1QMYA

Fmdv leader protease (lbshort-c51a-c133s)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
156
structure length
156
Chain Sequence
MELTLYNGEKKTFYSRPNNHDNAWLNAILQLFRYVEEPFFDWVYSSPENLTLEAIKQLEDLTGLELHEGGPPALVIWNIKHLLHTGIGTASRPSEVCVVDGTDMSLADFHAGIFLKGQEHAVFACVTSNGWYAIDDEDFYPWTPDPSDVLVFVPYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEASE
publication title Structure and Biochemical Features Distinguish the Foot-and-Mouth Disease Virus Leader Proteinase from Other Papain-Like Enzymes
pubmed doi rcsb
source organism Aphthovirus o
molecule tags Hydrolase
total genus 40
structure length 156
sequence length 156
chains with identical sequence B, C
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1999-10-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1qmyA00
3H8BA 3NHEA 3I06A 3I3TA 1K3BB 2DZYA 1EWPA 1MEGA 1JQPA 1Y08A 1CS8A 3S3QA 3BOWA 2PNSA 5CVNB 2HHNA 2OZ2A 4CDFB 4Q8HA 2DC8A 2NQAA 2YJBA 3S3RA 1GMYA 2PADA 3QT4A 1ITOA 1ICFA 4MSXA 1MIRA 1IWDA 1AYUA 2YJ8A 4Q8GA 2FYEA 2F7DA 3D6SA 1U9VA 2JQFR 4I05A 4DMXA 1S4VA 4I04A 3RVWA 1CPJA 1U9QX 1MDWA 2O6XA 3P5UA 3CBJA 3PBHA 3HHIA 1NQCA 3CBKA 1KFUL 2DJGB 2NQGA 2B1MA 1PE6A 3USVA 3IEJA 1DEUA 3ZUAA 1CQDA 3P5WA 1VSNA 5JH3A 3LFYA 3KWZA 2AYNA 2DC9A 1U5IA 3PDFA 2FO5A 1CB5A 2CIOA 3N4CA 3IOQA 4X6JA 3BCNA 3U8EA 3WXEA 2ATOA 3V6CA 2OP3A 3IHPA 1O0EA 1ME3A 4BSQA 2DCDA 3PW3A 3H8CA 2P0RA 1U9XA 4MZSA 1CV8A 2R6NA 3BC3A 4AXMA 3O0UA 1AECA 1PIPA 1SP4B 4XUIA 4YYUA 1AYVA 4YYWA 1EWLA 2E00A 2AS8A 2BDZA 2ACTA 4PP2E 1Q6KA 1BY8A 2AUXA 1HUCB 4W5CA 1AU0A 3QSDA 4QRGA 1NB5A 3HHAA 1YT7A 3B79A 1NPZA 1THEA 4BS6A 4X6HA 3MHSA 1AU2A 4QH6A 5K16A 3KKUA 1QOLA 2NQDB 3WXFA 4YV8A 6PADA 3P5XA 1CTEA 4CDDB 3IMAA 1MS6A 5A24A 1KHQA 4W5BA 1A6RA 2G8EA 4QRXA 3HD3A 4DMYA 2HXZA 1F2AA 3OF9A 4XR7A 1ATKA 1PXVA 1KHPA 4KLBA 5PADA 3K24A 3H7DA 1F2CA 2JQGR 2F1GA 3QJ3A 1EWOA 4BPVA 1SNKA 4N8WA 1KFXL 1PADA 3BWKA 2PREA 1MHWA 3OF8A 1YK7A 4YYRA 3MORA 5FPWA 2IBIA 3KSEA 3H6SA 9PAPA 2B1NA 2FRQA 3HWNA 2H7JA 1QDQA 1M6DA 2FUDA 2G8JA 1PBHA 4MZOA 2CB5A 8PCHA 3KX1A 4FIPA 5EGWA 2E03A 1AIMA 2Y6EA 1U9WA 2WBFX 3MTNA 3IUTA 2AVWA 