA 2HHNA 2R9OA 3LFYA 2YJ9A 3V6CA 5CHTA 3N4CA 1MDWA 2FQ9A 1AU2A 4YYRA 5A24A 1YK8A 3ERVA 1ITOA 1CV8A 3RVVA 1SP4B 3HHAA 4YV8A 1F29A 1A6RA 3PDFA 3PW3A 3P5UA 4PP2E 3BWKA 3H8CA 4XUIA 4QRVA 1CJLA 1MHWA 2XU1A 1QMYA 4FJCA 2AUZA 3E1ZB 5CHVA 2PBHA 4QRGA 1HUCB 3OF8A 3LXSA 2R6NA 2E00A 1PADA 1EWPA 3IHPA 4BQVA 2R9NA 4DMXA 2G6DA 1KFXL 4BSQA 1MIRA 1GMYA 3GCBA 3S3QA 5CVMA 4CDEB 4N79A 3I06A 1GX3A 1JQPA 2OP3A 1U5IA 4CDCB 1Y4HA 3OVZA 1U9WA 2E02A 1AECA 4GUZA 5F02A 3BC3A 2DCCA 2DCAA 3KSEA 2WBFX 2XU4A 5EF4A 2GFOA 2DC8A 3KWZA 4RY2A 3BCNA 4C5PA 1X9YA 3H6SA 1TL9A 1PXVA 3MTNA 3CBJA 1O0EA 4BPVA 4BS5A 1THEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U9V A;  2FT2 A;  3RVW A;  2CIO A;  4FK5 A;  3KX1 A;  3K24 A;  1M6D A;  4HWY A;  4G54 A;  4ZUX U;  1GLO A;  1MEG A;  2PRE A;  3IMA A;  8PCH A;  2NQI A;  4YYV A;  2OUL A;  3S3R A;  1Q6K A;  2DZZ A;  4N8W A;  2P86 A;  1F2B A;  1QOL A;  3C9E A;  1KHP A;  1KXR A;  2H7J A;  1CVZ A;  2HH5 A;  1AU0 A;  3USV A;  2VHS A;  3B79 A;  5FPW A;  2E01 A;  3TNX A;  2HXZ A;  2JQG R;  2FRA A;  2OZ2 A;  1DF0 A;  4QH6 A;  3IV2 A;  1AYW A;  3HHI A;  4KLB A;  1QDQ A;  4CDD B;  2Y5B A;  3U8E A;  4Q8G A;  3PBH A;  1CTE A;  2AYN A;  1MS6 A;  1XKG A;  3KW9 A;  1AIM A;  4W5B A;  9PAP A;  2DC7 A;  4YYU A;  4OEL A;  2YJC A;  3KFQ A;  4YYS A;  1F2C A;  3PNR A;  2FO5 A;  2ACT A;  2AVW A;  4I05 A;  4X6I A;  2F1G A;  4AXL A;  4CZW A;  4AXM A;  2E03 A;  2G8J A;  4DMY A;  1ME4 A;  2DCD A;  1PPD A;  1TLO A;  3IEJ A;  1STF E;  2IBI A;  4X6H A;  2G7Y A;  4Q8H A;  3H7D A;  2FYE A;  5K16 A;  3MOR A;  1F2A A;  2XU5 A;  3WXF A;  1KFU L;  1FH0 A;  3OIS A;  4QBB A;  1PPP A;  4K7C A;  2DJG B;  2GHU A;  2Y6E A;  3N3G A;  3K8U A;  4XR7 A;  2AIM A;  1PCI A;  2ARY A;  4YYW A;  3I3T A;  4MZO A;  1AYV A;  1BP4 A;  1VSN A;  2PAD A;  1U9X A;  4YYQ A;  1U9Q X;  5CVN B;  4I07 A;  1NPZ A;  1Y08 A;  1YVB A;  1ICF A;  1AYU A;  3NHE A;  4CDF B;  1MEM A;  1AU4 A;  2BDZ A;  1BY8 A;  3OVX A;  3P5V A;  5J94 A;  4W4U A;  2F7D A;  1CSB B;  3QT4 A;  3IOQ A;  5CVO B;  2NQD