1QMYA

Fmdv leader protease (lbshort-c51a-c133s)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
156
structure length
156
Chain Sequence
MELTLYNGEKKTFYSRPNNHDNAWLNAILQLFRYVEEPFFDWVYSSPENLTLEAIKQLEDLTGLELHEGGPPALVIWNIKHLLHTGIGTASRPSEVCVVDGTDMSLADFHAGIFLKGQEHAVFACVTSNGWYAIDDEDFYPWTPDPSDVLVFVPYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Biochemical Features Distinguish the Foot-and-Mouth Disease Virus Leader Proteinase from Other Papain-Like Enzymes
pubmed doi rcsb
source organism Aphthovirus o
molecule tags Hydrolase
molecule keywords PROTEASE
total genus 40
structure length 156
sequence length 156
chains with identical sequence B, C
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1999-10-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1qmyA00
2GFOA 2R9MA 1NB5A 1STFE 1YALA 1TU6A 3DF0A 2AUZA 4AXLA 3QJ3A 1EWLA 1S4VA 1BY8A 2R6NA 3OF9A 2FTDA 3B79A 2R9FA 3F5VA 3KW9A 2DJGB 1PCIA 2HH5A 2AYNA 2FQ9A 1PBHA 2Y6EA 1AECA 3S3QA 5CVNB 1CPJA 1BQIA 1PPDA 4N4ZA 5FPWA 4WA6A 3BCNA 3RVXA 3V6CA 2E00A 2PREA 4CZWA 3IUTA 2CIOA 3BWKA 1QMYA 4BS5A 1EWMA 2NQGA 1CTEA 3OVXA 4P6GA 3RVWA 5J94A 2DC9A 4G54A 3CBJA 4HWYA 4N79A 2AUXA 1GLOA 4QBBA 3H6SA 1DF0A 4W5CA 3CH3X 1BGOA 3D6SA 2AU1A 3ERVA 2OZ2A 2XU3A 4PADA 3P5WA 4Q8GA 4FIPA 1SP4B 1CV8A 4X6HA 4W4UA 2ARYA 1GMYA 3P5UA 3N3GA 4AXMA 1EF7A 1KHPA 3PDFA 4I05A 1YVBA 2R9OA 2R9CA 4OEMA 1KHQA 2G8EA 1PXVA 2DC6A 3WXFA 4K7CA 1PIPA 3M99A 2YJBA 2DJFB 2PNSA 5CHVA 1MS6A 1ITOA 3IMAA 3LXSA 3K8UA 1CVZA 3BPMA 3U8EA 1AU2A 2B1MA 2P7UA 1AU3A 4KLBA 2DZZA 2ATOA 1MEGA 2NQDB 2PBHA 2DC7A 3KKUA 4BPVA 1TLOA 4YVAA 1HUCB 1F29A 2XU4A 4PP1A 3KWBX 3I3TA 4MZSA 2HD5A 3IV2A 2H7JA 4P6EA 3NHEA 1XKGA 1ZCMA 1IWDA 1YT7A 1PADA 2G7YA 2JQFR 2DCBA 1Q6KA 4QRGA 5K16A 3BPFA 2G8JA 2C0YA 6PADA 3C9EA 4I04A 4YV8A 2FUDA 2PADA 2WBFX 2XU5A 1ATKA 1MDWA 1X9YA 1MIRA 3BOWA 5CHTA 3IOQA 1U9WA 1Y08A 1A6RA 1DEUA 2AS8A 2YJ2A 1VJVA 3KFQA 5PADA 4YYVA 3BC3A 3HWNA 1CSBB 3KWZA 1F2AA 4DMXA 1AYWA 1O0EA 2YJ9A 1NPZA 1POPA 3ZUAA 4XR7A 4ZUXU 7PCKA 3CH2X 2AIMA 3H89A 3RVVA 4YYQA 2E01A 1TL9A 1AYVA 4BSQA 2BDZA 3WXGA 1NL6A 2YJCA 2HHNA 1YK7A 1VSNA 1AU0A 3KX1A 2VHSA 2O6XA 1JQPA 4CDCB 4W5BA 4YYSA 4PP2E 5A24A 1ME3A 2HXZA 3MTNA 5F02A 2BDLA 2XU1A 3P5VA 3WXEA 3N3KA 1ME4A 2R9NA 3HHAA 3H7DA 3TNXA 3USVA 1AU4A 1QDQA 4FJCA 4RY2A 3K9MA 4YYUA 4X6IA 3PW3A 3GCBA 2JQGR 4XUIA 5EGWA 1U9XA 4CDEB 1EWPA 1ICFA 1AIMA 3H8BA 3P5XA 2B1NA 1AYUA 4YYRA 5JA7A 3HD3A 1BP4A 3KSEA 2AYOA 9PAPA 4FK5A 2FYEA 1F2CA 3E1ZB 4CDFB 1GECE 2Y5BA 1GCBA 3OISA 1PPNA 1U5IA 3O0UA 