1QMYA

Fmdv leader protease (lbshort-c51a-c133s)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
156
structure length
156
Chain Sequence
MELTLYNGEKKTFYSRPNNHDNAWLNAILQLFRYVEEPFFDWVYSSPENLTLEAIKQLEDLTGLELHEGGPPALVIWNIKHLLHTGIGTASRPSEVCVVDGTDMSLADFHAGIFLKGQEHAVFACVTSNGWYAIDDEDFYPWTPDPSDVLVFVPYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Biochemical Features Distinguish the Foot-and-Mouth Disease Virus Leader Proteinase from Other Papain-Like Enzymes
pubmed doi rcsb
source organism Aphthovirus o
molecule tags Hydrolase
molecule keywords PROTEASE
total genus 40
structure length 156
sequence length 156
chains with identical sequence B, C
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1999-10-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1qmyA00
2R9MA 2NQAA 2YJBA 3MORA 2ATOA 2E01A 3CH2X 1AU2A 4W4UA 5CHTA 1F2BA 2P86A 3V6EA 1BQIA 8PCHA 4AXLA 3AI8A 4YYQA 3KWZA 1EWMA 2IPPB 3GCBA 3K24A 2R9FA 4BS6A 4FJCA 1BGOA 3PBHA 1PBHA 2O6XA 1ITOA 1YK7A 2JQFR 3P5UA 4I04A 2XU4A 1PPPA 1PXVA 1U9QX 3C9EA 3N4CA 1MHWA 5JA7A 2PADA 4KLBA 2E02A 2AIMA 1CSBB 4OELA 1VSNA 2R9NA 1CTEA 2BDLA 2YJ8A 2IBIA 5J94A 5EGWA 2DJGB 3N3KA 3IMAA 2FQ9A 4YYVA 1HUCB 1PPOA 2FRAA 1Y08A 3KX1A 1YK8A 4K7CA 3CH3X 1PCIA 3S3RA 2H7JA 4FK5A 1AU0A 3KW9A 3WXGA 1X9YA 1ME4A 1BY8A 1YALA 4MZOA 1EWOA 2FT2A 4MZSA 2FO5A 2AUZA 3IV2A 2WBFX 4MSXA 3F5VA 1TU6A 1XKGA 2OULA 1IWDA 1CV8A 1QXPA 3OVZA 3DF0A 4QH6A 4W5CA 2Y6EA 2F7DA 2DJFB 2E00A 5F02A 4X6HA 3WXEA 2R6NA 1AU3A 2OZ2A 1NQCA 1MDWA 3CBJA 1M6DA 2VHFA 1YT7A 1STFE 3OISA 3OF9A 3ERVA 1MEGA 1CS8A 4X6JA 3H8CA 4BSQA 2JQGR 2GFOA 1CVZA 1AYWA 5K16A 3H6SA 4DMYA 3H89A 2G6DA 5EF4A 1A6RA 4YYUA 3BC3A 3S3QA 3PDFA 2G7YA 1EWLA 1U9VA 2FYEA 1JQPA 1TL9A 4RY2A 5PADA 2DC9A 1TLOA 1BP4A 3I3TA 3OVXA 1KHPA 2B1MA 2AS8A 3F75A 5FPWA 3LFYA 1POPA 1ATKA 4CDEB 2HD5A 4XUIA 4X6IA 3TNXA 3USVA 1EF7A 4DMXA 1U9WA 2HXZA 3NHEA 5CVMA 2DCBA 4N4ZA 4QBBA 3RVXA 1ICFA 3I06A 3MHSA 3KFQA 3HD3A 1KXRA 4WA6A 5A24A 2PNSA 2PREA 2XU1A 2DCDA 3MHHA 3KWBX 4P6GA 2YJ9A 1S4VA 4YYWA 2AYOA 1VJVA 1ME3A 3IOQA 1PPNA 2NQDB 3IHPA 3BOWA 1SNKA 1YVBA 3M99A 1QOLA 4CDDB 1AU4A 1PPDA 4PP1A 3BPMA 4QRVA 2HH5A 3WXFA 4BS5A 2C0YA 6PADA 2NQIA 2YJ2A 1CJLA 4YV8A 4Q8GA 4PI3A 3BCNA 4YYSA 1NB3A 2FUDA 3K8UA 1F29A 2AU1A 3BPFA 1KFUL 2AUXA 1NB5A 2R9CA 4HWYA 1KHQA 4CZWA 2GHUA 2HHNA 4I05A 1CQDA 1QDQA 1NLJA 1MS6A 3QJ3A 1MIRA 1ZIVA 3O1GA 3D6SA 2P7UA 1DEUA 4N79A 2DC8A 3P5WA 2DZZA 9PAPA 2AVWA 1CPJA 4CDCB 3ZUAA 1U9XA 3H7DA 1ZCMA 1Y4HA 1F2CA 4W5BA 2NQGA 2G8JA 3RVWA 1Q6KA 2P0RA 4BQVA 