1QMYA

Fmdv leader protease (lbshort-c51a-c133s)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
156
structure length
156
Chain Sequence
b'MELTLYNGEKKTFYSRPNNHDNAWLNAILQLFRYVEEPFFDWVYSSPENLTLEAIKQLEDLTGLELHEGGPPALVIWNIKHLLHTGIGTASRPSEVCVVDGTDMSLADFHAGIFLKGQEHAVFACVTSNGWYAIDDEDFYPWTPDPSDVLVFVPYD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEASE
publication title Structure and Biochemical Features Distinguish the Foot-and-Mouth Disease Virus Leader Proteinase from Other Papain-Like Enzymes
pubmed doi rcsb
source organism Aphthovirus o
molecule tags Hydrolase
total genus 40
structure length 156
sequence length 156
chains with identical sequence B, C
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1999-10-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1qmyA00
3H8BA 2DJGB 2NQDB 4OEMA 1STFE 3OISA 5EF4A 1U9XA 2OZ2A 1FH0A 2IBIA 2JQGR 5K16A 3HWNA 1KFUL 2F7DA 3BPFA 2R9CA 1TU6A 2FYEA 3C9EA 4WA6A 3CH3X 7PCKA 3GCBA 2NQGA 2H7JA 1DEUA 1MS6A 2NQAA 1NB3A 3PBHA 1A6RA 2WBFX 4FIPA 4Q8HA 1MEMA 5CVMA 3H8CA 4CDFB 2YJ9A 4PADA 1AIMA 1PPDA 2E01A 1PPNA 4K7CA 1AYWA 1F2AA 2HD5A 2DCCA 4YYVA 4G54A 4AXLA 1GMYA 3BC3A 4YYUA 1PPPA 3KKUA 2AUZA 2FTDA 4OELA 1F29A 2HXZA 4Q8GA 2DC9A 5PADA 1PIPA 1EWMA 1F2CA 4BSQA 4I04A 1KHQA 3NHEA 5JH3A 2AUXA 2DCAA 2DC8A 2FRAA 3H89A 1GECE 2ARYA 1HUCB 1CVZA 3S3RA 3H6SA 1ME4A 3KWBX 1QXPA 1ICFA 2HHNA 2PNSA 4YYSA 4AXMA 4HWYA 1AU3A 3IMAA 1CB5A 1CV8A 4QRGA 1CSBB 3LXSA 3WXEA 1NLJA 3PNRA 5FPWA 4BQVA 1AU0A 4W5BA 5CVOB 3MHSA 1TL9A 2CIOA 2AU1A 1EWOA 4W5CA 1KHPA 3P5WA 1PCIA 1ZIVA 3K9MA 2GFOA 4X6JA 3I06A 1PBHA 5CHVA 1BGOA 3HHAA 6PADA 1CJLA 1Y08A 4N4ZA 2DC6A 1NQCA 2B1NA 2P86A 1NPZA 1EWLA 1Y4HA 3WXFA 3E1ZB 3RVXA 2FUDA 4I07A 1MHWA 4CDEB 1YVBA 1GLOA 1U9QX 3K24A 3O1GA 4QRXA 3RVVA 1VJVA 3V6CA 3F5VA 3N4CA 2AS8A 1K3BB 1X9YA 3CH2X 2AYNA 4YV8A 2DCDA 4ZUXU 4FJCA 2R9FA 4YVAA 2DZZA 2YJBA 1S4VA 1BQIA 2AIMA 4XR7A 4X6HA 1IWDA 2XU5A 1U9WA 2YJ2A 3TNXA 3OF9A 2OULA 3KW9A 1QDQA 2ACTA 4XUIA 1KFXL 1QOLA 2BDLA 3MORA 5A24A 2CB5A 1AYVA 3IEJA 1POPA 3K8UA 4DMXA 3LFYA 5JA7A 4QBBA 3QJ3A 3ERVA 3QSDA 2GHUA 3P5XA 1CPJA 2E00A 3RVWA 3IHPA 2BDZA 4FK5A 1PE6A 1ZCMA 3D6SA 2NQIA 3P5UA 4CDDB 2DCBA 1M6DA 3IOQA 4YYQA 3IV2A 2AVWA 2Y6EA 3P5VA 1PXVA 2G6DA 1TLOA 2IPPB 2JQFR 2B1MA 2R9OA 4BS6A 3N3GA 2O6XA 4PP1A 2OP3A 1BP4A 8PCHA 1CS8A 1Q6KA 4QH6A 2G8JA 2P0RA 1CQDA 1AECA 1CTEA 3OVXA 1KXRA 2XU4A 3M99A 1ATKA 4CZWA 2VHSA 2YJCA 3HHIA 1O0EA 5CHTA 1SNKA 5F02A 4RY2A 4CDCB 2G8EA 2DC7A 2Y5BA 2E02A 4PP2E 4P6EA 1YK8A 1DF0A 3BCNA 2ATOA 4YYRA 