2FRAA 1MHWA 3QT4A 3MHSA 1CS8A 1QOLA 1NQCA 2E03A 4Q8HA 4YYWA 2DCAA 2F1GA 1ZIVA 1YK8A 1CJLA 3AI8A 3K24A 3S3RA 3LFYA 1CB5A 2IBIA 3IHPA 5CVMA 2OULA 3CBKA 4OELA 3O1GA 4BS6A 1KFUL 1KXRA 3F75A 2G6DA 1K3BB 2CB5A 2IPPB 3IEJA 3N4CA 5CVOB 4PI3A 4DMYA 2DCDA 2P0RA 2YJ8A 1U9VA 4QH6A 3OF8A 3H8CA 1PPPA 5EF4A 2OP3A 2AVWA 2NQIA 5JH3A 2E02A 3HHIA 4QRXA 4X6JA 3MHHA 2DC8A 1MEMA 4MZOA 4BQVA 1PE6A 3MORA 2DCCA 3OVZA 4CDDB 2NQAA 2FRQA 1NB3A 8PCHA 4MSXA 2GHUA 1THEA 4QRVA 3V6EA 1M6DA 1F2BA 2VHFA 1PPOA 3PBHA 1EWOA 1NLJA 1KFXL 3PNRA 1CQDA 3I06A 4I07A 2DZYA 1FH0A 1SNKA 2F7DA 2P86A 3QSDA 1Y4HA 4N8WA 1QXPA 2FT2A 1U9QX 2FO5A 2ACTA
chains in the Genus database with same CATH superfamily
2GFOA 2R9MA 1NB5A 1STFE 4D8EA 1YALA 1TU6A 3DF0A 2AUZA 4AXLA 3QJ3A 1EWLA 1S4VA 1BY8A 2R6NA 3OF9A 2FTDA 4A5UA 3B79A 2R9FA 3F5VA 4RF0A 3KW9A 2DJGB 1PCIA 4ZTBA 2HH5A 2AYNA 2FQ9A 1PBHA 2Y6EA 1AECA 3S3QA 5CVNB 1CPJA 1BQIA 3C0RA 1PPDA 4N4ZA 5FPWA 3ZNHA 4WA6A 3BCNA 3RVXA 3V6CA 2E00A 3PRPA 2PREA 4CZWA 3IUTA 2CIOA 3BWKA 1QMYA 4BS5A 1EWMA 2NQGA 1CTEA 3OVXA 3MP2A 4P6GA 3RVWA 3W31A 5J94A 2DC9A 4G54A 3CBJA 4HWYA 4N79A 4RF1A 2AUXA 1GLOA 4QBBA 3H6SA 1DF0A 4W5CA 3CH3X 1BGOA 3D6SA 2AU1A 3ERVA 4BOUA 2OZ2A 2XU3A 4PADA 3P5WA 4Q8GA 4FIPA 1DKIA 1SP4B 4R3DA 1CV8A 5E6JA 4X6HA 4W4UA 2ARYA 1GMYA 3P5UA 4OVZA 3N3GA 4AXMA 1EF7A 1KHPA 3PDFA 4I05A 1YVBA 2R9OA 2R9CA 4OEMA 1KHQA 2G8EA 1PXVA 2DC6A 3WXFA 4K7CA 1PIPA 4OVZB 1PVJA 3M99A 3BB7A 2YJBA 2DJFB 2PNSA 4P16A 5CHVA 1MS6A 3BBAA 3E9SA 1ITOA 3IMAA 3LXSA 3K8UA 1CVZA 4GUAA 3BPMA 3U8EA 2BU3A 1AU2A 2B1MA 2P7UA 1AU3A 4KLBA 3O65A 2DZZA 2ATOA 1MEGA 2NQDB 4D8IA 2PBHA 2DC7A 3KKUA 4BPVA 1TLOA 4YVAA 1HUCB 1F29A 2XU4A 4PP1A 3KWBX 3I3TA 4MZSA 2HD5A 3IV2A 2H7JA 4P6EA 3NHEA 1XKGA 1ZCMA 1IWDA 1YT7A 1PADA 2G7YA 2JQFR 3RNVA 2DCBA 1Q6KA 4QRGA 5K16A 3BPFA 2G8JA 2C0YA 6PADA 3C9EA 4I04A 4YV8A 2FUDA 2PADA 2WBFX 3PHXA 2XU5A 1ATKA 1MDWA 1X9YA 1MIRA 3BOWA 4IUMA 5CHTA 3IOQA 1U9WA 1Y08A 1A6RA 1DEUA 2AS8A 2YJ2A 2DOSA 4WURA 1VJVA 3KFQA 5PADA 4YYVA 3BC3A 3HWNA 1CSBB 3KWZA 1F2AA 4DMXA 1AYWA 1O0EA 2YJ9A 1NPZA 1POPA 3ZUAA 4XR7A 3MJ5A 4ZUXU 7PCKA 3CH2X 2AIMA 3H89A 3RVVA 4YYQA 2E01A 1TL9A 1AYVA 4BSQA 2BDZA 4IP3A 3WXGA 1NL6A 2YJCA 3B21A 2HHNA 2Z84A 1YK7A 1VSNA 1AU0A 3KX1A 4PT5A 2JRIA 1YZBA 2VHSA 5KO3A 2O6XA 1JQPA 4CDCB 4W5BA 4BOZA 4YYSA 4PP2E 5A24A 1ME3A 2HXZA 3MTNA 5F02A 2BDLA 2XU1A 3P5VA 2BTWB 3PRMA 3WXEA 3N3KA 2BTWA 1ME4A 2R9NA 3HHAA 3H7DA 3OQCA 3TNXA 3USVA 1AU4A 1QDQA 4RNAA 3MTVA 3TRKA 4FJCA 4RY2A 3K9MA 4YYUA 4X6IA 3PW3A 3GCBA 2JQGR 4XUIA 5EGWA 1U9XA 