B;  2PNS A;  4PI3 A;  2AS8 A;  3OF9 A;  3CH3 X;  5EGW A;  1EWL A;  1ME3 A;  3H89 A;  3QJ3 A;  4N4Z A;  5JA7 A;  2HD5 A;  4MSX A;  3O1G A;  1SNK A;  1YK7 A;  1S4V A;  3BPM A;  1GEC E;  4FIP A;  3ZUA A;  2NQG A;  4I04 A;  7PCK A;  1DEU A;  4PP1 A;  2DZY A;  2JQF R;  3QSD A;  2FUD A;  1TU6 A;  3H8B A;  2BDL A;  5JH3 A;  3N3K A;  4OEM A;  1NLJ A;  1CS8 A;  3AI8 A;  3CBK A;  3D6S A;  1ZCM A;  4BS6 A;  1YAL A;  1PIP A;  1K3B B;  2XU3 A;  3MHH A;  3KKU A;  1CPJ A;  4QRX A;  2YJ2 A;  3HWN A;  3O0U A;  2G8E A;  1ATK A;  3V6E A;  2DJF B;  5PAD A;  2DC6 A;  4X6J A;  1VJV A;  2YJ8 A;  1BGO A;  1KHQ A;  4P6G A;  1NB5 A;  2AU1 A;  2FTD A;  2FRQ A;  2VHF A;  2ATO A;  3WXE A;  2DC9 A;  3MHS A;  3P5W A;  1EF7 A;  2R9M A;  1YT7 A;  1CQD A;  2NQA A;  4PAD A;  2P0R A;  3F5V A;  3HD3 A;  3IUT A;  1CB5 A;  2AUX A;  2AYO A;  1NL6 A;  1IWD A;  3WXG A;  2R9F A;  3KWB X;  3F75 A;  2P7U A;  4MZS A;  3CH2 X;  2CB5 A;  3DF0 A;  3BPF A;  2IPP B;  1AU3 A;  4YVA A;  1NQC A;  4W5C A;  3K9M A;  2DCB A;  4P6E A;  3P5X A;  2R9C A;  1EWO A;  2B1M A;  2C0Y A;  1POP A;  3BOW A;  1BQI A;  2O6X A;  1GCB A;  1ZIV A;  1PPN A;  4WA6 A;  1PPO A;  1NB3 A;  2B1N A;  1EWM A;  1QXP A;  3RVX A;  1PE6 A;  2YJB A;  1PBH A;  3M99 A;  6PAD A;  2HHN A;  2R9O A;  3LFY A;  2YJ9 A;  3V6C A;  5CHT A;  3N4C A;  1MDW A;  2FQ9 A;  1AU2 A;  4YYR A;  5A24 A;  1YK8 A;  3ERV A;  1ITO A;  1CV8 A;  3RVV A;  1SP4 B;  3HHA A;  4YV8 A;  1F29 A;  1A6R A;  3PDF A;  3PW3 A;  3P5U A;  4PP2 E;  3BWK A;  3H8C A;  4XUI A;  4QRV A;  1CJL A;  1MHW A;  2XU1 A;  1QMY A;  4FJC A;  2AUZ A;  3E1Z B;  5CHV A;  2PBH A;  4QRG A;  1HUC B;  3OF8 A;  3LXS A;  2R6N A;  2E00 A;  1PAD A;  1EWP A;  3IHP A;  4BQV A;  2R9N A;  4DMX A;  2G6D A;  1KFX L;  4BSQ A;  1MIR A;  1GMY A;  3GCB A;  3S3Q A;  5CVM A;  4CDE B;  4N79 A;  3I06 A;  1JQP A;  2OP3 A;  1U5I A;  4CDC B;  1Y4H A;  3OVZ A;  1U9W A;  2E02 A;  1AEC A;  5F02 A;  3BC3 A;  2DCC A;  2DCA A;  3KSE A;  2WBF X;  2XU4 A;  5EF4 A;  2GFO A;  2DC8 A;  3KWZ A;  4RY2 A;  3BCN A;  1X9Y A;  3H6S A;  1TL9 A;  1PXV A;  3MTN A;  3CBJ A;  1O0E A;  4BPV A;  4BS5 A;  1THE A; 