1EF7A 2R6NA 1ME3A 2HH5A 2DJFB 1YT7A 3PW3A 2AYOA 1NB5A 3B79A 1QMYA 2F1GA 3F75A 9PAPA 3WXGA 2R9MA 1F2BA 1AU4A 2PADA 1U9VA 3BPMA 4BPVA 2G7YA 3BOWA 2YJ8A 2FQ9A 2R9NA 1PADA 1MIRA 5J94A 3PDFA 3CBJA 1VSNA 1U5IA 1AYUA 3OF8A 4KLBA 1XKGA 3S3QA 3USVA 2FO5A 3KX1A 2E03A 2FRQA 3KFQA 4MSXA 4MZSA 3DF0A 4YYWA 1PPOA 4N8WA 1ITOA 4BS5A 4I05A 3IUTA 4PI3A 1EWPA 1YALA 4QRVA 2P7UA 3KWZA 2VHFA 3MHHA 1MEGA 5EGWA 2XU3A 1AU2A 1NL6A 1SP4B 4DMYA 3QT4A 3N3KA 3OVZA 4W4UA 3CBKA 2C0YA 4N79A 3KSEA 1BY8A 3U8EA 1YK7A 3MTNA 3H7DA 1JQPA 1GCBA 3BWKA 4X6IA 2PBHA 2DZYA 1MDWA 2XU1A 2FT2A 2PREA 3ZUAA 3I3TA 3O0UA 5CVNB 4MZOA 4P6GA 1THEA 3V6EA 3AI8A 3HD3A
chains in the Genus database with same CATH superfamily
3H8BA 2DJGB 3TRKA 4IP3A 1DKIA 2NQDB 4OEMA 1STFE 3OISA 4R3DA 5EF4A 1U9XA 2OZ2A 1FH0A 2IBIA 2JQGR 5K16A 3HWNA 1KFUL 2F7DA 3BPFA 2R9CA 4HXDB 1TU6A 2FYEA 3B21A 3C9EA 4WA6A 3CH3X 3ZNHA 7PCKA 3GCBA 2NQGA 2H7JA 1DEUA 1MS6A 2NQAA 1NB3A 3PBHA 3PHXA 1A6RA 2WBFX 3PRMA 4FIPA 4Q8HA 1MEMA 5CVMA 3H8CA 4CDFB 2YJ9A 4PADA 4A5UA 4BOSA 1AIMA 1PPDA 2E01A 1PPNA 4K7CA 5EZQA 1AYWA 1F2AA 2HD5A 2DCCA 4YYVA 4G54A 4RF1A 4AXLA 1GMYA 3BC3A 4YYUA 1PPPA 3KKUA 4D8EA 2AUZA 2FTDA 4OELA 1F29A 2HXZA 4Q8GA 2DC9A 5PADA 1PIPA 1EWMA 1F2CA 4BSQA 4I04A 1KHQA 3NHEA 4IUMA 5JH3A 4D8IA 2AUXA 5JZEA 2DCAA 2DC8A 2FRAA 3H89A 4OVZB 1GECE 2ARYA 1HUCB 1CVZA 3S3RA 3H6SA 1ME4A 3KWBX 1QXPA 1ICFA 1PVJA 2HHNA 4P16A 2PNSA 4YYSA 4AXMA 4HWYA 1AU3A 3IMAA 1CB5A 1CV8A 4QRGA 1CSBB 3LXSA 3WXEA 1NLJA 3PNRA 3OQCA 4WURA 5FPWA 4BQVA 1AU0A 4W5BA 5CVOB 3MHSA 1TL9A 3O65A 3PHWA 2CIOA 2AU1A 1EWOA 4W5CA 1KHPA 3P5WA 1PCIA 1ZIVA 4D8BA 3K9MA 2GFOA 2JRIA 4X6JA 4BOZA 3I06A 1PBHA 5CHVA 1BGOA 3HHAA 6PADA 1CJLA 1Y08A 4N4ZA 2DC6A 3MTVA 1NQCA 2B1NA 2P86A 2BU3A 1NPZA 1EWLA 1Y4HA 3WXFA 3E1ZB 1UKFA 3RVXA 2FUDA 4I07A 1MHWA 4CDEB 1YVBA 1YZBA 1GLOA 1U9QX 3K24A 3O1GA 4QRXA 3RVVA 4BOPA 4RNAA 1VJVA 4BOUA 2FE8A 3V6CA 3F5VA 3N4CA 2AS8A 2Z84A 1K3BB 1X9YA 3CH2X 2AYNA 4YV8A 5KO3A 2DCDA 4ZUXU 4FJCA 2R9FA 4YVAA 2DZZA 2YJBA 1S4VA 1BQIA 2AIMA 4XR7A 3PSEA 4X6HA 1IWDA 2XU5A 1U9WA 2YJ2A 4XZXA 3TNXA 3OF9A 2OULA 3KW9A 3C0RA 3MJ5A 1QDQA 2ACTA 4XUIA 1KFXL 1QOLA 2BDLA 4PT5A 3MORA 5A24A 2CB5A 1AYVA 3IEJA 1POPA 3K8UA 3W30A 4DMXA 3LFYA 5JA7A 4QBBA 3QJ3A 2J7QC 3ERVA 3QSDA 4MI7A 2GHUA 3P5XA 1CPJA 2E00A 3RVWA 3IHPA 2BDZA 4FK5A 1PE6A 1ZCMA 2J7QA 3D6SA 2DOSA 2NQIA 3P5UA 4CDDB 2JTCA 3PRPA 2DCBA 1M6DA 3IOQA 4YYQA 3IV2A 2AVWA 2Y6EA 3P5VA 1PXVA 2G6DA 4REZA 1TLOA 2IPPB 3MP2A 2JQFR 3PT2A 4BOQA 2B1MA 2R9OA 4BS6A 3N3GA 2AGAA 2O6XA 4PP1A 2OP3A 1BP4A 