4CDEB 1EWPA 1ICFA 1AIMA 3H8BA 3P5XA 2JTCA 2B1NA 1AYUA 4YYRA 3BY4A 5JA7A 2UZJA 3HD3A 1BP4A 3KSEA 3PT2A 2AYOA 9PAPA 4FK5A 2FYEA 1F2CA 3E1ZB 3PSEA 4MI7A 4CDFB 1GECE 3PHUA 2Y5BA 1GCBA 3OISA 1PPNA 1U5IA 3O0UA 2FRAA 1UKFA 4D8BA 1MHWA 3QT4A 3MHSA 2J7QC 1CS8A 1QOLA 1NQCA 4M0WA 2E03A 4Q8HA 4YYWA 2DCAA 2F1GA 1ZIVA 1YK8A 2J7QA 1CJLA 3AI8A 3K24A 3S3RA 3PHWA 3LFYA 1CB5A 2IBIA 3IHPA 5CVMA 2OULA 4BOSA 3CBKA 4OELA 4OW0A 3O1GA 4XZXA 4BS6A 1KFUL 1KXRA 3F75A 2G6DA 1K3BB 2CB5A 2IPPB 3IEJA 5EZSA 3N4CA 5CVOB 4PI3A 4DMYA 2DCDA 2P0RA 2YJ8A 1U9VA 4QH6A 3OF8A 3H8CA 1PPPA 5EF4A 2OP3A 2FE8A 2AVWA 2NQIA 5JH3A 4MM3B 2E02A 3HHIA 4QRXA 4X6JA 4BOQA 3MHHA 2DC8A 1MEMA 4MZOA 4BQVA 1PE6A 4RKXA 3MORA 2DCCA 3OVZA 5JZEA 4CDDB 4REZA 2NQAA 2FRQA 1NB3A 8PCHA 4MSXA 2GHUA 1THEA 4QRVA 3V6EA 1M6DA 3W30A 4BOPA 1F2BA 2VHFA 1PPOA 4HXDB 3IFUA 3PBHA 1EWOA 1NLJA 1KFXL 3PNRA 1CQDA 3I06A 4I07A 2DZYA 1FH0A 1SNKA 3TMPA 2F7DA 2HWKA 2P86A 3QSDA 1Y4HA 4N8WA 1QXPA 5EZQA 2AGAA 2FT2A 1U9QX 2FO5A 2ACTA
chains in the Genus database with same CATH topology
2GFOA 2R9MA 1NB5A 1STFE 1YALA 1TU6A 3DF0A 2AUZA 4B55A 4AXLA 3QJ3A 1EWLA 1S4VA 1BY8A 2R6NA 3OF9A 2FTDA 3B79A 2R9FA 3F5VA 3KW9A 2DJGB 1PCIA 2HH5A 2AYNA 2FQ9A 1PBHA 2Y6EA 1AECA 3S3QA 5CVNB 1CPJA 1BQIA 1PPDA 4N4ZA 5FPWA 4WA6A 3BCNA 3RVXA 3V6CA 2E00A 2PREA 4CZWA 3IUTA 2CIOA 3BWKA 1QMYA 4BS5A 1EWMA 2NQGA 1CTEA 3OVXA 4P6GA 3RVWA 5J94A 2DC9A 4G54A 3CBJA 4HWYA 4N79A 2AUXA 1GLOA 4QBBA 3H6SA 1DF0A 4W5CA 3CH3X 1BGOA 3D6SA 2AU1A 3ERVA 2OZ2A 2XU3A 4PADA 3P5WA 4Q8GA 4FIPA 1SP4B 1CV8A 4X6HA 4W4UA 2ARYA 1GMYA 3P5UA 3N3GA 4AXMA 1EF7A 1KHPA 3PDFA 4I05A 1YVBA 2R9OA 2R9CA 4OEMA 1KHQA 2G8EA 1PXVA 2DC6A 3WXFA 4K7CA 1PIPA 3M99A 2YJBA 2DJFB 2PNSA 5CHVA 1MS6A 1ITOA 3IMAA 3LXSA 3K8UA 1CVZA 2BSZA 3BPMA 3U8EA 3LTWA 1AU2A 2B1MA 2P7UA 1AU3A 4KLBA 2DZZA 2ATOA 1MEGA 2NQDB 2PBHA 2DC7A 3KKUA 4BPVA 1TLOA 4YVAA 1HUCB 1F29A 2XU4A 4PP1A 3KWBX 3I3TA 4MZSA 2HD5A 3IV2A 2H7JA 4P6EA 3NHEA 1XKGA 1ZCMA 1IWDA 1YT7A 1PADA 2G7YA 2JQFR 2DCBA 1Q6KA 4QRGA 5K16A 3BPFA 2G8JA 2C0YA 6PADA 3C9EA 4I04A 4YV8A 2FUDA 1E2TA 2PADA 2WBFX 2XU5A 1ATKA 1MDWA 1X9YA 1MIRA 3BOWA 5CHTA 3IOQA 1U9WA 1Y08A 1A6RA 1DEUA 2AS8A 2YJ2A 1VJVA 3KFQA 5PADA 4GUZA 4YYVA 3BC3A 3HWNA 1CSBB 3KWZA 1F2AA 4DMXA 1AYWA 1O0EA 2YJ9A 1NPZA 1POPA 3ZUAA 4XR7A 4ZUXU 7PCKA 3CH2X 2AIMA 3H89A 3RVVA 4YYQA 2E01A 1TL9A 1AYVA 4BSQA 2BDZA 4NV8A 3WXGA 1NL6A 1W4TA 2YJCA 2HHNA 1YK7A 1VSNA 1AU0A 3KX1A 2VHSA 1GX3A 2O6XA 1JQPA 4CDCB 4W5BA 1W5RA 4YYSA 4PP2E 5A24A 1ME3A 2HXZA 2VFCA 3MTNA 5F02A 2BDLA 2XU1A 3P5VA 