3OISA 2DZZA 2VHFA 3CH3X 4K7CA 1YALA 4QBBA 4YYQA 4CDEB 2PBHA 4WA6A 5JA7A 1XKGA 1MEMA 2DCBA 3KWBX 2BDLA 2XU5A 2XU4A 1YK8A 3V6EA 1PPPA 1KXRA 1F2BA 2E02A 4YVAA 1F29A 2Y5BA 4N4ZA 4X6IA 3AI8A 4W4UA 3RVVA 1ME4A 1QMYA 1ZIVA 2E01A 2R9OA 1QXPA 3KFQA 2R9NA 1VJVA 4AXLA 4QRVA 1YVBA 1AYWA 2P7UA 2FTDA 5CHVA 5F02A 4RY2A 1X9YA 2R9CA 1GECE 4OEMA 3N3GA 1CSBB 3K8UA 2ARYA 2YJ9A 1PPOA 4P6EA 4I07A 3BPFA 2OULA 2AU1A 4OELA 1TLOA 3CH2X 2HH5A 3WXGA 4YYSA 1POPA 2G6DA 7PCKA 1GLOA 4PP1A 1FH0A 2VHSA 1NL6A 5J94A 4BQVA 1Y4HA 2NQIA 3TNXA 1EF7A 3PNRA 2DJFB 5CHTA 3GCBA 1BQIA 2HD5A 1AU3A 3LXSA 3F5VA 5CVMA 3RVXA 1PPNA 4ZUXU 3OVXA 4G54A 3P5VA 4FJCA 1PCIA 1BP4A 4CDCB 2FQ9A 2AUZA 2AIMA 1GCBA 2FT2A 4P6GA 1DF0A 1NLJA 2DCAA 3IV2A 4PI3A 2GFOA 1TU6A 2DCCA 2DC7A 1CVZA 2R9MA 2XU3A 4PADA 5EF4A 3MHHA 1CJLA 3C9EA 2XU1A 3H89A 1STFE 4CZWA 2G7YA 5CVOB 2R9FA 1PPDA 2AYOA 2FRAA 3K9MA 1AU4A 4N79A 2IPPB 4BS5A 3M99A 4HWYA 3ERVA 3O1GA 3F75A 3BPMA 1ZCMA 3DF0A 1TL9A 1NB3A 1BGOA 3OVZA 4FK5A 3E1ZB 3KW9A 2YJCA 3N3KA 2YJ2A 1EWMA 2GHUA 4YYVA 2C0YA 2P86A 2DC6A
chains in the Genus database with same CATH superfamily
3H8BA 3NHEA 3I06A 4RF1A 3I3TA 1K3BB 2DZYA 1EWPA 1MEGA 1JQPA 1Y08A 1CS8A 3S3QA 3BOWA 3TRKA 2PNSA 5CVNB 2HHNA 2OZ2A 4CDFB 4Q8HA 2DC8A 2NQAA 2YJBA 3S3RA 1GMYA 3PRMA 2PADA 3QT4A 1ITOA 1ICFA 4MSXA 1MIRA 1IWDA 1AYUA 2YJ8A 4Q8GA 2FYEA 3BBAA 2F7DA 3D6SA 1U9VA 2JQFR 4I05A 4DMXA 1S4VA 4I04A 3RVWA 1CPJA 1U9QX 1MDWA 2O6XA 1UKFA 3P5UA 3CBJA 3PBHA 3HHIA 1NQCA 3CBKA 1KFUL 4BOQA 2DJGB 2FE8A 2NQGA 2B1MA 1PE6A 3USVA 4D8BA 4BOSA 3IEJA 1DEUA 3ZUAA 1CQDA 3P5WA 1VSNA 5JH3A 3LFYA 3MJ5A 3KWZA 2AYNA 2DC9A 1U5IA 3PDFA 1PVJA 2FO5A 1CB5A 2CIOA 3N4CA 3IOQA 4X6JA 1YZBA 3PT2A 3BCNA 3U8EA 3WXEA 3RNVA 2ATOA 3V6CA 2OP3A 3IHPA 1O0EA 1ME3A 4BSQA 2DCDA 3PW3A 3H8CA 2P0RA 1U9XA 4MZSA 1CV8A 2BTWB 2R6NA 3BC3A 4AXMA 4D8EA 3O0UA 1AECA 1PIPA 1SP4B 4XUIA 4YYUA 1AYVA 5KO3A 4YYWA 1EWLA 2E00A 3E9SA 2AS8A 4OW0A 2BDZA 2ACTA 4PP2E 1Q6KA 1BY8A 2AUXA 1HUCB 4W5CA 4WURA 4R3DA 4BOPA 1AU0A 3QSDA 4QRGA 1NB5A 3HHAA 1YT7A 2JTCA 4MI7A 3B79A 1NPZA 2J7QA 1THEA 4BS6A 4X6HA 3MHSA 4ZTBA 1AU2A 4QH6A 5K16A 3KKUA 1QOLA 2NQDB 