8PCHA 1CS8A 1Q6KA 4QH6A 2G8JA 3PHUA 2P0RA 1CQDA 1AECA 4RKXA 1CTEA 3OVXA 1KXRA 2XU4A 3IFUA 3M99A 1ATKA 4CZWA 2VHSA 2YJCA 3HHIA 4M0WA 1O0EA 5CHTA 3E9SA 1SNKA 5F02A 4RY2A 4CDCB 2G8EA 2DC7A 2Y5BA 2E02A 4PP2E 4P6EA 1YK8A 2HWKA 1DF0A 3BCNA 2ATOA 4YYRA 1EF7A 2R6NA 1ME3A 2HH5A 2DJFB 4RF0A 1YT7A 3PW3A 2AYOA 1NB5A 3B79A 1QMYA 2F1GA 3F75A 9PAPA 3WXGA 2R9MA 1F2BA 3BY4A 1AU4A 2PADA 1U9VA 3BPMA 4BPVA 2G7YA 3BOWA 2YJ8A 2FQ9A 2R9NA 1PADA 1MIRA 4OVZA 5J94A 3PDFA 3CBJA 1VSNA 1U5IA 1AYUA 3OF8A 4KLBA 1XKGA 3S3QA 3USVA 2FO5A 3BB7A 3KX1A 2E03A 2FRQA 3KFQA 4MSXA 4MZSA 2BTWA 3DF0A 3BBAA 4YYWA 1PPOA 4N8WA 1ITOA 3RNVA 4BS5A 4I05A 3IUTA 4PI3A 1EWPA 4OW0A 1YALA 4QRVA 2P7UA 3KWZA 2VHFA 3MHHA 1MEGA 5EGWA 5EZSA 4GUAA 2XU3A 1AU2A 1NL6A 2UZJA 1SP4B 4DMYA 3QT4A 3N3KA 3OVZA 4W4UA 3CBKA 3W31A 2C0YA 4N79A 3KSEA 1BY8A 3U8EA 1YK7A 4ZTBA 3MTNA 3H7DA 1JQPA 2BTWB 1GCBA 3TMPA 3BWKA 4X6IA 2PBHA 2DZYA 1MDWA 2XU1A 2FT2A 2PREA 3ZUAA 3I3TA 3O0UA 4MM3B 5CVNB 4MZOA 5E6JA 4P6GA 1THEA 3V6EA 3AI8A 3HD3A
chains in the Genus database with same CATH topology
3H8BA 2DJGB 2NQDB 4OEMA 1STFE 3OISA 5EF4A 1U9XA 2OZ2A 1FH0A 2IBIA 2JQGR 5K16A 3HWNA 1KFUL 2F7DA 3BPFA 2R9CA 1TU6A 2FYEA 3C9EA 4WA6A 3CH3X 7PCKA 3GCBA 2NQGA 2H7JA 1DEUA 1MS6A 2NQAA 1NB3A 3PBHA 1A6RA 2WBFX 4FIPA 4Q8HA 1MEMA 5CVMA 3H8CA 4CDFB 2YJ9A 4PADA 1AIMA 1PPDA 2E01A 1PPNA 4K7CA 1AYWA 1F2AA 2HD5A 2DCCA 4YYVA 4G54A 4AXLA 1GMYA 3BC3A 4YYUA 1PPPA 3KKUA 2AUZA 2FTDA 4OELA 1F29A 2HXZA 4Q8GA 2DC9A 5PADA 1PIPA 1EWMA 1F2CA 4BSQA 4I04A 1KHQA 3NHEA 5JH3A 2AUXA 2DCAA 2DC8A 1GX3A 2FRAA 3H89A 1GECE 2ARYA 1HUCB 1CVZA 3S3RA 3H6SA 1ME4A 3KWBX 1QXPA 1ICFA 2HHNA 2PNSA 4YYSA 4AXMA 4HWYA 1AU3A 3IMAA 1CB5A 1CV8A 4QRGA 1CSBB 3LXSA 3WXEA 1NLJA 3PNRA 5FPWA 4BQVA 1AU0A 4W5BA 5CVOB 3MHSA 1TL9A 2CIOA 2VFCA 2AU1A 1EWOA 4W5CA 1KHPA 3P5WA 1PCIA 1ZIVA 3K9MA 2GFOA 4X6JA 3I06A 1PBHA 5CHVA 1BGOA 3HHAA 6PADA 1CJLA 1Y08A 4N4ZA 2DC6A 3LTWA 1NQCA 2B1NA 2P86A 1NPZA 1EWLA 1Y4HA 3WXFA 3E1ZB 3RVXA 2FUDA 4I07A 1MHWA 4CDEB 1YVBA 1GLOA 1U9QX 3K24A 4B55A 3O1GA 4QRXA 3RVVA 4GUZA 1VJVA 3V6CA 3F5VA 3N4CA 2AS8A 2BSZA 1K3BB 1X9YA 3CH2X 2AYNA 4YV8A 2DCDA 4ZUXU 4FJCA 2R9FA 4YVAA 2DZZA 2YJBA 1S4VA 1BQIA 2AIMA 4XR7A 4X6HA 1IWDA 2XU5A 1U9WA 2YJ2A 3D9WA 3TNXA 3OF9A 2OULA 3KW9A 1QDQA 2ACTA 4XUIA 1KFXL 1QOLA 2BDLA 3MORA 5A24A 2CB5A 4NV8A 1AYVA 3IEJA 1POPA 3K8UA 4DMXA 3LFYA 5JA7A 4QBBA 3QJ3A 3ERVA 3QSDA 2GHUA 3P5XA 1CPJA 2E00A 3RVWA 3IHPA 2BDZA 4FK5A 1PE6A 1ZCMA 3D6SA 4BGFA 2NQIA 3P5UA 4CDDB 2DCBA 1M6DA 3IOQA 4YYQA 3IV2A 2AVWA 2Y6EA 3P5VA 1PXVA 