3WXEA 3N3KA 1ME4A 2R9NA 3HHAA 3H7DA 3TNXA 3USVA 1AU4A 1QDQA 4FJCA 4RY2A 3K9MA 4YYUA 4X6IA 3PW3A 3GCBA 2JQGR 4XUIA 5EGWA 1U9XA 4CDEB 1EWPA 1ICFA 1AIMA 3H8BA 3P5XA 2B1NA 1AYUA 4YYRA 5JA7A 3HD3A 1BP4A 3KSEA 2AYOA 9PAPA 4FK5A 2FYEA 1F2CA 3E1ZB 4CDFB 1GECE 2Y5BA 1GCBA 3OISA 1PPNA 1U5IA 4BGFA 3O0UA 2FRAA 1MHWA 3QT4A 3MHSA 1CS8A 1QOLA 1NQCA 2E03A 4Q8HA 4YYWA 2DCAA 2F1GA 1ZIVA 1YK8A 1CJLA 3AI8A 3K24A 3S3RA 3LFYA 1CB5A 2IBIA 3IHPA 5CVMA 2OULA 3CBKA 4OELA 3O1GA 4BS6A 1KFUL 1KXRA 3F75A 2G6DA 1K3BB 2CB5A 2IPPB 3IEJA 3N4CA 5CVOB 4PI3A 4DMYA 2DCDA 2P0RA 2YJ8A 2VFBA 1U9VA 4QH6A 3OF8A 3H8CA 1PPPA 5EF4A 2OP3A 4NV7A 2AVWA 2NQIA 5JH3A 2E02A 3HHIA 4QRXA 4X6JA 3D9WA 4C5PA 3MHHA 2DC8A 1MEMA 4MZOA 4BQVA 1PE6A 3MORA 2DCCA 3OVZA 4CDDB 1W6FA 2NQAA 2FRQA 1NB3A 8PCHA 4MSXA 2GHUA 1THEA 4QRVA 3V6EA 1M6DA 1F2BA 2VHFA 1PPOA 3PBHA 1EWOA 1NLJA 1KFXL 3PNRA 1CQDA 3I06A 4I07A 2DZYA 1FH0A 1SNKA 2F7DA 2P86A 3QSDA 1Y4HA 4N8WA 1QXPA 2FT2A 1U9QX 2FO5A 2ACTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GFO A;  2R9M A;  1NB5 A;  1STF E;  1YAL A;  1TU6 A;  3DF0 A;  2AUZ A;  4AXL A;  3QJ3 A;  1EWL A;  1S4V A;  1BY8 A;  2R6N A;  3OF9 A;  2FTD A;  3B79 A;  2R9F A;  3F5V A;  3KW9 A;  2DJG B;  1PCI A;  2HH5 A;  2AYN A;  2FQ9 A;  1PBH A;  2Y6E A;  1AEC A;  3S3Q A;  5CVN B;  1CPJ A;  1BQI A;  1PPD A;  4N4Z A;  5FPW A;  4WA6 A;  3BCN A;  3RVX A;  3V6C A;  2E00 A;  2PRE A;  4CZW A;  3IUT A;  2CIO A;  3BWK A;  1QMY A;  4BS5 A;  1EWM A;  2NQG A;  1CTE A;  3OVX A;  4P6G A;  3RVW A;  5J94 A;  2DC9 A;  4G54 A;  3CBJ A;  4HWY A;  4N79 A;  2AUX A;  1GLO A;  4QBB A;  3H6S A;  1DF0 A;  4W5C A;  3CH3 X;  1BGO A;  3D6S A;  2AU1 A;  3ERV A;  2OZ2 A;  2XU3 A;  4PAD A;  3P5W A;  4Q8G A;  4FIP A;  1SP4 B;  1CV8 A;  4X6H A;  4W4U A;  2ARY A;  1GMY A;  3P5U A;  3N3G A;  4AXM A;  1EF7 A;  1KHP A;  3PDF A;  4I05 A;  1YVB A;  2R9O A;  2R9C A;  4OEM A;  1KHQ A;  2G8E A;  1PXV A;  2DC6 A;  3WXF A;  4K7C A;  1PIP A;  3M99 A;  2YJB A;  2DJF B;  2PNS A;  5CHV A;  1MS6 A;  1ITO A;  3IMA A;  3LXS A;  3K8U A;  1CVZ A;  3BPM A;  3U8E A;  1AU2 A;  2B1M A;  2P7U A;  1AU3 A;  4KLB A;  2DZZ A;  2ATO A;  1MEG A;  2NQD B;  2PBH A;  2DC7 A;  3KKU A;  4BPV A;  1TLO A;  4YVA A;  1HUC B;  1F29 A;  2XU4 A;  4PP1 A;  3KWB X;  3I3T A;  4MZS A;  2HD5 A;  3IV2 A;  2H7J A;  4P6E A;  3NHE A;  1XKG A;  1ZCM A;  1IWD A;  1YT7 A;  1PAD A;  2G7Y A;  2JQF R;  2DCB A;  1Q6K A;  4QRG A;  5K16 A;  3BPF A;  2G8J A;  2C0Y A;  6PAD A;  3C9E A;  4I04 A;  4YV8 A;  2FUD A;  2PAD A;  2WBF