3WXFA 4YV8A 3PHWA 6PADA 3IFUA 1CTEA 3P5XA 4CDDB 5E6JA 3IMAA 1MS6A 5A24A 1KHQA 4W5BA 4GUAA 1A6RA 2G8EA 4QRXA 3HD3A 4DMYA 2HXZA 3MP2A 1F2AA 3OF9A 4XR7A 1ATKA 1PXVA 1KHPA 2DOSA 4KLBA 5PADA 3K24A 3H7DA 1F2CA 2JQGR 2F1GA 3ZNHA 3QJ3A 1EWOA 4BPVA 1SNKA 2JRIA 4N8WA 5JZEA 1KFXL 1PADA 3BWKA 2PREA 1MHWA 4HXDB 3OF8A 1YK7A 4YYRA 3MORA 5FPWA 2HWKA 2IBIA 3KSEA 3H6SA 3PHXA 9PAPA 3BB7A 2B1NA 2BTWA 2FRQA 3HWNA 2H7JA 1QDQA 3PSEA 1M6DA 2FUDA 2G8JA 3PHUA 1PBHA 4MZOA 2CB5A 8PCHA 3KX1A 4FIPA 5EGWA 2E03A 1AIMA 2Y6EA 4IUMA 4BOUA 1U9WA 2WBFX 3MTNA 3IUTA 4BOZA 2AVWA 3OISA 2DZZA 2VHFA 3CH3X 4K7CA 1YALA 4QBBA 4YYQA 4CDEB 2PBHA 4RKXA 4WA6A 5JA7A 1XKGA 1MEMA 2DCBA 3KWBX 2BDLA 2XU5A 2XU4A 1YK8A 4D8IA 4A5UA 3V6EA 1PPPA 1KXRA 1F2BA 2E02A 4YVAA 4OVZB 1F29A 2Y5BA 4N4ZA 4X6IA 3AI8A 4W4UA 3RVVA 1ME4A 3C0RA 1QMYA 1ZIVA 2E01A 2R9OA 1QXPA 3KFQA 2R9NA 1VJVA 4AXLA 4QRVA 3W31A 1YVBA 1AYWA 2P7UA 2FTDA 5CHVA 5F02A 4RY2A 4PT5A 1X9YA 4MM3B 2R9CA 1GECE 4OEMA 3N3GA 1CSBB 3K8UA 2ARYA 3W30A 2YJ9A 1PPOA 4P6EA 4I07A 3BPFA 2OULA 2AU1A 4OELA 1TLOA 3CH2X 3TMPA 2HH5A 3WXGA 4YYSA 1POPA 2G6DA 4IP3A 7PCKA 1GLOA 1DKIA 4PP1A 1FH0A 2VHSA 1NL6A 5J94A 4BQVA 1Y4HA 2NQIA 3B21A 1EF7A 3TNXA 3PNRA 2DJFB 5CHTA 3GCBA 1BQIA 2HD5A 1AU3A 3LXSA 3F5VA 2AGAA 5CVMA 3RVXA 4RNAA 1PPNA 4ZUXU 3OVXA 4G54A 3P5VA 3OQCA 4FJCA 2UZJA 1PCIA 1BP4A 4CDCB 3BY4A 2FQ9A 2AUZA 2AIMA 4OVZA 1GCBA 2FT2A 4P6GA 1DF0A 1NLJA 2DCAA 2J7QC 3IV2A 2Z84A 4PI3A 2GFOA 3MTVA 1TU6A 2DCCA 2DC7A 1CVZA 2R9MA 2XU3A 4PADA 5EF4A 4REZA 3MHHA 1CJLA 2BU3A 3C9EA 2XU1A 3H89A 1STFE 4CZWA 2G7YA 5CVOB 2R9FA 4M0WA 1PPDA 2AYOA 2FRAA 3K9MA 1AU4A 4N79A 2IPPB 4BS5A 3M99A 4HWYA 3ERVA 4RF0A 3O1GA 3F75A 3BPMA 1ZCMA 4XZXA 3DF0A 1TL9A 4P16A 1NB3A 3O65A 3PRPA 5EZQA 1BGOA 3OVZA 4FK5A 3E1ZB 3KW9A 2YJCA 3N3KA 2YJ2A 5EZSA 1EWMA 2GHUA 4YYVA 2C0YA 2P86A 2DC6A
chains in the Genus database with same CATH topology