2G6DA 1TLOA 2IPPB 2JQFR 2B1MA 2R9OA 4BS6A 3N3GA 2O6XA 4PP1A 2OP3A 1BP4A 8PCHA 1CS8A 1Q6KA 4QH6A 2G8JA 2P0RA 1CQDA 1AECA 1CTEA 3OVXA 1KXRA 2XU4A 3M99A 1W6FA 1ATKA 4CZWA 2VHSA 2YJCA 3HHIA 1O0EA 5CHTA 4C5PA 1SNKA 5F02A 4RY2A 4CDCB 2G8EA 2DC7A 2Y5BA 2E02A 4PP2E 4P6EA 1YK8A 1DF0A 3BCNA 2ATOA 4YYRA 1EF7A 2R6NA 1ME3A 2HH5A 2DJFB 1YT7A 3PW3A 2AYOA 1NB5A 3B79A 1QMYA 2F1GA 3F75A 9PAPA 1W5RA 3WXGA 2R9MA 1F2BA 1AU4A 2PADA 1U9VA 3BPMA 1W4TA 4BPVA 2G7YA 3BOWA 2YJ8A 2FQ9A 2R9NA 1PADA 1MIRA 5J94A 3PDFA 3CBJA 1VSNA 1U5IA 1AYUA 3OF8A 4KLBA 1XKGA 3S3QA 3USVA 2FO5A 2VFBA 3KX1A 2E03A 2FRQA 3KFQA 4MSXA 4MZSA 3DF0A 4YYWA 1PPOA 4N8WA 1ITOA 4BS5A 4I05A 3IUTA 4PI3A 1EWPA 1YALA 4QRVA 2P7UA 3KWZA 2VHFA 3MHHA 1MEGA 5EGWA 2XU3A 1AU2A 1NL6A 1SP4B 4DMYA 3QT4A 3N3KA 3OVZA 4W4UA 1E2TA 3CBKA 2C0YA 4N79A 3KSEA 1BY8A 3U8EA 1YK7A 3MTNA 3H7DA 1JQPA 1GCBA 3BWKA 4X6IA 2PBHA 4NV7A 2DZYA 1MDWA 2XU1A 2FT2A 2PREA 3ZUAA 3I3TA 3O0UA 5CVNB 4MZOA 4P6GA 1THEA 3V6EA 3AI8A 3HD3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H8B A;  2DJG B;  2NQD B;  4OEM A;  1STF E;  3OIS A;  5EF4 A;  1U9X A;  2OZ2 A;  1FH0 A;  2IBI A;  2JQG R;  5K16 A;  3HWN A;  1KFU L;  2F7D A;  3BPF A;  2R9C A;  1TU6 A;  2FYE A;  3C9E A;  4WA6 A;  3CH3 X;  7PCK A;  3GCB A;  2NQG A;  2H7J A;  1DEU A;  1MS6 A;  2NQA A;  1NB3 A;  3PBH A;  1A6R A;  2WBF X;  4FIP A;  4Q8H A;  1MEM A;  5CVM A;  3H8C A;  4CDF B;  2YJ9 A;  4PAD A;  1AIM A;  1PPD A;  2E01 A;  1PPN A;  4K7C A;  1AYW A;  1F2A A;  2HD5 A;  2DCC A;  4YYV A;  4G54 A;  4AXL A;  1GMY A;  3BC3 A;  4YYU A;  1PPP A;  3KKU A;  2AUZ A;  2FTD A;  4OEL A;  1F29 A;  2HXZ A;  4Q8G A;  2DC9 A;  5PAD A;  1PIP A;  1EWM A;  1F2C A;  4BSQ A;  4I04 A;  1KHQ A;  3NHE A;  5JH3 A;  2AUX A;  2DCA A;  2DC8 A;  2FRA A;  3H89 A;  1GEC E;  2ARY A;  1HUC B;  1CVZ A;  3S3R A;  3H6S A;  1ME4 A;  3KWB X;  1QXP A;  1ICF A;  2HHN A;  2PNS A;  4YYS A;  4AXM A;  4HWY A;  1AU3 A;  3IMA A;  1CB5 A;  1CV8 A;  4QRG A;  1CSB B;  3LXS A;  3WXE A;  1NLJ A;  3PNR A;  5FPW A;  4BQV A;  1AU0 A;  4W5B A;  5CVO B;  3MHS A;  1TL9 A;  2CIO A;  2AU1 A;  1EWO A;  4W5C A;  1KHP A;  3P5W A;  1PCI A;  1ZIV A;  3K9M A;  2GFO A;  4X6J A;  3I06 A;  1PBH A;  5CHV A;  1BGO A;  3HHA A;  6PAD A;  1CJL A;  1Y08 A;  4N4Z A;  2DC6 A;  1NQC A;  2B1N A;  2P86 A;  1NPZ A;  1EWL A;  1Y4H A;  3WXF A;  3E1Z B;  3RVX A;  2FUD A;  4I07 A;  1MHW A;  4CDE B;  1YVB A;  1GLO A;  1U9Q X;  3K24 A;  3O1G A;  4QRX A;  3RVV A;  1VJV A;  3V6C A;  3F5V A;  3N4C A;  2AS8 A;  1K3B B;  1X9Y