1U5IA 2PBHA 3CBKA 2ACTA 5JH3A 4CDFB 3IUTA 2DCAA 4N8WA 2ARYA 2G8EA 4FIPA 3PW3A 3MTNA 3H8BA 4P6EA 2F1GA 2E03A 3RVVA 4YVAA 1EWPA 3E1ZB 3IEJA 3P5XA 1QMYA 3BWKA 1KFXL 3B79A 1THEA 4YYRA 5CVOB 2Y5BA 2XU5A 1FH0A 4G54A 2AYNA 4PADA 3P5VA 3OF8A 3QT4A 1F2AA 2CB5A 2OP3A 4OEMA 1DF0A 3HWNA 4Q8HA 1PIPA 2CIOA 4QRXA 4XR7A 3QSDA 4ZUXU 1O0EA 4PP2E 1NL6A 2FTDA 1MEMA 2DC7A 3HHAA 3K9MA 3KSEA 1GECE 1AYVA 2YJCA 2DCCA 5CHVA 4QRGA 1AYUA 1GMYA 1GLOA 1PADA 2R9OA 3KKUA 3N3GA 3O0UA 2XU3A 2VHSA 7PCKA 2FRQA 4I07A 3HHIA 3PNRA 2DZYA 4BPVA 1GCBA 5CVNB 1SP4B 1NPZA 1CB5A 3U8EA 2B1NA 1K3BB 1AIMA 1PE6A 2DC6A 3LXSA 2BDZA 4AXMA 3V6CA 1AECA
chains in the Genus database with same CATH superfamily
2R9MA 2NQAA 2YJBA 3MORA 2ATOA 2E01A 3CH2X 1AU2A 4W4UA 5CHTA 1F2BA 2P86A 3V6EA 1BQIA 8PCHA 2DOSA 3BY4A 4AXLA 2BTWA 3AI8A 4YYQA 3KWZA 1EWMA 2IPPB 3GCBA 3K24A 2R9FA 4BS6A 4FJCA 1BGOA 3PBHA 2UZJA 1PBHA 2O6XA 3ZNHA 1ITOA 1YK7A 2JQFR 3P5UA 4I04A 2XU4A 1PPPA 1PVJA 1PXVA 1U9QX 3RNVA 3C9EA 3N4CA 1MHWA 5KO3A 5JA7A 2PADA 4XZXA 4KLBA 2E02A 2AIMA 1CSBB 4OELA 1VSNA 2R9NA 1CTEA 5JZEA 4M0WA 2BDLA 2YJ8A 2IBIA 5J94A 5EGWA 2DJGB 3N3KA 3IMAA 2FQ9A 4RKXA 4YYVA 1HUCB 1PPOA 2FRAA 1Y08A 3KX1A 4OVZB 1YK8A 4K7CA 3CH3X 1PCIA 3S3RA 2H7JA 2FE8A 4FK5A 1AU0A 3KW9A 2JRIA 3WXGA 3BB7A 1X9YA 1ME4A 1BY8A 1YALA 4MZOA 1EWOA 3TRKA 2FT2A 4D8EA 4MZSA 2FO5A 2AUZA 3IV2A 2WBFX 4MSXA 1UKFA 3F5VA 1TU6A 4IP3A 1XKGA 2OULA 1IWDA 1CV8A 1QXPA 3OVZA 3DF0A 4QH6A 4W5CA 2Y6EA 2F7DA 2DJFB 2E00A 4OVZA 5F02A 4X6HA 3WXEA 2R6NA 1AU3A 5EZQA 2OZ2A 1NQCA 1MDWA 3CBJA 1M6DA 2VHFA 1YT7A 1STFE 2J7QC 3OISA 3OF9A 3ERVA 4MI7A 1MEGA 1CS8A 4R3DA 3H8CA 4X6JA 4BSQA 2JQGR 2GFOA 1CVZA 1AYWA 5K16A 3H6SA 4DMYA 4BOZA 3H89A 2G6DA 5EF4A 1A6RA 3PSEA 3O65A 3MTVA 4YYUA 3BC3A 3E9SA 2BTWB 3S3QA 3PDFA 2G7YA 1EWLA 1U9VA 2FYEA 1JQPA 1TL9A 4RY2A 5PADA 2DC9A 1TLOA 1BP4A 3I3TA 3OVXA 1KHPA 2B1MA 2AS8A 3F75A 5FPWA 3LFYA 1POPA 1ATKA 4CDEB 2HD5A 4XUIA 4X6IA 3TNXA 3USVA 1EF7A 4DMXA 1U9WA 1DKIA 2HXZA 3NHEA 5CVMA 4BOQA 2DCBA 4N4ZA 4QBBA 3OQCA 3RVXA 1ICFA 3I06A 3MHSA 3KFQA 3HD3A 1KXRA 4WA6A 5A24A 2PNSA 2PREA 2XU1A 2DCDA 3MHHA 3KWBX 4P6GA 4RNAA 2YJ9A 1S4VA 3IFUA 4PT5A 4YYWA 2AYOA 1VJVA 1ME3A 3IOQA 1PPNA 2NQDB 4OW0A 3IHPA 3BOWA 3BBAA 1SNKA 1YVBA 3M99A 1QOLA 4CDDB 1AU4A 1PPDA 4PP1A 3BPMA 4QRVA 2HH5A 3WXFA 4BS5A 2C0YA 6PADA 2NQIA 2YJ2A 1CJLA 4YV8A 2Z84A 4Q8GA 4PI3A 3BCNA 4YYSA 1NB3A 3C0RA 4D8IA 2FUDA 4A5UA 3K8UA 3PHUA 1F29A 2J7QA 2AU1A 3BPFA 1KFUL 2AUXA 1NB5A 2R9CA 4HWYA 1KHQA 4CZWA 2GHUA 2HHNA 5E6JA 4I05A 1CQDA 1QDQA 1NLJA 1MS6A 3QJ3A 