3H8BA 3NHEA 3I06A 3I3TA 1K3BB 2DZYA 1EWPA 1MEGA 1JQPA 1Y08A 1CS8A 3S3QA 3BOWA 2PNSA 5CVNB 2HHNA 2OZ2A 4CDFB 4Q8HA 2DC8A 2NQAA 2YJBA 3S3RA 1GMYA 2PADA 3LTWA 3QT4A 1ITOA 1ICFA 4MSXA 1MIRA 1IWDA 1AYUA 2YJ8A 4Q8GA 2FYEA 2F7DA 3D6SA 1U9VA 2JQFR 4I05A 4DMXA 1S4VA 4I04A 3RVWA 1CPJA 1U9QX 1MDWA 2O6XA 3P5UA 3CBJA 3PBHA 3HHIA 1NQCA 3CBKA 1KFUL 2DJGB 2NQGA 2B1MA 1PE6A 3USVA 3IEJA 1DEUA 3ZUAA 1CQDA 3P5WA 1VSNA 1W6FA 5JH3A 3LFYA 3KWZA 2AYNA 2DC9A 1U5IA 3PDFA 2FO5A 1CB5A 2CIOA 3N4CA 3IOQA 4X6JA 3BCNA 3U8EA 3WXEA 2ATOA 3V6CA 2OP3A 3IHPA 1O0EA 1ME3A 4BSQA 2DCDA 3PW3A 3H8CA 2P0RA 1U9XA 4MZSA 1CV8A 2R6NA 3BC3A 2VFBA 4AXMA 3O0UA 1AECA 1PIPA 1SP4B 4XUIA 4YYUA 1AYVA 4YYWA 1EWLA 2E00A 2AS8A 4NV8A 2BDZA 2ACTA 4PP2E 1Q6KA 1BY8A 2AUXA 1HUCB 4W5CA 1AU0A 3QSDA 4QRGA 1NB5A 3HHAA 1YT7A 3B79A 1NPZA 1THEA 4BS6A 4X6HA 3MHSA 1AU2A 4QH6A 5K16A 3KKUA 1QOLA 2NQDB 3WXFA 4YV8A 3D9WA 6PADA 3P5XA 1CTEA 4CDDB 3IMAA 1MS6A 5A24A 1KHQA 4W5BA 1A6RA 2G8EA 4QRXA 3HD3A 4DMYA 2HXZA 1F2AA 3OF9A 4XR7A 1ATKA 1PXVA 1KHPA 4KLBA 5PADA 3K24A 3H7DA 1F2CA 2JQGR 2F1GA 3QJ3A 1EWOA 4BPVA 1SNKA 4N8WA 1KFXL 1PADA 4GUZA 3BWKA 2PREA 1MHWA 3OF8A 1YK7A 4YYRA 3MORA 5FPWA 2IBIA 4B55A 3KSEA 3H6SA 9PAPA 2B1NA 2FRQA 3HWNA 2H7JA 1QDQA 1M6DA 2FUDA 2G8JA 1PBHA 4MZOA 2CB5A 8PCHA 3KX1A 4FIPA 5EGWA 2E03A 1AIMA 2Y6EA 1U9WA 2WBFX 3MTNA 3IUTA 2AVWA 3OISA 1GX3A 2DZZA 2VHFA 3CH3X 4K7CA 1YALA 4QBBA 4YYQA 4CDEB 2PBHA 4WA6A 5JA7A 1XKGA 1MEMA 2DCBA 3KWBX 2BDLA 2XU5A 2XU4A 1YK8A 3V6EA 1PPPA 1KXRA 1F2BA 2E02A 4YVAA 1F29A 2Y5BA 4N4ZA 4X6IA 3AI8A 4W4UA 3RVVA 1ME4A 1QMYA 1ZIVA 2E01A 2R9OA 1QXPA 3KFQA 2R9NA 1VJVA 2BSZA 4AXLA 4QRVA 1YVBA 1AYWA 2P7UA 2FTDA 5CHVA 5F02A 4RY2A 1W4TA 1X9YA 2R9CA 1GECE 4OEMA 3N3GA 4NV7A 1CSBB 3K8UA 2ARYA 2YJ9A 1PPOA 4P6EA 4I07A 3BPFA 2OULA 2AU1A 4OELA 1TLOA 3CH2X 2HH5A 3WXGA 4YYSA 1POPA 2G6DA 2VFCA 7PCKA 1GLOA 4PP1A 1FH0A 2VHSA 1NL6A 5J94A 4BQVA 1Y4HA 2NQIA 3TNXA 1EF7A 3PNRA 2DJFB 5CHTA 3GCBA 1BQIA 2HD5A 1AU3A 3LXSA 3F5VA 5CVMA 3RVXA 1PPNA 4ZUXU 3OVXA 4G54A 3P5VA 4FJCA 1PCIA 1BP4A 4CDCB 2FQ9A 2AUZA 2AIMA 1GCBA 2FT2A 4P6GA 1DF0A 1NLJA 2DCAA 3IV2A 4PI3A 2GFOA 1TU6A 2DCCA 2DC7A 4C5PA 1CVZA 2R9MA 2XU3A 4PADA 5EF4A 3MHHA 1CJLA 3C9EA 2XU1A 3H89A 1STFE 4CZWA 2G7YA 5CVOB 2R9FA 1PPDA 2AYOA 2FRAA 3K9MA 1AU4A 4N79A 2IPPB 4BS5A 3M99A 4HWYA 3ERVA 3O1GA 1E2TA 3F75A 3BPMA 1ZCMA 3DF0A 1TL9A 4BGFA 1NB3A 1BGOA 