A;  3CH2 X;  2AYN A;  4YV8 A;  2DCD A;  4ZUX U;  4FJC A;  2R9F A;  4YVA A;  2DZZ A;  2YJB A;  1S4V A;  1BQI A;  2AIM A;  4XR7 A;  4X6H A;  1IWD A;  2XU5 A;  1U9W A;  2YJ2 A;  3TNX A;  3OF9 A;  2OUL A;  3KW9 A;  1QDQ A;  2ACT A;  4XUI A;  1KFX L;  1QOL A;  2BDL A;  3MOR A;  5A24 A;  2CB5 A;  1AYV A;  3IEJ A;  1POP A;  3K8U A;  4DMX A;  3LFY A;  5JA7 A;  4QBB A;  3QJ3 A;  3ERV A;  3QSD A;  2GHU A;  3P5X A;  1CPJ A;  2E00 A;  3RVW A;  3IHP A;  2BDZ A;  4FK5 A;  1PE6 A;  1ZCM A;  3D6S A;  2NQI A;  3P5U A;  4CDD B;  2DCB A;  1M6D A;  3IOQ A;  4YYQ A;  3IV2 A;  2AVW A;  2Y6E A;  3P5V A;  1PXV A;  2G6D A;  1TLO A;  2IPP B;  2JQF R;  2B1M A;  2R9O A;  4BS6 A;  3N3G A;  2O6X A;  4PP1 A;  2OP3 A;  1BP4 A;  8PCH A;  1CS8 A;  1Q6K A;  4QH6 A;  2G8J A;  2P0R A;  1CQD A;  1AEC A;  1CTE A;  3OVX A;  1KXR A;  2XU4 A;  3M99 A;  1ATK A;  4CZW A;  2VHS A;  2YJC A;  3HHI A;  1O0E A;  5CHT A;  1SNK A;  5F02 A;  4RY2 A;  4CDC B;  2G8E A;  2DC7 A;  2Y5B A;  2E02 A;  4PP2 E;  4P6E A;  1YK8 A;  1DF0 A;  3BCN A;  2ATO A;  4YYR A;  1EF7 A;  2R6N A;  1ME3 A;  2HH5 A;  2DJF B;  1YT7 A;  3PW3 A;  2AYO A;  1NB5 A;  3B79 A;  1QMY A;  2F1G A;  3F75 A;  9PAP A;  3WXG A;  2R9M A;  1F2B A;  1AU4 A;  2PAD A;  1U9V A;  3BPM A;  4BPV A;  2G7Y A;  3BOW A;  2YJ8 A;  2FQ9 A;  2R9N A;  1PAD A;  1MIR A;  5J94 A;  3PDF A;  3CBJ A;  1VSN A;  1U5I A;  1AYU A;  3OF8 A;  4KLB A;  1XKG A;  3S3Q A;  3USV A;  2FO5 A;  3KX1 A;  2E03 A;  2FRQ A;  3KFQ A;  4MSX A;  4MZS A;  3DF0 A;  4YYW A;  1PPO A;  4N8W A;  1ITO A;  4BS5 A;  4I05 A;  3IUT A;  4PI3 A;  1EWP A;  1YAL A;  4QRV A;  2P7U A;  3KWZ A;  2VHF A;  3MHH A;  1MEG A;  5EGW A;  2XU3 A;  1AU2 A;  1NL6 A;  1SP4 B;  4DMY A;  3QT4 A;  3N3K A;  3OVZ A;  4W4U A;  3CBK A;  2C0Y A;  4N79 A;  3KSE A;  1BY8 A;  3U8E A;  1YK7 A;  3MTN A;  3H7D A;  1JQP A;  1GCB A;  3BWK A;  4X6I A;  2PBH A;  2DZY A;  1MDW A;  2XU1 A;  2FT2 A;  2PRE A;  3ZUA A;  3I3T A;  3O0U A;  5CVN B;  4MZO A;  4P6G A;  1THE A;  3V6E A;  3AI8 A;  3HD3 A; 
#chains in the Genus database with same CATH topology
 3H8B A;  2DJG B;  3TRK A;  4IP3 A;  1DKI A;  2NQD B;  4OEM A;  1STF E;  3OIS A;  4R3D A;  5EF4 A;  1U9X A;  2OZ2 A;  1FH0 A;  2IBI A;  2JQG R;  5K16 A;  3HWN A;  1KFU L;  2F7D A;  3BPF A;  2R9C A;  4HXD B;  1TU6 A;  2FYE A;  3B21 A;  3C9E A;  4WA6 A;  3CH3 X;  3ZNH A;  7PCK A;  3GCB A;  2NQG A;  2H7J A;  1DEU A;  1MS6 A;  2NQA A;  1NB3 A;  3PBH A;  3PHX A;  1A6R A;  2WBF X;  3PRM A;  4FIP A;  4Q8H A;  1MEM A;  5CVM A;  3H8C