X;  2XU5 A;  1ATK A;  1MDW A;  1X9Y A;  1MIR A;  3BOW A;  5CHT A;  3IOQ A;  1U9W A;  1Y08 A;  1A6R A;  1DEU A;  2AS8 A;  2YJ2 A;  1VJV A;  3KFQ A;  5PAD A;  4YYV A;  3BC3 A;  3HWN A;  1CSB B;  3KWZ A;  1F2A A;  4DMX A;  1AYW A;  1O0E A;  2YJ9 A;  1NPZ A;  1POP A;  3ZUA A;  4XR7 A;  4ZUX U;  7PCK A;  3CH2 X;  2AIM A;  3H89 A;  3RVV A;  4YYQ A;  2E01 A;  1TL9 A;  1AYV A;  4BSQ A;  2BDZ A;  3WXG A;  1NL6 A;  2YJC A;  2HHN A;  1YK7 A;  1VSN A;  1AU0 A;  3KX1 A;  2VHS A;  2O6X A;  1JQP A;  4CDC B;  4W5B A;  4YYS A;  4PP2 E;  5A24 A;  1ME3 A;  2HXZ A;  3MTN A;  5F02 A;  2BDL A;  2XU1 A;  3P5V A;  3WXE A;  3N3K A;  1ME4 A;  2R9N A;  3HHA A;  3H7D A;  3TNX A;  3USV A;  1AU4 A;  1QDQ A;  4FJC A;  4RY2 A;  3K9M A;  4YYU A;  4X6I A;  3PW3 A;  3GCB A;  2JQG R;  4XUI A;  5EGW A;  1U9X A;  4CDE B;  1EWP A;  1ICF A;  1AIM A;  3H8B A;  3P5X A;  2B1N A;  1AYU A;  4YYR A;  5JA7 A;  3HD3 A;  1BP4 A;  3KSE A;  2AYO A;  9PAP A;  4FK5 A;  2FYE A;  1F2C A;  3E1Z B;  4CDF B;  1GEC E;  2Y5B A;  1GCB A;  3OIS A;  1PPN A;  1U5I A;  3O0U A;  2FRA A;  1MHW A;  3QT4 A;  3MHS A;  1CS8 A;  1QOL A;  1NQC A;  2E03 A;  4Q8H A;  4YYW A;  2DCA A;  2F1G A;  1ZIV A;  1YK8 A;  1CJL A;  3AI8 A;  3K24 A;  3S3R A;  3LFY A;  1CB5 A;  2IBI A;  3IHP A;  5CVM A;  2OUL A;  3CBK A;  4OEL A;  3O1G A;  4BS6 A;  1KFU L;  1KXR A;  3F75 A;  2G6D A;  1K3B B;  2CB5 A;  2IPP B;  3IEJ A;  3N4C A;  5CVO B;  4PI3 A;  4DMY A;  2DCD A;  2P0R A;  2YJ8 A;  1U9V A;  4QH6 A;  3OF8 A;  3H8C A;  1PPP A;  5EF4 A;  2OP3 A;  2AVW A;  2NQI A;  5JH3 A;  2E02 A;  3HHI A;  4QRX A;  4X6J A;  3MHH A;  2DC8 A;  1MEM A;  4MZO A;  4BQV A;  1PE6 A;  3MOR A;  2DCC A;  3OVZ A;  4CDD B;  2NQA A;  2FRQ A;  1NB3 A;  8PCH A;  4MSX A;  2GHU A;  1THE A;  4QRV A;  3V6E A;  1M6D A;  1F2B A;  2VHF A;  1PPO A;  3PBH A;  1EWO A;  1NLJ A;  1KFX L;  3PNR A;  1CQD A;  3I06 A;  4I07 A;  2DZY A;  1FH0 A;  1SNK A;  2F7D A;  2P86 A;  3QSD A;  1Y4H A;  4N8W A;  1QXP A;  2FT2 A;  1U9Q X;  2FO5 A;  2ACT A; 
#chains in the Genus database with same CATH topology
 2GFO A;  2R9M A;  1NB5 A;  1STF E;  4D8E A;  1YAL A;  1TU6 A;  3DF0 A;  2AUZ A;  4AXL A;  3QJ3 A;  1EWL A;  1S4V A;  1BY8 A;  2R6N A;  3OF9 A;  2FTD A;  4A5U A;  3B79 A;  2R9F A;  3F5V A;  4RF0 A;  3KW9 A;  2DJG B;  1PCI A;  4ZTB A;  2HH5 A;  2AYN A;  2FQ9 A;  1PBH A;  2Y6E A;  1AEC A;  3S3Q A;  5CVN B;  1CPJ A;  1BQI A;  3C0R A;  1PPD A;  4N4Z A;  5FPW A;  3ZNH A;  4WA6 A;  3BCN A;  3RVX A;  3V6C A;  2E00 A;  3PRP A;  2PRE A;  