1MIRA 1ZIVA 4IUMA 3O1GA 3D6SA 2P7UA 1DEUA 4N79A 3B21A 4REZA 2DC8A 3P5WA 4BOPA 2DZZA 9PAPA 4HXDB 1YZBA 2AVWA 1CPJA 3MJ5A 4CDCB 3ZUAA 4WURA 3PRPA 1U9XA 3H7DA 1ZCMA 1Y4HA 1F2CA 4W5BA 2NQGA 2G8JA 3RVWA 1Q6KA 2P0RA 4BQVA 3W30A 1U5IA 2PBHA 3CBKA 2ACTA 5JH3A 2JTCA 4CDFB 3IUTA 2DCAA 4N8WA 3W31A 2ARYA 2G8EA 4FIPA 3PW3A 3MTNA 2BU3A 3H8BA 4P6EA 2F1GA 2E03A 3RVVA 4YVAA 1EWPA 3E1ZB 3IEJA 3MP2A 3PRMA 4MM3B 3P5XA 1QMYA 3BWKA 1KFXL 3B79A 1THEA 4YYRA 5CVOB 2Y5BA 2XU5A 1FH0A 4BOUA 4G54A 2AYNA 4PADA 3P5VA 3OF8A 3QT4A 4D8BA 2AGAA 4ZTBA 1F2AA 2CB5A 2OP3A 4OEMA 1DF0A 3HWNA 4Q8HA 1PIPA 2CIOA 4QRXA 4XR7A 3QSDA 4ZUXU 1O0EA 4PP2E 4BOSA 4GUAA 1NL6A 2FTDA 3TMPA 1MEMA 2DC7A 3HHAA 3K9MA 3KSEA 1GECE 1AYVA 2YJCA 2DCCA 5CHVA 4QRGA 1AYUA 4P16A 1GMYA 1GLOA 1PADA 2R9OA 3KKUA 3N3GA 3PHXA 3O0UA 5EZSA 2XU3A 2VHSA 7PCKA 2FRQA 3PT2A 4I07A 3PHWA 3HHIA 3PNRA 2DZYA 4BPVA 1GCBA 5CVNB 1SP4B 1NPZA 4RF1A 1CB5A 3U8EA 2B1NA 1K3BB 1AIMA 4RF0A 1PE6A 2DC6A 3LXSA 2BDZA 4AXMA 3V6CA 2HWKA 1AECA
chains in the Genus database with same CATH topology
2R9MA 2NQAA 2YJBA 3MORA 2ATOA 2E01A 3CH2X 1AU2A 4W4UA 5CHTA 1F2BA 2P86A 3V6EA 1BQIA 8PCHA 4AXLA 3AI8A 4YYQA 3KWZA 1EWMA 2IPPB 3GCBA 3K24A 2R9FA 4BS6A 4FJCA 1BGOA 3PBHA 1PBHA 2O6XA 1ITOA 1YK7A 2JQFR 3P5UA 4I04A 2XU4A 1PPPA 1PXVA 1U9QX 3C9EA 3N4CA 1MHWA 5JA7A 2PADA 4KLBA 2E02A 2AIMA 1CSBB 4OELA 1VSNA 2R9NA 1CTEA 2BDLA 2YJ8A 2IBIA 5J94A 5EGWA 2DJGB 3N3KA 3IMAA 2FQ9A 4YYVA 1HUCB 1PPOA 2FRAA 1Y08A 3KX1A 1YK8A 4K7CA 3CH3X 1PCIA 3S3RA 2H7JA 4FK5A 1AU0A 3KW9A 3WXGA 1E2TA 1X9YA 1ME4A 1BY8A 1YALA 4MZOA 1EWOA 2BSZA 2FT2A 4MZSA 2FO5A 2AUZA 3IV2A 2WBFX 4MSXA 3F5VA 1TU6A 1XKGA 2OULA 1IWDA 1CV8A 1QXPA 3OVZA 3DF0A 4QH6A 4W5CA 2Y6EA 2F7DA 2DJFB 2E00A 5F02A 4X6HA 3WXEA 2R6NA 1AU3A 2OZ2A 1NQCA 1MDWA 3CBJA 1M6DA 2VHFA 1YT7A 1STFE 3OISA 3OF9A 3ERVA 1MEGA 1CS8A 4X6JA 3H8CA 4BSQA 2JQGR 2GFOA 1CVZA 1AYWA 5K16A 3H6SA 4DMYA 3H89A 2G6DA 5EF4A 1A6RA 4YYUA 3BC3A 3S3QA 3PDFA 2G7YA 1EWLA 1U9VA 2FYEA 1JQPA 1TL9A 4RY2A 5PADA 2DC9A 1TLOA 1BP4A 3I3TA 3OVXA 1KHPA 2B1MA 4C5PA 2AS8A 3F75A 5FPWA 1W6FA 3LFYA 1POPA 1ATKA 4CDEB 2HD5A 4XUIA 4X6IA 3TNXA 3USVA 1EF7A 4DMXA 1U9WA 2HXZA 3NHEA 5CVMA 2DCBA 4N4ZA 4QBBA 3RVXA 1ICFA 3I06A 3MHSA 3KFQA 3HD3A 4WA6A 1KXRA 1W4TA 5A24A 2PNSA 2PREA 2XU1A 2DCDA 3MHHA 3KWBX 4P6GA 2YJ9A 1S4VA 4YYWA 2AYOA 1VJVA 1ME3A 3IOQA 1PPNA 2NQDB 3IHPA 3BOWA 1SNKA 1YVBA 2VFBA 3M99A 1QOLA 4CDDB 1AU4A 1PPDA 4PP1A 3BPMA 4QRVA 2HH5A 3WXFA 4BS5A 2C0YA 6PADA 2NQIA 2YJ2A 1CJLA 4YV8A 4Q8GA 4PI3A 3BCNA 4YYSA 1NB3A 2FUDA 3K8UA 1F29A 