3OVZA 4FK5A 1W5RA 3E1ZB 3KW9A 2YJCA 3N3KA 2YJ2A 1EWMA 2GHUA 4YYVA 2C0YA 2P86A 2DC6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H8B A;  3NHE A;  3I06 A;  3I3T A;  1K3B B;  2DZY A;  1EWP A;  1MEG A;  1JQP A;  1Y08 A;  1CS8 A;  3S3Q A;  3BOW A;  2PNS A;  5CVN B;  2HHN A;  2OZ2 A;  4CDF B;  4Q8H A;  2DC8 A;  2NQA A;  2YJB A;  3S3R A;  1GMY A;  2PAD A;  3QT4 A;  1ITO A;  1ICF A;  4MSX A;  1MIR A;  1IWD A;  1AYU A;  2YJ8 A;  4Q8G A;  2FYE A;  2F7D A;  3D6S A;  1U9V A;  2JQF R;  4I05 A;  4DMX A;  1S4V A;  4I04 A;  3RVW A;  1CPJ A;  1U9Q X;  1MDW A;  2O6X A;  3P5U A;  3CBJ A;  3PBH A;  3HHI A;  1NQC A;  3CBK A;  1KFU L;  2DJG B;  2NQG A;  2B1M A;  1PE6 A;  3USV A;  3IEJ A;  1DEU A;  3ZUA A;  1CQD A;  3P5W A;  1VSN A;  5JH3 A;  3LFY A;  3KWZ A;  2AYN A;  2DC9 A;  1U5I A;  3PDF A;  2FO5 A;  1CB5 A;  2CIO A;  3N4C A;  3IOQ A;  4X6J A;  3BCN A;  3U8E A;  3WXE A;  2ATO A;  3V6C A;  2OP3 A;  3IHP A;  1O0E A;  1ME3 A;  4BSQ A;  2DCD A;  3PW3 A;  3H8C A;  2P0R A;  1U9X A;  4MZS A;  1CV8 A;  2R6N A;  3BC3 A;  4AXM A;  3O0U A;  1AEC A;  1PIP A;  1SP4 B;  4XUI A;  4YYU A;  1AYV A;  4YYW A;  1EWL A;  2E00 A;  2AS8 A;  2BDZ A;  2ACT A;  4PP2 E;  1Q6K A;  1BY8 A;  2AUX A;  1HUC B;  4W5C A;  1AU0 A;  3QSD A;  4QRG A;  1NB5 A;  3HHA A;  1YT7 A;  3B79 A;  1NPZ A;  1THE A;  4BS6 A;  4X6H A;  3MHS A;  1AU2 A;  4QH6 A;  5K16 A;  3KKU A;  1QOL A;  2NQD B;  3WXF A;  4YV8 A;  6PAD A;  3P5X A;  1CTE A;  4CDD B;  3IMA A;  1MS6 A;  5A24 A;  1KHQ A;  4W5B A;  1A6R A;  2G8E A;  4QRX A;  3HD3 A;  4DMY A;  2HXZ A;  1F2A A;  3OF9 A;  4XR7 A;  1ATK A;  1PXV A;  1KHP A;  4KLB A;  5PAD A;  3K24 A;  3H7D A;  1F2C A;  2JQG R;  2F1G A;  3QJ3 A;  1EWO A;  4BPV A;  1SNK A;  4N8W A;  1KFX L;  1PAD A;  3BWK A;  2PRE A;  1MHW A;  3OF8 A;  1YK7 A;  4YYR A;  3MOR A;  5FPW A;  2IBI A;  3KSE A;  3H6S A;  9PAP A;  2B1N A;  2FRQ A;  3HWN A;  2H7J A;  1QDQ A;  1M6D A;  2FUD A;  2G8J A;  1PBH A;  4MZO A;  2CB5 A;  8PCH A;  3KX1 A;  4FIP A;  5EGW A;  2E03 A;  1AIM A;  2Y6E A;  1U9W A;  2WBF X;  3MTN A;  3IUT A;  2AVW A;  3OIS A;  2DZZ A;  2VHF A;  