#chains in the Genus database with same CATH topology
 1U9V A;  2FT2 A;  3RVW A;  2CIO A;  4FK5 A;  3KX1 A;  3K24 A;  3B21 A;  3PRP A;  1M6D A;  4HWY A;  4G54 A;  3W30 A;  4ZUX U;  1GLO A;  1MEG A;  2PRE A;  3IMA A;  8PCH A;  1YZB A;  4BOZ A;  3BBA A;  2NQI A;  4YYV A;  2OUL A;  3S3R A;  1Q6K A;  2DZZ A;  4N8W A;  2P86 A;  1F2B A;  1QOL A;  3C9E A;  1KHP A;  2J7Q C;  1KXR A;  2H7J A;  1CVZ A;  2HH5 A;  1AU0 A;  3USV A;  3PRM A;  2VHS A;  3B79 A;  5FPW A;  2E01 A;  4WUR A;  3TNX A;  2HXZ A;  2JQG R;  2FRA A;  2OZ2 A;  1DF0 A;  4QH6 A;  3IV2 A;  1AYW A;  3HHI A;  4KLB A;  1QDQ A;  4CDD B;  2Y5B A;  4OVZ B;  3U8E A;  4Q8G A;  3PBH A;  1CTE A;  2AYN A;  1MS6 A;  1XKG A;  3KW9 A;  1AIM A;  3TMP A;  4W5B A;  3PHX A;  9PAP A;  2DC7 A;  5JZE A;  4YYU A;  4OEL A;  2YJC A;  3KFQ A;  4YYS A;  4HXD B;  1F2C A;  3PNR A;  2FO5 A;  2ACT A;  2AVW A;  3MTV A;  4I05 A;  4X6I A;  2F1G A;  4AXL A;  4CZW A;  4AXM A;  2E03 A;  2G8J A;  4DMY A;  1ME4 A;  2DCD A;  1PPD A;  1TLO A;  3IEJ A;  2BTW A;  1STF E;  2IBI A;  4X6H A;  2G7Y A;  4Q8H A;  3H7D A;  2FYE A;  2AGA A;  5K16 A;  3BY4 A;  4PT5 A;  3MOR A;  1F2A A;  2XU5 A;  3WXF A;  4D8I A;  1KFU L;  1FH0 A;  3OIS A;  4QBB A;  1PPP A;  4K7C A;  2DJG B;  3BB7 A;  2GHU A;  2Y6E A;  3N3G A;  3K8U A;  4XR7 A;  2AIM A;  1PCI A;  2ARY A;  4YYW A;  3I3T A;  4MZO A;  1AYV A;  1BP4 A;  3IFU A;  1VSN A;  2PAD A;  1U9X A;  4YYQ A;  1U9Q X;  2BTW B;  5CVN B;  4I07 A;  1NPZ A;  4D8E A;  1Y08 A;  4P16 A;  1YVB A;  1ICF A;  1AYU A;  3NHE A;  4CDF B;  1MEM A;  1AU4 A;  2BDZ A;  1BY8 A;  2HWK A;  3OVX A;  3P5V A;  5EZQ A;  5J94 A;  4W4U A;  2F7D A;  1CSB B;  3QT4 A;  3PT2 A;  3IOQ A;  5CVO B;  2NQD B;  5EZS A;  2PNS A;  3ZNH A;  4PI3 A;  2AS8 A;  3OF9 A;  3CH3 X;  5EGW A;  1EWL A;  1ME3 A;  2Z84 A;  3H89 A;  3QJ3 A;  4N4Z A;  5JA7 A;  2HD5 A;  4MSX A;  3O1G A;  1SNK A;  4BOU A;  1YK7 A;  1S4V A;  3BPM A;  1GEC E;  4FIP A;  3ZUA A;  