4CZW A;  3IUT A;  2CIO A;  3BWK A;  1QMY A;  4BS5 A;  1EWM A;  2NQG A;  1CTE A;  3OVX A;  3MP2 A;  4P6G A;  3RVW A;  3W31 A;  5J94 A;  2DC9 A;  4G54 A;  3CBJ A;  4HWY A;  4N79 A;  4RF1 A;  2AUX A;  1GLO A;  4QBB A;  3H6S A;  1DF0 A;  4W5C A;  3CH3 X;  1BGO A;  3D6S A;  2AU1 A;  3ERV A;  4BOU A;  2OZ2 A;  2XU3 A;  4PAD A;  3P5W A;  4Q8G A;  4FIP A;  1DKI A;  1SP4 B;  4R3D A;  1CV8 A;  5E6J A;  4X6H A;  4W4U A;  2ARY A;  1GMY A;  3P5U A;  4OVZ A;  3N3G A;  4AXM A;  1EF7 A;  1KHP A;  3PDF A;  4I05 A;  1YVB A;  2R9O A;  2R9C A;  4OEM A;  1KHQ A;  2G8E A;  1PXV A;  2DC6 A;  3WXF A;  4K7C A;  1PIP A;  4OVZ B;  1PVJ A;  3M99 A;  3BB7 A;  2YJB A;  2DJF B;  2PNS A;  4P16 A;  5CHV A;  1MS6 A;  3BBA A;  3E9S A;  1ITO A;  3IMA A;  3LXS A;  3K8U A;  1CVZ A;  4GUA A;  3BPM A;  3U8E A;  2BU3 A;  1AU2 A;  2B1M A;  2P7U A;  1AU3 A;  4KLB A;  3O65 A;  2DZZ A;  2ATO A;  1MEG A;  2NQD B;  4D8I A;  2PBH A;  2DC7 A;  3KKU A;  4BPV A;  1TLO A;  4YVA A;  1HUC B;  1F29 A;  2XU4 A;  4PP1 A;  3KWB X;  3I3T A;  4MZS A;  2HD5 A;  3IV2 A;  2H7J A;  4P6E A;  3NHE A;  1XKG A;  1ZCM A;  1IWD A;  1YT7 A;  1PAD A;  2G7Y A;  2JQF R;  3RNV A;  2DCB A;  1Q6K A;  4QRG A;  5K16 A;  3BPF A;  2G8J A;  2C0Y A;  6PAD A;  3C9E A;  4I04 A;  4YV8 A;  2FUD A;  2PAD A;  2WBF X;  3PHX A;  2XU5 A;  1ATK A;  1MDW A;  1X9Y A;  1MIR A;  3BOW A;  4IUM A;  5CHT A;  3IOQ A;  1U9W A;  1Y08 A;  1A6R A;  1DEU A;  2AS8 A;  2YJ2 A;  2DOS A;  4WUR A;  1VJV A;  3KFQ A;  5PAD A;  4YYV A;  3BC3 A;  3HWN A;  1CSB B;  3KWZ A;  1F2A A;  4DMX A;  1AYW A;  1O0E A;  2YJ9 A;  1NPZ A;  1POP A;  3ZUA A;  4XR7 A;  3MJ5 A;  4ZUX U;  7PCK A;  3CH2 X;  2AIM A;  3H89 A;  3RVV A;  4YYQ A;  2E01 A;  1TL9 A;  1AYV A;  4BSQ A;  2BDZ A;  4IP3 A;  3WXG A;  1NL6 A;  2YJC A;  3B21 A;  2HHN A;  2Z84 A;  1YK7 A;  1VSN A;  1AU0 A;  3KX1 A;  4PT5 A;  2JRI A;  1YZB A;  2VHS A;  5KO3 A;  2O6X A;  1JQP A;  4CDC B;  4W5B A;  4BOZ A;  4YYS A;  4PP2 E;  5A24 A;  1ME3 A;  2HXZ A;  3MTN A;  5F02 A;  2BDL A;  2XU1 A;  3P5V A;  2BTW B;  3PRM A;  3WXE A;  3N3K A;  2BTW A;  1ME4 A;  2R9N A;  3HHA A;  3H7D A;  3OQC A;  3TNX A;  3USV A;  1AU4 A;  1QDQ A;  4RNA A;  3MTV A;  3TRK A;  4FJC A;  4RY2 A;  3K9M A;  4YYU A;  4X6I A;  3PW3 A;  3GCB A;  2JQG R;  4XUI A;  5EGW A;  1U9X A;  4CDE B;  1EWP A;  1ICF A;  1AIM A;  3H8B A;  3P5X A;  2JTC A;  2B1N A;  1AYU A;  4YYR A;  3BY4 A;  5JA7 A;  2UZJ A;  3HD3 A;  1BP4 A;  3KSE A;  3PT2 A;  2AYO A;  9PAP A;  4FK5 A;  2FYE A;  1F2C A;  3E1Z B;  3PSE