3CH3 X;  4K7C A;  1YAL A;  4QBB A;  4YYQ A;  4CDE B;  2PBH A;  4WA6 A;  5JA7 A;  1XKG A;  1MEM A;  2DCB A;  3KWB X;  2BDL A;  2XU5 A;  2XU4 A;  1YK8 A;  3V6E A;  1PPP A;  1KXR A;  1F2B A;  2E02 A;  4YVA A;  1F29 A;  2Y5B A;  4N4Z A;  4X6I A;  3AI8 A;  4W4U A;  3RVV A;  1ME4 A;  1QMY A;  1ZIV A;  2E01 A;  2R9O A;  1QXP A;  3KFQ A;  2R9N A;  1VJV A;  4AXL A;  4QRV A;  1YVB A;  1AYW A;  2P7U A;  2FTD A;  5CHV A;  5F02 A;  4RY2 A;  1X9Y A;  2R9C A;  1GEC E;  4OEM A;  3N3G A;  1CSB B;  3K8U A;  2ARY A;  2YJ9 A;  1PPO A;  4P6E A;  4I07 A;  3BPF A;  2OUL A;  2AU1 A;  4OEL A;  1TLO A;  3CH2 X;  2HH5 A;  3WXG A;  4YYS A;  1POP A;  2G6D A;  7PCK A;  1GLO A;  4PP1 A;  1FH0 A;  2VHS A;  1NL6 A;  5J94 A;  4BQV A;  1Y4H A;  2NQI A;  3TNX A;  1EF7 A;  3PNR A;  2DJF B;  5CHT A;  3GCB A;  1BQI A;  2HD5 A;  1AU3 A;  3LXS A;  3F5V A;  5CVM A;  3RVX A;  1PPN A;  4ZUX U;  3OVX A;  4G54 A;  3P5V A;  4FJC A;  1PCI A;  1BP4 A;  4CDC B;  2FQ9 A;  2AUZ A;  2AIM A;  1GCB A;  2FT2 A;  4P6G A;  1DF0 A;  1NLJ A;  2DCA A;  3IV2 A;  4PI3 A;  2GFO A;  1TU6 A;  2DCC A;  2DC7 A;  1CVZ A;  2R9M A;  2XU3 A;  4PAD A;  5EF4 A;  3MHH A;  1CJL A;  3C9E A;  2XU1 A;  3H89 A;  1STF E;  4CZW A;  2G7Y A;  5CVO B;  2R9F A;  1PPD A;  2AYO A;  2FRA A;  3K9M A;  1AU4 A;  4N79 A;  2IPP B;  4BS5 A;  3M99 A;  4HWY A;  3ERV A;  3O1G A;  3F75 A;  3BPM A;  1ZCM A;  3DF0 A;  1TL9 A;  1NB3 A;  1BGO A;  3OVZ A;  4FK5 A;  3E1Z B;  3KW9 A;  2YJC A;  3N3K A;  2YJ2 A;  1EWM A;  2GHU A;  4YYV A;  2C0Y A;  2P86 A;  2DC6 A; 
#chains in the Genus database with same CATH topology
 3H8B A;  3NHE A;  3I06 A;  4RF1 A;  3I3T A;  1K3B B;  2DZY A;  1EWP A;  1MEG A;  1JQP A;  1Y08 A;  1CS8 A;  3S3Q A;  3BOW A;  3TRK A;  2PNS A;  5CVN B;  2HHN A;  2OZ2 A;  4CDF B;  4Q8H A;  2DC8 A;  2NQA A;  2YJB A;  3S3R A;  1GMY A;  3PRM A;  2PAD A;  3QT4 A;  1ITO A;  1ICF A;  4MSX A;  1MIR A;  1IWD A;  1AYU A;  2YJ8 A;  4Q8G A;  2FYE A;  3BBA A;  2F7D A;  3D6S A;  1U9V A;  2JQF R;  4I05 A;  4DMX A;  1S4V A;  4I04 A;  3RVW A;  1CPJ A;  1U9Q X;  1MDW A;  2O6X A;  1UKF A;  3P5U A;  3CBJ A;  