2NQG A;  4I04 A;  4OVZ A;  7PCK A;  1DEU A;  4PP1 A;  2DZY A;  2JQF R;  3QSD A;  2FUD A;  1TU6 A;  3H8B A;  2BDL A;  5JH3 A;  3N3K A;  4OEM A;  1NLJ A;  1CS8 A;  3AI8 A;  3CBK A;  3D6S A;  1ZCM A;  4BOS A;  4BS6 A;  1YAL A;  1PIP A;  1K3B B;  4MI7 A;  2XU3 A;  3MHH A;  3KKU A;  1CPJ A;  4QRX A;  2YJ2 A;  1PVJ A;  3HWN A;  2G8E A;  1ATK A;  3O0U A;  3PHW A;  3V6E A;  2DJF B;  4R3D A;  4OW0 A;  5PAD A;  2DC6 A;  4X6J A;  1VJV A;  2YJ8 A;  1THE A;  1BGO A;  1KHQ A;  4P6G A;  1NB5 A;  2AU1 A;  2FTD A;  2FRQ A;  2VHF A;  2ATO A;  3WXE A;  2DC9 A;  4M0W A;  3MHS A;  3P5W A;  1EF7 A;  2R9M A;  1YT7 A;  1CQD A;  2NQA A;  4PAD A;  2P0R A;  3F5V A;  3HD3 A;  3IUT A;  1CB5 A;  2AUX A;  2AYO A;  3RNV A;  1NL6 A;  1IWD A;  3WXG A;  4BOP A;  1UKF A;  2R9F A;  3KWB X;  3F75 A;  2JTC A;  2P7U A;  4MZS A;  3CH2 X;  2CB5 A;  3DF0 A;  3BPF A;  2IPP B;  1AU3 A;  4YVA A;  1NQC A;  4W5C A;  3K9M A;  2J7Q A;  2DCB A;  4P6E A;  3P5X A;  2R9C A;  4REZ A;  1EWO A;  2B1M A;  2C0Y A;  3PSE A;  1POP A;  3BOW A;  1BQI A;  2O6X A;  1GCB A;  1ZIV A;  3TRK A;  1PPN A;  4WA6 A;  1PPO A;  1NB3 A;  2B1N A;  1EWM A;  1QXP A;  3RVX A;  4D8B A;  1DKI A;  1PE6 A;  2YJB A;  1PBH A;  3M99 A;  4A5U A;  6PAD A;  2HHN A;  2R9O A;  3LFY A;  2DOS A;  2YJ9 A;  3V6C A;  5CHT A;  3N4C A;  3PHU A;  1MDW A;  2FQ9 A;  1AU2 A;  4YYR A;  5A24 A;  1YK8 A;  3ERV A;  1ITO A;  1CV8 A;  3RVV A;  3O65 A;  1SP4 B;  4BOQ A;  2FE8 A;  3HHA A;  4YV8 A;  3C0R A;  4MM3 B;  4IP3 A;  1F29 A;  1A6R A;  3PDF A;  3PW3 A;  3P5U A;  4PP2 E;  3BWK A;  3H8C A;  4XUI A;  5E6J A;  4QRV A;  1CJL A;  1MHW A;  3W31 A;  2XU1 A;  1QMY A;  4FJC A;  2AUZ A;  3E1Z B;  5CHV A;  2PBH A;  4QRG A;  1HUC B;  4IUM A;  3OF8 A;  3LXS A;  2R6N A;  2E00 A;  1PAD A;  1EWP A;  3IHP A;  4BQV A;  4RKX A;  2R9N A;  4DMX A;  2G6D A;  4RNA A;  1KFX L;  4BSQ A;  1MIR A;  1GMY A;  3E9S A;  3GCB A;  3S3Q A;  5CVM A;  4CDE B;  4N79 A;  3I06 A;  1JQP A;  2OP3 A;  4RF0 A;  1U5I A;  4CDC B;  4GUA A;  1Y4H A;  3OVZ A;  1U9W A;  2E02 A;  1AEC A;  2JRI A;  4RF1 A;  3MJ5 A;  5F02 A;  3BC3 A;  3MP2 A;  2UZJ A;  2DCC A;  2DCA A;  3KSE A;  2WBF X;  2BU3 A;  2XU4 A;  2GFO A;  5EF4 A;  2DC8 A;  3KWZ A;  4ZTB A;  4RY2 A;  3BCN A;  1X9Y A;  3H6S A;  1TL9 A;  4XZX A;  1PXV A;  3MTN A;  3CBJ A;  1O0E A;  4BPV A;  4BS5 A;  3OQC A;  5KO3 A; 