4NV8A 2AU1A 3BPFA 1KFUL 3LTWA 2AUXA 1NB5A 2R9CA 4HWYA 1KHQA 4CZWA 2GHUA 2HHNA 4I05A 1CQDA 4B55A 1QDQA 1NLJA 1MS6A 3QJ3A 1MIRA 1ZIVA 3O1GA 3D6SA 2P7UA 1DEUA 4N79A 1W5RA 2DC8A 3P5WA 2DZZA 9PAPA 2AVWA 1CPJA 4CDCB 3ZUAA 1U9XA 3H7DA 1ZCMA 1Y4HA 1F2CA 4W5BA 2NQGA 2G8JA 3D9WA 3RVWA 1Q6KA 2P0RA 4BQVA 1U5IA 2PBHA 3CBKA 2ACTA 5JH3A 4CDFB 3IUTA 2DCAA 4N8WA 2ARYA 2G8EA 4FIPA 3PW3A 3MTNA 2VFCA 3H8BA 4P6EA 2F1GA 2E03A 3RVVA 4YVAA 1EWPA 3E1ZB 3IEJA 4GUZA 3P5XA 1QMYA 3BWKA 1KFXL 3B79A 1THEA 4YYRA 5CVOB 2Y5BA 2XU5A 1FH0A 4G54A 2AYNA 4PADA 3P5VA 3OF8A 3QT4A 1F2AA 2CB5A 2OP3A 4OEMA 4NV7A 1DF0A 3HWNA 4Q8HA 1GX3A 1PIPA 2CIOA 4QRXA 4XR7A 3QSDA 4ZUXU 1O0EA 4PP2E 1NL6A 2FTDA 1MEMA 2DC7A 3HHAA 3K9MA 3KSEA 1GECE 1AYVA 2YJCA 2DCCA 5CHVA 4QRGA 1AYUA 1GMYA 1GLOA 1PADA 2R9OA 3KKUA 3N3GA 3O0UA 4BGFA 2XU3A 2VHSA 7PCKA 2FRQA 4I07A 3HHIA 3PNRA 2DZYA 4BPVA 1GCBA 5CVNB 1SP4B 1NPZA 1CB5A 3U8EA 2B1NA 1K3BB 1AIMA 1PE6A 2DC6A 3LXSA 2BDZA 4AXMA 3V6CA 1AECA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R9M A;  2NQA A;  2YJB A;  3MOR A;  2ATO A;  2E01 A;  3CH2 X;  1AU2 A;  4W4U A;  5CHT A;  1F2B A;  2P86 A;  3V6E A;  1BQI A;  8PCH A;  4AXL A;  3AI8 A;  4YYQ A;  3KWZ A;  1EWM A;  2IPP B;  3GCB A;  3K24 A;  2R9F A;  4BS6 A;  4FJC A;  1BGO A;  3PBH A;  1PBH A;  2O6X A;  1ITO A;  1YK7 A;  2JQF R;  3P5U A;  4I04 A;  2XU4 A;  1PPP A;  1PXV A;  1U9Q X;  3C9E A;  3N4C A;  1MHW A;  5JA7 A;  2PAD A;  4KLB A;  2E02 A;  2AIM A;  1CSB B;  4OEL A;  1VSN A;  2R9N A;  1CTE A;  2BDL A;  2YJ8 A;  2IBI A;  5J94 A;  5EGW A;  2DJG B;  3N3K A;  3IMA A;  2FQ9 A;  4YYV A;  1HUC B;  1PPO A;  2FRA A;  1Y08 A;  3KX1 A;  1YK8 A;  4K7C A;  3CH3 X;  1PCI A;  3S3R A;  2H7J A;  4FK5 A;  1AU0 A;  3KW9 A;  3WXG A;  1X9Y A;  1ME4 A;  1BY8 A;  1YAL A;  4MZO A;  1EWO A;  2FT2 A;  4MZS A;  2FO5 A;  2AUZ A;  3IV2 A;  2WBF X;  4MSX A;  3F5V A;  1TU6 A;  1XKG A;  2OUL A;  1IWD A;  1CV8 A;  1QXP A;  3OVZ A;  3DF0 A;  4QH6 A;  4W5C A;  2Y6E A;  2F7D A;  2DJF B;  2E00 A;  5F02 A;  4X6H A;  3WXE A;  2R6N A;  1AU3 A;  2OZ2 A;  1NQC A;  1MDW A;  3CBJ A;  1M6D A;  2VHF A;  1YT7 A;  1STF E;  3OIS A;  3OF9 A;  3ERV A;  1MEG A;  1CS8 A;  4X6J A;  3H8C A;  4BSQ A;  2JQG R;  2GFO A;  1CVZ A;  1AYW A;  5K16 A;  3H6S A;  4DMY A;  3H89 A;  2G6D A;  5EF4 A;  1A6R A;  4YYU A;  3BC3 A;  3S3Q A;  3PDF A;  2G7Y A;  1EWL A;  1U9V A;  2FYE A;  1JQP A;  1TL9 A;  4RY2 A;  5PAD A;  2DC9 A;  1TLO A;  1BP4 A;  3I3T A;  3OVX A;  1KHP A;  2B1M A;  2AS8 A;  3F75 A;  5FPW A;  3LFY A;  1POP