A;  4MI7 A;  4CDF B;  1GEC E;  3PHU A;  2Y5B A;  1GCB A;  3OIS A;  1PPN A;  1U5I A;  3O0U A;  2FRA A;  1UKF A;  4D8B A;  1MHW A;  3QT4 A;  3MHS A;  2J7Q C;  1CS8 A;  1QOL A;  1NQC A;  4M0W A;  2E03 A;  4Q8H A;  4YYW A;  2DCA A;  2F1G A;  1ZIV A;  1YK8 A;  2J7Q A;  1CJL A;  3AI8 A;  3K24 A;  3S3R A;  3PHW A;  3LFY A;  1CB5 A;  2IBI A;  3IHP A;  5CVM A;  2OUL A;  4BOS A;  3CBK A;  4OEL A;  4OW0 A;  3O1G A;  4XZX A;  4BS6 A;  1KFU L;  1KXR A;  3F75 A;  2G6D A;  1K3B B;  2CB5 A;  2IPP B;  3IEJ A;  5EZS A;  3N4C A;  5CVO B;  4PI3 A;  4DMY A;  2DCD A;  2P0R A;  2YJ8 A;  1U9V A;  4QH6 A;  3OF8 A;  3H8C A;  1PPP A;  5EF4 A;  2OP3 A;  2FE8 A;  2AVW A;  2NQI A;  5JH3 A;  4MM3 B;  2E02 A;  3HHI A;  4QRX A;  4X6J A;  4BOQ A;  3MHH A;  2DC8 A;  1MEM A;  4MZO A;  4BQV A;  1PE6 A;  4RKX A;  3MOR A;  2DCC A;  3OVZ A;  5JZE A;  4CDD B;  4REZ A;  2NQA A;  2FRQ A;  1NB3 A;  8PCH A;  4MSX A;  2GHU A;  1THE A;  4QRV A;  3V6E A;  1M6D A;  3W30 A;  4BOP A;  1F2B A;  2VHF A;  1PPO A;  4HXD B;  3IFU A;  3PBH A;  1EWO A;  1NLJ A;  1KFX L;  3PNR A;  1CQD A;  3I06 A;  4I07 A;  2DZY A;  1FH0 A;  1SNK A;  3TMP A;  2F7D A;  2HWK A;  2P86 A;  3QSD A;  1Y4H A;  4N8W A;  1QXP A;  5EZQ A;  2AGA A;  2FT2 A;  1U9Q X;  2FO5 A;  2ACT A; 
#chains in the Genus database with same CATH homology
 2GFO A;  2R9M A;  1NB5 A;  1STF E;  1YAL A;  1TU6 A;  3DF0 A;  2AUZ A;  4B55 A;  4AXL A;  3QJ3 A;  1EWL A;  1S4V A;  1BY8 A;  2R6N A;  3OF9 A;  2FTD A;  3B79 A;  2R9F A;  3F5V A;  3KW9 A;  2DJG B;  1PCI A;  2HH5 A;  2AYN A;  2FQ9 A;  1PBH A;  2Y6E A;  1AEC A;  3S3Q A;  5CVN B;  1CPJ A;  1BQI A;  1PPD A;  4N4Z A;  5FPW A;  4WA6 A;  3BCN A;  3RVX A;  3V6C A;  2E00 A;  2PRE A;  4CZW A;  3IUT A;  2CIO A;  3BWK A;  1QMY A;  4BS5 A;  1EWM A;  2NQG A;  1CTE A;  3OVX A;  4P6G A;  3RVW A;  5J94 A;  2DC9 A;  4G54 A;  3CBJ A;  4HWY A;  4N79 A;  2AUX A;  1GLO A;  4QBB A;  3H6S A;  1DF0 A;  4W5C A;  3CH3 X;  1BGO A;  3D6S A;  2AU1 A;  3ERV A;  2OZ2 A;  2XU3 A;  4PAD A;  3P5W A;  4Q8G A;  4FIP A;  1SP4 B;  1CV8 A;  4X6H A;  4W4U A;  2ARY A;  1GMY A;  3P5U A;  3N3G A;  4AXM A;  1EF7 A;  1KHP A;  3PDF A;  4I05 A;  1YVB A;  2R9O A;  2R9C A;  4OEM A;  1KHQ A;  2G8E A;  1PXV A;  2DC6 A;  3WXF A;  4K7C A;  1PIP A;  3M99 A;  2YJB A;  2DJF B;  2PNS A;  5CHV A;  1MS6 A;  1ITO A;  3IMA A;  3LXS A;  3K8U A;  1CVZ A;  2BSZ A;  3BPM A;  3U8E A;  3LTW A;  1AU2 A;  2B1M A;  2P7U A;  1AU3 A;  4KLB A;  2DZZ A;  2ATO A;  1MEG A;  2NQD B;  2PBH A;  2DC7 A;  3KKU A;  