#chains in the Genus database with same CATH homology
 1U9V A;  2FT2 A;  3RVW A;  2CIO A;  4FK5 A;  3KX1 A;  3K24 A;  1M6D A;  4HWY A;  4G54 A;  4ZUX U;  1GLO A;  1MEG A;  2PRE A;  3IMA A;  8PCH A;  2NQI A;  4YYV A;  2OUL A;  3S3R A;  1Q6K A;  2DZZ A;  4N8W A;  2P86 A;  1F2B A;  1QOL A;  1E2T A;  3C9E A;  1KHP A;  1KXR A;  2H7J A;  1CVZ A;  2HH5 A;  1AU0 A;  3USV A;  2VHS A;  3B79 A;  5FPW A;  2E01 A;  3TNX A;  2HXZ A;  2JQG R;  2FRA A;  2OZ2 A;  1DF0 A;  4QH6 A;  3IV2 A;  1AYW A;  4BGF A;  3HHI A;  4KLB A;  1QDQ A;  4CDD B;  2Y5B A;  3U8E A;  4Q8G A;  3PBH A;  1CTE A;  2AYN A;  1MS6 A;  1XKG A;  3KW9 A;  1AIM A;  4W5B A;  9PAP A;  2DC7 A;  4YYU A;  4OEL A;  2YJC A;  3KFQ A;  4YYS A;  1F2C A;  3PNR A;  2FO5 A;  2ACT A;  2AVW A;  2VFB A;  1W5R A;  4I05 A;  4X6I A;  2F1G A;  4AXL A;  4CZW A;  4AXM A;  2E03 A;  2G8J A;  4DMY A;  1ME4 A;  2DCD A;  1PPD A;  1TLO A;  4B55 A;  3IEJ A;  1STF E;  2IBI A;  4X6H A;  2G7Y A;  4Q8H A;  3H7D A;  2FYE A;  5K16 A;  3MOR A;  1F2A A;  2XU5 A;  3WXF A;  1KFU L;  1FH0 A;  3OIS A;  4QBB A;  1PPP A;  4K7C A;  2DJG B;  2GHU A;  2Y6E A;  3N3G A;  3K8U A;  4XR7 A;  2AIM A;  1PCI A;  2ARY A;  4YYW A;  3I3T A;  4MZO A;  1AYV A;  3LTW A;  1BP4 A;  1VSN A;  2PAD A;  1U9X A;  4YYQ A;  1U9Q X;  5CVN B;  4I07 A;  1NPZ A;  1W6F A;  1Y08 A;  1YVB A;  1ICF A;  1AYU A;  3NHE A;  4CDF B;  1MEM A;  1AU4 A;  2BDZ A;  1BY8 A;  3OVX A;  3P5V A;  5J94 A;  4W4U A;  2F7D A;  1CSB B;  3QT4 A;  3IOQ A;  5CVO B;  2NQD B;  2PNS A;  4PI3 A;  2AS8 A;  3OF9 A;  3CH3 X;  5EGW A;  1EWL A;  1ME3 A;  3H89 A;  3QJ3 A;  4N4Z A;  5JA7 A;  2HD5 A;  4MSX A;  3O1G A;  1SNK A;  1YK7 A;  1S4V A;  3BPM A;  1GEC E;  4FIP A;  3ZUA A;  2NQG A;  4I04 A;  7PCK