A;  1ATK A;  4CDE B;  2HD5 A;  4XUI A;  4X6I A;  3TNX A;  3USV A;  1EF7 A;  4DMX A;  1U9W A;  2HXZ A;  3NHE A;  5CVM A;  2DCB A;  4N4Z A;  4QBB A;  3RVX A;  1ICF A;  3I06 A;  3MHS A;  3KFQ A;  3HD3 A;  1KXR A;  4WA6 A;  5A24 A;  2PNS A;  2PRE A;  2XU1 A;  2DCD A;  3MHH A;  3KWB X;  4P6G A;  2YJ9 A;  1S4V A;  4YYW A;  2AYO A;  1VJV A;  1ME3 A;  3IOQ A;  1PPN A;  2NQD B;  3IHP A;  3BOW A;  1SNK A;  1YVB A;  3M99 A;  1QOL A;  4CDD B;  1AU4 A;  1PPD A;  4PP1 A;  3BPM A;  4QRV A;  2HH5 A;  3WXF A;  4BS5 A;  2C0Y A;  6PAD A;  2NQI A;  2YJ2 A;  1CJL A;  4YV8 A;  4Q8G A;  4PI3 A;  3BCN A;  4YYS A;  1NB3 A;  2FUD A;  3K8U A;  1F29 A;  2AU1 A;  3BPF A;  1KFU L;  2AUX A;  1NB5 A;  2R9C A;  4HWY A;  1KHQ A;  4CZW A;  2GHU A;  2HHN A;  4I05 A;  1CQD A;  1QDQ A;  1NLJ A;  1MS6 A;  3QJ3 A;  1MIR A;  1ZIV A;  3O1G A;  3D6S A;  2P7U A;  1DEU A;  4N79 A;  2DC8 A;  3P5W A;  2DZZ A;  9PAP A;  2AVW A;  1CPJ A;  4CDC B;  3ZUA A;  1U9X A;  3H7D A;  1ZCM A;  1Y4H A;  1F2C A;  4W5B A;  2NQG A;  2G8J A;  3RVW A;  1Q6K A;  2P0R A;  4BQV A;  1U5I A;  2PBH A;  3CBK A;  2ACT A;  5JH3 A;  4CDF B;  3IUT A;  2DCA A;  4N8W A;  2ARY A;  2G8E A;  4FIP A;  3PW3 A;  3MTN A;  3H8B A;  4P6E A;  2F1G A;  2E03 A;  3RVV A;  4YVA A;  1EWP A;  3E1Z B;  3IEJ A;  3P5X A;  1QMY A;  3BWK A;  1KFX L;  3B79 A;  1THE A;  4YYR A;  5CVO B;  2Y5B A;  2XU5 A;  1FH0 A;  4G54 A;  2AYN A;  4PAD A;  3P5V A;  3OF8 A;  3QT4 A;  1F2A A;  2CB5 A;  2OP3 A;  4OEM A;  1DF0 A;  3HWN A;  4Q8H A;  1PIP A;  2CIO A;  4QRX A;  4XR7 A;  3QSD A;  4ZUX U;  1O0E A;  4PP2 E;  1NL6 A;  2FTD A;  1MEM A;  2DC7 A;  3HHA A;  3K9M A;  3KSE A;  1GEC E;  1AYV A;  2YJC A;  2DCC A;  5CHV A;  4QRG A;  1AYU A;  1GMY A;  1GLO A;  1PAD A;  2R9O A;  3KKU A;  3N3G A;  3O0U A;  2XU3 A;  2VHS A;  7PCK A;  2FRQ A;  4I07 A;  3HHI A;  3PNR A;  2DZY A;  4BPV A;  1GCB A;  5CVN B;  1SP4 B;  1NPZ A;  1CB5 A;  3U8E A;  2B1N A;  1K3B B;  1AIM A;  1PE6 A;  2DC6 A;  3LXS A;  2BDZ A;  4AXM A;  3V6C A;  1AEC A; 
#chains in the Genus database with same CATH topology
 2R9M A;  2NQA A;  2YJB A;  3MOR A;  2ATO A;  2E01 A;  3CH2 X;  1AU2 A;  4W4U A;  5CHT A;  1F2B A;  2P86 A;  3V6E A;  1BQI A;  8PCH A;  2DOS A;  3BY4 A;  4AXL A;  2BTW A;  3AI8 A;  4YYQ A;  3KWZ A;  1EWM A;  2IPP B;  3GCB A;  3K24 A;  2R9F A;  4BS6 A;  4FJC A;  1BGO A;  3PBH A;  2UZJ A;  1PBH A;  2O6X A;  3ZNH A;  1ITO A;  1YK7 A;  2JQF R;  3P5U A;  4I04 A;  2XU4 A;  1PPP A;  1PVJ A;  1PXV A;  1U9Q X;  3RNV A;  3C9E A;  3N4C A;  