3PBH A;  3HHI A;  1NQC A;  3CBK A;  1KFU L;  4BOQ A;  2DJG B;  2FE8 A;  2NQG A;  2B1M A;  1PE6 A;  3USV A;  4D8B A;  4BOS A;  3IEJ A;  1DEU A;  3ZUA A;  1CQD A;  3P5W A;  1VSN A;  5JH3 A;  3LFY A;  3MJ5 A;  3KWZ A;  2AYN A;  2DC9 A;  1U5I A;  3PDF A;  1PVJ A;  2FO5 A;  1CB5 A;  2CIO A;  3N4C A;  3IOQ A;  4X6J A;  1YZB A;  3PT2 A;  3BCN A;  3U8E A;  3WXE A;  3RNV A;  2ATO A;  3V6C A;  2OP3 A;  3IHP A;  1O0E A;  1ME3 A;  4BSQ A;  2DCD A;  3PW3 A;  3H8C A;  2P0R A;  1U9X A;  4MZS A;  1CV8 A;  2BTW B;  2R6N A;  3BC3 A;  4AXM A;  4D8E A;  3O0U A;  1AEC A;  1PIP A;  1SP4 B;  4XUI A;  4YYU A;  1AYV A;  5KO3 A;  4YYW A;  1EWL A;  2E00 A;  3E9S A;  2AS8 A;  4OW0 A;  2BDZ A;  2ACT A;  4PP2 E;  1Q6K A;  1BY8 A;  2AUX A;  1HUC B;  4W5C A;  4WUR A;  4R3D A;  4BOP A;  1AU0 A;  3QSD A;  4QRG A;  1NB5 A;  3HHA A;  1YT7 A;  2JTC A;  4MI7 A;  3B79 A;  1NPZ A;  2J7Q A;  1THE A;  4BS6 A;  4X6H A;  3MHS A;  4ZTB A;  1AU2 A;  4QH6 A;  5K16 A;  3KKU A;  1QOL A;  2NQD B;  3WXF A;  4YV8 A;  3PHW A;  6PAD A;  3IFU A;  1CTE A;  3P5X A;  4CDD B;  5E6J A;  3IMA A;  1MS6 A;  5A24 A;  1KHQ A;  4W5B A;  4GUA A;  1A6R A;  2G8E A;  4QRX A;  3HD3 A;  4DMY A;  2HXZ A;  3MP2 A;  1F2A A;  3OF9 A;  4XR7 A;  1ATK A;  1PXV A;  1KHP A;  2DOS A;  4KLB A;  5PAD A;  3K24 A;  3H7D A;  1F2C A;  2JQG R;  2F1G A;  3ZNH A;  3QJ3 A;  1EWO A;  4BPV A;  1SNK A;  2JRI A;  4N8W A;  5JZE A;  1KFX L;  1PAD A;  3BWK A;  2PRE A;  1MHW A;  4HXD B;  3OF8 A;  1YK7 A;  4YYR A;  3MOR A;  5FPW A;  2HWK A;  2IBI A;  3KSE A;  3H6S A;  3PHX A;  9PAP A;  3BB7 A;  2B1N A;  2BTW A;  2FRQ A;  3HWN A;  2H7J A;  1QDQ A;  3PSE A;  1M6D A;  2FUD A;  2G8J A;  3PHU A;  1PBH A;  4MZO A;  2CB5 A;  8PCH A;  3KX1 A;  4FIP A;  5EGW A;  2E03 A;  1AIM A;  2Y6E A;  4IUM A;  4BOU A;  1U9W A;  2WBF X;  3MTN A;  3IUT A;  4BOZ A;  2AVW A;  3OIS A;  2DZZ A;  2VHF A;  3CH3 X;  4K7C A;  1YAL A;  4QBB A;  4YYQ A;  4CDE B;  2PBH A;  4RKX A;  4WA6 A;  5JA7 A;  1XKG A;  1MEM A;  2DCB A;  3KWB X;  2BDL A;  2XU5 A;  2XU4 A;  1YK8 A;  4D8I A;  4A5U A;  3V6E A;  1PPP A;  1KXR A;  1F2B A;  2E02 A;  