A;  4CDF B;  2YJ9 A;  4PAD A;  4A5U A;  4BOS A;  1AIM A;  1PPD A;  2E01 A;  1PPN A;  4K7C A;  5EZQ A;  1AYW A;  1F2A A;  2HD5 A;  2DCC A;  4YYV A;  4G54 A;  4RF1 A;  4AXL A;  1GMY A;  3BC3 A;  4YYU A;  1PPP A;  3KKU A;  4D8E A;  2AUZ A;  2FTD A;  4OEL A;  1F29 A;  2HXZ A;  4Q8G A;  2DC9 A;  5PAD A;  1PIP A;  1EWM A;  1F2C A;  4BSQ A;  4I04 A;  1KHQ A;  3NHE A;  4IUM A;  5JH3 A;  4D8I A;  2AUX A;  5JZE A;  2DCA A;  2DC8 A;  2FRA A;  3H89 A;  4OVZ B;  1GEC E;  2ARY A;  1HUC B;  1CVZ A;  3S3R A;  3H6S A;  1ME4 A;  3KWB X;  1QXP A;  1ICF A;  1PVJ A;  2HHN A;  4P16 A;  2PNS A;  4YYS A;  4AXM A;  4HWY A;  1AU3 A;  3IMA A;  1CB5 A;  1CV8 A;  4QRG A;  1CSB B;  3LXS A;  3WXE A;  1NLJ A;  3PNR A;  3OQC A;  4WUR A;  5FPW A;  4BQV A;  1AU0 A;  4W5B A;  5CVO B;  3MHS A;  1TL9 A;  3O65 A;  3PHW A;  2CIO A;  2AU1 A;  1EWO A;  4W5C A;  1KHP A;  3P5W A;  1PCI A;  1ZIV A;  4D8B A;  3K9M A;  2GFO A;  2JRI A;  4X6J A;  4BOZ A;  3I06 A;  1PBH A;  5CHV A;  1BGO A;  3HHA A;  6PAD A;  1CJL A;  1Y08 A;  4N4Z A;  2DC6 A;  3MTV A;  1NQC A;  2B1N A;  2P86 A;  2BU3 A;  1NPZ A;  1EWL A;  1Y4H A;  3WXF A;  3E1Z B;  1UKF A;  3RVX A;  2FUD A;  4I07 A;  1MHW A;  4CDE B;  1YVB A;  1YZB A;  1GLO A;  1U9Q X;  3K24 A;  3O1G A;  4QRX A;  3RVV A;  4BOP A;  4RNA A;  1VJV A;  4BOU A;  2FE8 A;  3V6C A;  3F5V A;  3N4C A;  2AS8 A;  2Z84 A;  1K3B B;  1X9Y A;  3CH2 X;  2AYN A;  4YV8 A;  5KO3 A;  2DCD A;  4ZUX U;  4FJC A;  2R9F A;  4YVA A;  2DZZ A;  2YJB A;  1S4V A;  1BQI A;  2AIM A;  4XR7 A;  3PSE A;  4X6H A;  1IWD A;  2XU5 A;  1U9W A;  2YJ2 A;  4XZX A;  3TNX A;  3OF9 A;  2OUL A;  3KW9 A;  3C0R A;  3MJ5 A;  1QDQ A;  2ACT A;  4XUI A;  1KFX L;  1QOL A;  2BDL A;  4PT5 A;  3MOR A;  5A24 A;  2CB5 A;  1AYV A;  3IEJ A;  1POP A;  3K8U A;  3W30 A;  4DMX A;  3LFY A;  5JA7 A;  4QBB A;  3QJ3 A;  2J7Q C;  3ERV A;  3QSD A;  4MI7 A;  2GHU A;  3P5X A;  1CPJ A;  2E00 A;  3RVW A;  3IHP A;  2BDZ A;  4FK5 A;  1PE6 A;  1ZCM A;  2J7Q A;  3D6S A;  2DOS A;  2NQI A;  3P5U A;  4CDD B;  2JTC A;  3PRP A;  2DCB A;  1M6D A;  3IOQ A;  4YYQ A;  3IV2 A;  2AVW A;  2Y6E A;  3P5V A;  1PXV A;  2G6D A;  4REZ A;  1TLO A;  2IPP B;  3MP2 A;  2JQF R;  3PT2 A;  4BOQ A;  2B1M A;  2R9O A;  4BS6 A;  3N3G A;  2AGA A;  2O6X A;  4PP1 A;  2OP3 A;  1BP4 A;  8PCH A;  1CS8 A;  1Q6K A;  4QH6 A;  2G8J A;  3PHU A;  2P0R A;  1CQD A;  1AEC A;  4RKX A;  1CTE A;  3OVX A;  1KXR A;  2XU4 A;  3IFU A;  3M99 A;  1ATK A;  4CZW A;  2VHS A;  2YJC A;  3HHI A;  4M0W A;  1O0E A;  5CHT A;  3E9S A;  