1MHW A;  5KO3 A;  5JA7 A;  2PAD A;  4XZX A;  4KLB A;  2E02 A;  2AIM A;  1CSB B;  4OEL A;  1VSN A;  2R9N A;  1CTE A;  5JZE A;  4M0W A;  2BDL A;  2YJ8 A;  2IBI A;  5J94 A;  5EGW A;  2DJG B;  3N3K A;  3IMA A;  2FQ9 A;  4RKX A;  4YYV A;  1HUC B;  1PPO A;  2FRA A;  1Y08 A;  3KX1 A;  4OVZ B;  1YK8 A;  4K7C A;  3CH3 X;  1PCI A;  3S3R A;  2H7J A;  2FE8 A;  4FK5 A;  1AU0 A;  3KW9 A;  2JRI A;  3WXG A;  3BB7 A;  1X9Y A;  1ME4 A;  1BY8 A;  1YAL A;  4MZO A;  1EWO A;  3TRK A;  2FT2 A;  4D8E A;  4MZS A;  2FO5 A;  2AUZ A;  3IV2 A;  2WBF X;  4MSX A;  1UKF A;  3F5V A;  1TU6 A;  4IP3 A;  1XKG A;  2OUL A;  1IWD A;  1CV8 A;  1QXP A;  3OVZ A;  3DF0 A;  4QH6 A;  4W5C A;  2Y6E A;  2F7D A;  2DJF B;  2E00 A;  4OVZ A;  5F02 A;  4X6H A;  3WXE A;  2R6N A;  1AU3 A;  5EZQ A;  2OZ2 A;  1NQC A;  1MDW A;  3CBJ A;  1M6D A;  2VHF A;  1YT7 A;  1STF E;  2J7Q C;  3OIS A;  3OF9 A;  3ERV A;  4MI7 A;  1MEG A;  1CS8 A;  4R3D A;  3H8C A;  4X6J A;  4BSQ A;  2JQG R;  2GFO A;  1CVZ A;  1AYW A;  5K16 A;  3H6S A;  4DMY A;  4BOZ A;  3H89 A;  2G6D A;  5EF4 A;  1A6R A;  3PSE A;  3O65 A;  3MTV A;  4YYU A;  3BC3 A;  3E9S A;  2BTW B;  3S3Q A;  3PDF A;  2G7Y A;  1EWL A;  1U9V A;  2FYE A;  1JQP A;  1TL9 A;  4RY2 A;  5PAD A;  2DC9 A;  1TLO A;  1BP4 A;  3I3T A;  3OVX A;  1KHP A;  2B1M A;  2AS8 A;  3F75 A;  5FPW A;  3LFY A;  1POP A;  1ATK A;  4CDE B;  2HD5 A;  4XUI A;  4X6I A;  3TNX A;  3USV A;  1EF7 A;  4DMX A;  1U9W A;  1DKI A;  2HXZ A;  3NHE A;  5CVM A;  4BOQ A;  2DCB A;  4N4Z A;  4QBB A;  3OQC A;  3RVX A;  1ICF A;  3I06 A;  3MHS A;  3KFQ A;  3HD3 A;  1KXR A;  4WA6 A;  5A24 A;  2PNS A;  2PRE A;  2XU1 A;  2DCD A;  3MHH A;  3KWB X;  4P6G A;  4RNA A;  2YJ9 A;  1S4V A;  3IFU A;  4PT5 A;  4YYW A;  2AYO A;  1VJV A;  1ME3 A;  3IOQ A;  1PPN A;  2NQD B;  4OW0 A;  3IHP A;  3BOW A;  3BBA A;  1SNK A;  1YVB A;  3M99 A;  1QOL A;  4CDD B;  1AU4 A;  1PPD A;  4PP1 A;  3BPM A;  4QRV A;  2HH5 A;  3WXF A;  4BS5 A;  2C0Y A;  6PAD A;  2NQI A;  2YJ2 A;  1CJL A;  4YV8 A;  2Z84 A;  4Q8G A;  4PI3 A;  3BCN A;  4YYS A;  1NB3 A;  3C0R A;  4D8I A;  2FUD A;  4A5U A;  3K8U A;  3PHU A;  1F29 A;  2J7Q A;  2AU1 A;  3BPF A;  1KFU L;  2AUX A;  1NB5 A;  2R9C A;  4HWY A;  1KHQ A;  4CZW A;  2GHU A;  2HHN A;  5E6J A;  4I05 A;  1CQD A;  1QDQ A;  1NLJ A;  1MS6 A;  3QJ3 A;  1MIR A;  1ZIV A;  4IUM A;  3O1G A;  3D6S A;  2P7U A;  1DEU A;  4N79 A;  3B21 A;  4REZ A;  2DC8 A;  3P5W A;  4BOP A;  2DZZ A;  9PAP A;  4HXD B;  1YZB A;  2AVW A;  1CPJ A;  3MJ5 A;  4CDC B;  3ZUA A;  4WUR A;  3PRP