A;  1DEU A;  4PP1 A;  2DZY A;  2JQF R;  3QSD A;  2FUD A;  1TU6 A;  3H8B A;  2BDL A;  5JH3 A;  3N3K A;  4OEM A;  1NLJ A;  1CS8 A;  3AI8 A;  3CBK A;  3D6S A;  1ZCM A;  2BSZ A;  4BS6 A;  1YAL A;  1PIP A;  1K3B B;  2XU3 A;  3MHH A;  3KKU A;  1CPJ A;  4QRX A;  2YJ2 A;  3HWN A;  3O0U A;  2G8E A;  1ATK A;  4NV8 A;  3V6E A;  2DJF B;  5PAD A;  2DC6 A;  4X6J A;  1VJV A;  2YJ8 A;  1BGO A;  1KHQ A;  4P6G A;  1NB5 A;  2AU1 A;  2FTD A;  2FRQ A;  2VHF A;  2ATO A;  3WXE A;  2DC9 A;  3MHS A;  3P5W A;  1EF7 A;  2R9M A;  1YT7 A;  1CQD A;  2NQA A;  4PAD A;  2P0R A;  3F5V A;  3HD3 A;  3IUT A;  1CB5 A;  2AUX A;  2AYO A;  1NL6 A;  1IWD A;  3WXG A;  2R9F A;  3KWB X;  3F75 A;  2P7U A;  4MZS A;  3CH2 X;  2CB5 A;  3DF0 A;  3BPF A;  2IPP B;  3D9W A;  1AU3 A;  4YVA A;  1NQC A;  4W5C A;  3K9M A;  1W4T A;  2DCB A;  4P6E A;  3P5X A;  2R9C A;  1EWO A;  2B1M A;  2C0Y A;  1POP A;  3BOW A;  1BQI A;  2O6X A;  1GCB A;  1ZIV A;  1PPN A;  4WA6 A;  1PPO A;  1NB3 A;  2B1N A;  1EWM A;  2VFC A;  1QXP A;  3RVX A;  1PE6 A;  2YJB A;  1PBH A;  3M99 A;  4NV7 A;  6PAD A;  2HHN A;  2R9O A;  3LFY A;  2YJ9 A;  3V6C A;  5CHT A;  3N4C A;  1MDW A;  2FQ9 A;  1AU2 A;  4YYR A;  5A24 A;  1YK8 A;  3ERV A;  1ITO A;  1CV8 A;  3RVV A;  1SP4 B;  3HHA A;  4YV8 A;  1F29 A;  1A6R A;  3PDF A;  3PW3 A;  3P5U A;  4PP2 E;  3BWK A;  3H8C A;  4XUI A;  4QRV A;  1CJL A;  1MHW A;  2XU1 A;  1QMY A;  4FJC A;  2AUZ A;  3E1Z B;  5CHV A;  2PBH A;  4QRG A;  1HUC B;  3OF8 A;  3LXS A;  2R6N A;  2E00 A;  1PAD A;  1EWP A;  3IHP A;  4BQV A;  2R9N A;  4DMX A;  2G6D A;  1KFX L;  4BSQ A;  1MIR A;  1GMY A;  3GCB A;  3S3Q A;  5CVM A;  4CDE B;  4N79 A;  3I06 A;  1GX3 A;  1JQP A;  2OP3 A;  1U5I A;  4CDC B;  1Y4H A;  3OVZ A;  1U9W A;  2E02 A;  1AEC A;  4GUZ A;  5F02 A;  3BC3 A;  2DCC A;  2DCA A;  3KSE A;  2WBF X;  2XU4 A;  5EF4 A;  2GFO A;  2DC8 A;  3KWZ A;  4RY2 A;  3BCN A;  4C5P A;  1X9Y A;  3H6S A;  1TL9 A;  1PXV A;  3MTN A;  3CBJ A;  1O0E A;  4BPV A;  4BS5 A;  1THE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...