1SNK A;  5F02 A;  4RY2 A;  4CDC B;  2G8E A;  2DC7 A;  2Y5B A;  2E02 A;  4PP2 E;  4P6E A;  1YK8 A;  2HWK A;  1DF0 A;  3BCN A;  2ATO A;  4YYR A;  1EF7 A;  2R6N A;  1ME3 A;  2HH5 A;  2DJF B;  4RF0 A;  1YT7 A;  3PW3 A;  2AYO A;  1NB5 A;  3B79 A;  1QMY A;  2F1G A;  3F75 A;  9PAP A;  3WXG A;  2R9M A;  1F2B A;  3BY4 A;  1AU4 A;  2PAD A;  1U9V A;  3BPM A;  4BPV A;  2G7Y A;  3BOW A;  2YJ8 A;  2FQ9 A;  2R9N A;  1PAD A;  1MIR A;  4OVZ A;  5J94 A;  3PDF A;  3CBJ A;  1VSN A;  1U5I A;  1AYU A;  3OF8 A;  4KLB A;  1XKG A;  3S3Q A;  3USV A;  2FO5 A;  3BB7 A;  3KX1 A;  2E03 A;  2FRQ A;  3KFQ A;  4MSX A;  4MZS A;  2BTW A;  3DF0 A;  3BBA A;  4YYW A;  1PPO A;  4N8W A;  1ITO A;  3RNV A;  4BS5 A;  4I05 A;  3IUT A;  4PI3 A;  1EWP A;  4OW0 A;  1YAL A;  4QRV A;  2P7U A;  3KWZ A;  2VHF A;  3MHH A;  1MEG A;  5EGW A;  5EZS A;  4GUA A;  2XU3 A;  1AU2 A;  1NL6 A;  2UZJ A;  1SP4 B;  4DMY A;  3QT4 A;  3N3K A;  3OVZ A;  4W4U A;  3CBK A;  3W31 A;  2C0Y A;  4N79 A;  3KSE A;  1BY8 A;  3U8E A;  1YK7 A;  4ZTB A;  3MTN A;  3H7D A;  1JQP A;  2BTW B;  1GCB A;  3TMP A;  3BWK A;  4X6I A;  2PBH A;  2DZY A;  1MDW A;  2XU1 A;  2FT2 A;  2PRE A;  3ZUA A;  3I3T A;  3O0U A;  4MM3 B;  5CVN B;  4MZO A;  5E6J A;  4P6G A;  1THE A;  3V6E A;  3AI8 A;  3HD3 A; 
#chains in the Genus database with same CATH homology
 3H8B A;  2DJG B;  2NQD B;  4OEM A;  1STF E;  3OIS A;  5EF4 A;  1U9X A;  2OZ2 A;  1FH0 A;  2IBI A;  2JQG R;  5K16 A;  3HWN A;  1KFU L;  2F7D A;  3BPF A;  2R9C A;  1TU6 A;  2FYE A;  3C9E A;  4WA6 A;  3CH3 X;  7PCK A;  3GCB A;  2NQG A;  2H7J A;  1DEU A;  1MS6 A;  2NQA A;  1NB3 A;  3PBH A;  1A6R A;  2WBF X;  4FIP A;  4Q8H A;  1MEM A;  5CVM A;  3H8C A;  4CDF B;  2YJ9 A;  4PAD A;  1AIM A;  1PPD A;  2E01 A;  1PPN A;  4K7C A;  1AYW A;  1F2A A;  2HD5 A;  2DCC A;  4YYV A;  4G54 A;  4AXL A;  1GMY A;  3BC3 A;  4YYU A;  1PPP A;  3KKU A;  2AUZ A;  2FTD A;  4OEL A;  1F29 A;  2HXZ A;  4Q8G A;  2DC9 A;  5PAD A;  1PIP A;  1EWM A;  1F2C A;  4BSQ A;  4I04 A;  1KHQ A;  3NHE A;  5JH3 A;  2AUX A;  2DCA A;  2DC8 A;  1GX3 A;  2FRA A;  3H89 A;  1GEC E;  2ARY A;  1HUC B;  1CVZ A;  3S3R A;  3H6S A;  1ME4 A;  3KWB X;  1QXP A;  1ICF A;  2HHN A;  2PNS A;  4YYS A;  4AXM A;  4HWY A;  1AU3 A;  3IMA A;  1CB5 A;  1CV8 A;  4QRG A;  1CSB B;  3LXS A;  3WXE A;  1NLJ A;  3PNR A;  5FPW A;  4BQV A;  1AU0 A;  4W5B A;  5CVO B;  3MHS A;  1TL9 A;  2CIO A;  2VFC A;  2AU1 A;  1EWO A;  4W5C A;  1KHP A;  3P5W A;  1PCI A;  1ZIV A;  3K9M A;  2GFO A;  4X6J A;  3I06 A;  1PBH A;  5CHV A;  