A;  1U9X A;  3H7D A;  1ZCM A;  1Y4H A;  1F2C A;  4W5B A;  2NQG A;  2G8J A;  3RVW A;  1Q6K A;  2P0R A;  4BQV A;  3W30 A;  1U5I A;  2PBH A;  3CBK A;  2ACT A;  5JH3 A;  2JTC A;  4CDF B;  3IUT A;  2DCA A;  4N8W A;  3W31 A;  2ARY A;  2G8E A;  4FIP A;  3PW3 A;  3MTN A;  2BU3 A;  3H8B A;  4P6E A;  2F1G A;  2E03 A;  3RVV A;  4YVA A;  1EWP A;  3E1Z B;  3IEJ A;  3MP2 A;  3PRM A;  4MM3 B;  3P5X A;  1QMY A;  3BWK A;  1KFX L;  3B79 A;  1THE A;  4YYR A;  5CVO B;  2Y5B A;  2XU5 A;  1FH0 A;  4BOU A;  4G54 A;  2AYN A;  4PAD A;  3P5V A;  3OF8 A;  3QT4 A;  4D8B A;  2AGA A;  4ZTB A;  1F2A A;  2CB5 A;  2OP3 A;  4OEM A;  1DF0 A;  3HWN A;  4Q8H A;  1PIP A;  2CIO A;  4QRX A;  4XR7 A;  3QSD A;  4ZUX U;  1O0E A;  4PP2 E;  4BOS A;  4GUA A;  1NL6 A;  2FTD A;  3TMP A;  1MEM A;  2DC7 A;  3HHA A;  3K9M A;  3KSE A;  1GEC E;  1AYV A;  2YJC A;  2DCC A;  5CHV A;  4QRG A;  1AYU A;  4P16 A;  1GMY A;  1GLO A;  1PAD A;  2R9O A;  3KKU A;  3N3G A;  3PHX A;  3O0U A;  5EZS A;  2XU3 A;  2VHS A;  7PCK A;  2FRQ A;  3PT2 A;  4I07 A;  3PHW A;  3HHI A;  3PNR A;  2DZY A;  4BPV A;  1GCB A;  5CVN B;  1SP4 B;  1NPZ A;  4RF1 A;  1CB5 A;  3U8E A;  2B1N A;  1K3B B;  1AIM A;  4RF0 A;  1PE6 A;  2DC6 A;  3LXS A;  2BDZ A;  4AXM A;  3V6C A;  2HWK A;  1AEC A; 
#chains in the Genus database with same CATH homology
 2R9M A;  2NQA A;  2YJB A;  3MOR A;  2ATO A;  2E01 A;  3CH2 X;  1AU2 A;  4W4U A;  5CHT A;  1F2B A;  2P86 A;  3V6E A;  1BQI A;  8PCH A;  4AXL A;  3AI8 A;  4YYQ A;  3KWZ A;  1EWM A;  2IPP B;  3GCB A;  3K24 A;  2R9F A;  4BS6 A;  4FJC A;  1BGO A;  3PBH A;  1PBH A;  2O6X A;  1ITO A;  1YK7 A;  2JQF R;  3P5U A;  4I04 A;  2XU4 A;  1PPP A;  1PXV A;  1U9Q X;  3C9E A;  3N4C A;  1MHW A;  5JA7 A;  2PAD A;  4KLB A;  2E02 A;  2AIM A;  1CSB B;  4OEL A;  1VSN A;  2R9N A;  1CTE A;  2BDL A;  2YJ8 A;  2IBI A;  5J94 A;  5EGW A;  2DJG B;  3N3K A;  3IMA A;  2FQ9 A;  4YYV A;  1HUC B;  1PPO A;  2FRA A;  1Y08 A;  3KX1 A;  1YK8 A;  4K7C A;  3CH3 X;  1PCI A;  3S3R A;  2H7J A;  4FK5 A;  1AU0 A;  3KW9 A;  3WXG A;  1E2T A;  1X9Y A;  1ME4 A;  1BY8 A;  1YAL A;  4MZO A;  1EWO A;  2BSZ A;  2FT2 A;  4MZS A;  2FO5 A;  2AUZ A;  3IV2 A;  2WBF X;  4MSX A;  3F5V A;  1TU6 A;  1XKG A;  2OUL A;  1IWD A;  1CV8 A;  1QXP A;  3OVZ A;  3DF0 A;  4QH6 A;  4W5C A;  2Y6E A;  2F7D A;  2DJF B;  2E00 A;  5F02 A;  4X6H A;  3WXE A;  2R6N A;  1AU3 A;  2OZ2 A;  1NQC A;  1MDW A;  3CBJ A;  1M6D A;  2VHF A;  1YT7 A;  1STF E;  3OIS A;  3OF9 A;  3ERV A;  1MEG A;  1CS8 A;  4X6J A;  3H8C A;  4BSQ A;  