4BPV A;  1TLO A;  4YVA A;  1HUC B;  1F29 A;  2XU4 A;  4PP1 A;  3KWB X;  3I3T A;  4MZS A;  2HD5 A;  3IV2 A;  2H7J A;  4P6E A;  3NHE A;  1XKG A;  1ZCM A;  1IWD A;  1YT7 A;  1PAD A;  2G7Y A;  2JQF R;  2DCB A;  1Q6K A;  4QRG A;  5K16 A;  3BPF A;  2G8J A;  2C0Y A;  6PAD A;  3C9E A;  4I04 A;  4YV8 A;  2FUD A;  1E2T A;  2PAD A;  2WBF X;  2XU5 A;  1ATK A;  1MDW A;  1X9Y A;  1MIR A;  3BOW A;  5CHT A;  3IOQ A;  1U9W A;  1Y08 A;  1A6R A;  1DEU A;  2AS8 A;  2YJ2 A;  1VJV A;  3KFQ A;  5PAD A;  4GUZ A;  4YYV A;  3BC3 A;  3HWN A;  1CSB B;  3KWZ A;  1F2A A;  4DMX A;  1AYW A;  1O0E A;  2YJ9 A;  1NPZ A;  1POP A;  3ZUA A;  4XR7 A;  4ZUX U;  7PCK A;  3CH2 X;  2AIM A;  3H89 A;  3RVV A;  4YYQ A;  2E01 A;  1TL9 A;  1AYV A;  4BSQ A;  2BDZ A;  4NV8 A;  3WXG A;  1NL6 A;  1W4T A;  2YJC A;  2HHN A;  1YK7 A;  1VSN A;  1AU0 A;  3KX1 A;  2VHS A;  1GX3 A;  2O6X A;  1JQP A;  4CDC B;  4W5B A;  1W5R A;  4YYS A;  4PP2 E;  5A24 A;  1ME3 A;  2HXZ A;  2VFC A;  3MTN A;  5F02 A;  2BDL A;  2XU1 A;  3P5V A;  3WXE A;  3N3K A;  1ME4 A;  2R9N A;  3HHA A;  3H7D A;  3TNX A;  3USV A;  1AU4 A;  1QDQ A;  4FJC A;  4RY2 A;  3K9M A;  4YYU A;  4X6I A;  3PW3 A;  3GCB A;  2JQG R;  4XUI A;  5EGW A;  1U9X A;  4CDE B;  1EWP A;  1ICF A;  1AIM A;  3H8B A;  3P5X A;  2B1N A;  1AYU A;  4YYR A;  5JA7 A;  3HD3 A;  1BP4 A;  3KSE A;  2AYO A;  9PAP A;  4FK5 A;  2FYE A;  1F2C A;  3E1Z B;  4CDF B;  1GEC E;  2Y5B A;  1GCB A;  3OIS A;  1PPN A;  1U5I A;  4BGF A;  3O0U A;  2FRA A;  1MHW A;  3QT4 A;  3MHS A;  1CS8 A;  1QOL A;  1NQC A;  2E03 A;  4Q8H A;  4YYW A;  2DCA A;  2F1G A;  1ZIV A;  1YK8 A;  1CJL A;  3AI8 A;  3K24 A;  3S3R A;  3LFY A;  1CB5 A;  2IBI A;  3IHP A;  5CVM A;  2OUL A;  3CBK A;  4OEL A;  3O1G A;  4BS6 A;  1KFU L;  1KXR A;  3F75 A;  2G6D A;  1K3B B;  2CB5 A;  2IPP B;  3IEJ A;  3N4C A;  5CVO B;  4PI3 A;  4DMY A;  2DCD A;  2P0R A;  2YJ8 A;  2VFB A;  1U9V A;  4QH6 A;  3OF8 A;  3H8C A;  1PPP A;  5EF4 A;  2OP3 A;  4NV7 A;  2AVW A;  2NQI A;  5JH3 A;  2E02 A;  3HHI A;  4QRX A;  4X6J A;  3D9W A;  4C5P A;  3MHH A;  2DC8 A;  1MEM A;  4MZO A;  4BQV A;  1PE6 A;  3MOR A;  2DCC A;  3OVZ A;  4CDD B;  1W6F A;  2NQA A;  2FRQ A;  1NB3 A;  8PCH A;  4MSX A;  2GHU A;  1THE A;  4QRV A;  3V6E A;  1M6D A;  1F2B A;  2VHF A;  1PPO A;  3PBH A;  1EWO A;  1NLJ A;  1KFX L;  3PNR A;  1CQD A;  3I06 A;  4I07 A;  2DZY A;  1FH0 A;  1SNK A;  2F7D A;  2P86 A;  3QSD A;  1Y4H A;  4N8W A;  1QXP A;  2FT2 A;  1U9Q X;  2FO5 A;  2ACT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...