1BGO A;  3HHA A;  6PAD A;  1CJL A;  1Y08 A;  4N4Z A;  2DC6 A;  3LTW A;  1NQC A;  2B1N A;  2P86 A;  1NPZ A;  1EWL A;  1Y4H A;  3WXF A;  3E1Z B;  3RVX A;  2FUD A;  4I07 A;  1MHW A;  4CDE B;  1YVB A;  1GLO A;  1U9Q X;  3K24 A;  4B55 A;  3O1G A;  4QRX A;  3RVV A;  4GUZ A;  1VJV A;  3V6C A;  3F5V A;  3N4C A;  2AS8 A;  2BSZ A;  1K3B B;  1X9Y A;  3CH2 X;  2AYN A;  4YV8 A;  2DCD A;  4ZUX U;  4FJC A;  2R9F A;  4YVA A;  2DZZ A;  2YJB A;  1S4V A;  1BQI A;  2AIM A;  4XR7 A;  4X6H A;  1IWD A;  2XU5 A;  1U9W A;  2YJ2 A;  3D9W A;  3TNX A;  3OF9 A;  2OUL A;  3KW9 A;  1QDQ A;  2ACT A;  4XUI A;  1KFX L;  1QOL A;  2BDL A;  3MOR A;  5A24 A;  2CB5 A;  4NV8 A;  1AYV A;  3IEJ A;  1POP A;  3K8U A;  4DMX A;  3LFY A;  5JA7 A;  4QBB A;  3QJ3 A;  3ERV A;  3QSD A;  2GHU A;  3P5X A;  1CPJ A;  2E00 A;  3RVW A;  3IHP A;  2BDZ A;  4FK5 A;  1PE6 A;  1ZCM A;  3D6S A;  4BGF A;  2NQI A;  3P5U A;  4CDD B;  2DCB A;  1M6D A;  3IOQ A;  4YYQ A;  3IV2 A;  2AVW A;  2Y6E A;  3P5V A;  1PXV A;  2G6D A;  1TLO A;  2IPP B;  2JQF R;  2B1M A;  2R9O A;  4BS6 A;  3N3G A;  2O6X A;  4PP1 A;  2OP3 A;  1BP4 A;  8PCH A;  1CS8 A;  1Q6K A;  4QH6 A;  2G8J A;  2P0R A;  1CQD A;  1AEC A;  1CTE A;  3OVX A;  1KXR A;  2XU4 A;  3M99 A;  1W6F A;  1ATK A;  4CZW A;  2VHS A;  2YJC A;  3HHI A;  1O0E A;  5CHT A;  4C5P A;  1SNK A;  5F02 A;  4RY2 A;  4CDC B;  2G8E A;  2DC7 A;  2Y5B A;  2E02 A;  4PP2 E;  4P6E A;  1YK8 A;  1DF0 A;  3BCN A;  2ATO A;  4YYR A;  1EF7 A;  2R6N A;  1ME3 A;  2HH5 A;  2DJF B;  1YT7 A;  3PW3 A;  2AYO A;  1NB5 A;  3B79 A;  1QMY A;  2F1G A;  3F75 A;  9PAP A;  1W5R A;  3WXG A;  2R9M A;  1F2B A;  1AU4 A;  2PAD A;  1U9V A;  3BPM A;  1W4T A;  4BPV A;  2G7Y A;  3BOW A;  2YJ8 A;  2FQ9 A;  2R9N A;  1PAD A;  1MIR A;  5J94 A;  3PDF A;  3CBJ A;  1VSN A;  1U5I A;  1AYU A;  3OF8 A;  4KLB A;  1XKG A;  3S3Q A;  3USV A;  2FO5 A;  2VFB A;  3KX1 A;  2E03 A;  2FRQ A;  3KFQ A;  4MSX A;  4MZS A;  3DF0 A;  4YYW A;  1PPO A;  4N8W A;  1ITO A;  4BS5 A;  4I05 A;  3IUT A;  4PI3 A;  1EWP A;  1YAL A;  4QRV A;  2P7U A;  3KWZ A;  2VHF A;  3MHH A;  1MEG A;  5EGW A;  2XU3 A;  1AU2 A;  1NL6 A;  1SP4 B;  4DMY A;  3QT4 A;  3N3K A;  3OVZ A;  4W4U A;  1E2T A;  3CBK A;  2C0Y A;  4N79 A;  3KSE A;  1BY8 A;  3U8E A;  1YK7 A;  3MTN A;  3H7D A;  1JQP A;  1GCB A;  3BWK A;  4X6I A;  2PBH A;  4NV7 A;  2DZY A;  1MDW A;  2XU1 A;  2FT2 A;  2PRE A;  3ZUA A;  3I3T A;  3O0U A;  5CVN B;  4MZO A;  4P6G A;  1THE A;  3V6E A;  3AI8 A;  3HD3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...