2JQG R;  2GFO A;  1CVZ A;  1AYW A;  5K16 A;  3H6S A;  4DMY A;  3H89 A;  2G6D A;  5EF4 A;  1A6R A;  4YYU A;  3BC3 A;  3S3Q A;  3PDF A;  2G7Y A;  1EWL A;  1U9V A;  2FYE A;  1JQP A;  1TL9 A;  4RY2 A;  5PAD A;  2DC9 A;  1TLO A;  1BP4 A;  3I3T A;  3OVX A;  1KHP A;  2B1M A;  4C5P A;  2AS8 A;  3F75 A;  5FPW A;  1W6F A;  3LFY A;  1POP A;  1ATK A;  4CDE B;  2HD5 A;  4XUI A;  4X6I A;  3TNX A;  3USV A;  1EF7 A;  4DMX A;  1U9W A;  2HXZ A;  3NHE A;  5CVM A;  2DCB A;  4N4Z A;  4QBB A;  3RVX A;  1ICF A;  3I06 A;  3MHS A;  3KFQ A;  3HD3 A;  4WA6 A;  1KXR A;  1W4T A;  5A24 A;  2PNS A;  2PRE A;  2XU1 A;  2DCD A;  3MHH A;  3KWB X;  4P6G A;  2YJ9 A;  1S4V A;  4YYW A;  2AYO A;  1VJV A;  1ME3 A;  3IOQ A;  1PPN A;  2NQD B;  3IHP A;  3BOW A;  1SNK A;  1YVB A;  2VFB A;  3M99 A;  1QOL A;  4CDD B;  1AU4 A;  1PPD A;  4PP1 A;  3BPM A;  4QRV A;  2HH5 A;  3WXF A;  4BS5 A;  2C0Y A;  6PAD A;  2NQI A;  2YJ2 A;  1CJL A;  4YV8 A;  4Q8G A;  4PI3 A;  3BCN A;  4YYS A;  1NB3 A;  2FUD A;  3K8U A;  1F29 A;  4NV8 A;  2AU1 A;  3BPF A;  1KFU L;  3LTW A;  2AUX A;  1NB5 A;  2R9C A;  4HWY A;  1KHQ A;  4CZW A;  2GHU A;  2HHN A;  4I05 A;  1CQD A;  4B55 A;  1QDQ A;  1NLJ A;  1MS6 A;  3QJ3 A;  1MIR A;  1ZIV A;  3O1G A;  3D6S A;  2P7U A;  1DEU A;  4N79 A;  1W5R A;  2DC8 A;  3P5W A;  2DZZ A;  9PAP A;  2AVW A;  1CPJ A;  4CDC B;  3ZUA A;  1U9X A;  3H7D A;  1ZCM A;  1Y4H A;  1F2C A;  4W5B A;  2NQG A;  2G8J A;  3D9W A;  3RVW A;  1Q6K A;  2P0R A;  4BQV A;  1U5I A;  2PBH A;  3CBK A;  2ACT A;  5JH3 A;  4CDF B;  3IUT A;  2DCA A;  4N8W A;  2ARY A;  2G8E A;  4FIP A;  3PW3 A;  3MTN A;  2VFC A;  3H8B A;  4P6E A;  2F1G A;  2E03 A;  3RVV A;  4YVA A;  1EWP A;  3E1Z B;  3IEJ A;  4GUZ A;  3P5X A;  1QMY A;  3BWK A;  1KFX L;  3B79 A;  1THE A;  4YYR A;  5CVO B;  2Y5B A;  2XU5 A;  1FH0 A;  4G54 A;  2AYN A;  4PAD A;  3P5V A;  3OF8 A;  3QT4 A;  1F2A A;  2CB5 A;  2OP3 A;  4OEM A;  4NV7 A;  1DF0 A;  3HWN A;  4Q8H A;  1GX3 A;  1PIP A;  2CIO A;  4QRX A;  4XR7 A;  3QSD A;  4ZUX U;  1O0E A;  4PP2 E;  1NL6 A;  2FTD A;  1MEM A;  2DC7 A;  3HHA A;  3K9M A;  3KSE A;  1GEC E;  1AYV A;  2YJC A;  2DCC A;  5CHV A;  4QRG A;  1AYU A;  1GMY A;  1GLO A;  1PAD A;  2R9O A;  3KKU A;  3N3G A;  3O0U A;  4BGF A;  2XU3 A;  2VHS A;  7PCK A;  2FRQ A;  4I07 A;  3HHI A;  3PNR A;  2DZY A;  4BPV A;  1GCB A;  5CVN B;  1SP4 B;  1NPZ A;  1CB5 A;  3U8E A;  2B1N A;  1K3B B;  1AIM A;  1PE6 A;  2DC6 A;  3LXS A;  2BDZ A;  4AXM A;  3V6C A;  1AEC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...