4YVA A;  4OVZ B;  1F29 A;  2Y5B A;  4N4Z A;  4X6I A;  3AI8 A;  4W4U A;  3RVV A;  1ME4 A;  3C0R A;  1QMY A;  1ZIV A;  2E01 A;  2R9O A;  1QXP A;  3KFQ A;  2R9N A;  1VJV A;  4AXL A;  4QRV A;  3W31 A;  1YVB A;  1AYW A;  2P7U A;  2FTD A;  5CHV A;  5F02 A;  4RY2 A;  4PT5 A;  1X9Y A;  4MM3 B;  2R9C A;  1GEC E;  4OEM A;  3N3G A;  1CSB B;  3K8U A;  2ARY A;  3W30 A;  2YJ9 A;  1PPO A;  4P6E A;  4I07 A;  3BPF A;  2OUL A;  2AU1 A;  4OEL A;  1TLO A;  3CH2 X;  3TMP A;  2HH5 A;  3WXG A;  4YYS A;  1POP A;  2G6D A;  4IP3 A;  7PCK A;  1GLO A;  1DKI A;  4PP1 A;  1FH0 A;  2VHS A;  1NL6 A;  5J94 A;  4BQV A;  1Y4H A;  2NQI A;  3B21 A;  1EF7 A;  3TNX A;  3PNR A;  2DJF B;  5CHT A;  3GCB A;  1BQI A;  2HD5 A;  1AU3 A;  3LXS A;  3F5V A;  2AGA A;  5CVM A;  3RVX A;  4RNA A;  1PPN A;  4ZUX U;  3OVX A;  4G54 A;  3P5V A;  3OQC A;  4FJC A;  2UZJ A;  1PCI A;  1BP4 A;  4CDC B;  3BY4 A;  2FQ9 A;  2AUZ A;  2AIM A;  4OVZ A;  1GCB A;  2FT2 A;  4P6G A;  1DF0 A;  1NLJ A;  2DCA A;  2J7Q C;  3IV2 A;  2Z84 A;  4PI3 A;  2GFO A;  3MTV A;  1TU6 A;  2DCC A;  2DC7 A;  1CVZ A;  2R9M A;  2XU3 A;  4PAD A;  5EF4 A;  4REZ A;  3MHH A;  1CJL A;  2BU3 A;  3C9E A;  2XU1 A;  3H89 A;  1STF E;  4CZW A;  2G7Y A;  5CVO B;  2R9F A;  4M0W A;  1PPD A;  2AYO A;  2FRA A;  3K9M A;  1AU4 A;  4N79 A;  2IPP B;  4BS5 A;  3M99 A;  4HWY A;  3ERV A;  4RF0 A;  3O1G A;  3F75 A;  3BPM A;  1ZCM A;  4XZX A;  3DF0 A;  1TL9 A;  4P16 A;  1NB3 A;  3O65 A;  3PRP A;  5EZQ A;  1BGO A;  3OVZ A;  4FK5 A;  3E1Z B;  3KW9 A;  2YJC A;  3N3K A;  2YJ2 A;  5EZS A;  1EWM A;  2GHU A;  4YYV A;  2C0Y A;  2P86 A;  2DC6 A; 
#chains in the Genus database with same CATH homology
 3H8B A;  3NHE A;  3I06 A;  3I3T A;  1K3B B;  2DZY A;  1EWP A;  1MEG A;  1JQP A;  1Y08 A;  1CS8 A;  3S3Q A;  3BOW A;  2PNS A;  5CVN B;  2HHN A;  2OZ2 A;  4CDF B;  4Q8H A;  2DC8 A;  2NQA A;  2YJB A;  3S3R A;  1GMY A;  2PAD A;  3LTW A;  3QT4 A;  1ITO A;  1ICF A;  4MSX A;  1MIR A;  1IWD A;  1AYU A;  2YJ8 A;  4Q8G A;  2FYE A;  2F7D A;  3D6S A;  1U9V A;  2JQF R;  4I05 A;  4DMX A;  1S4V A;  4I04 A;  3RVW A;  1CPJ A;  1U9Q X;  1MDW A;  2O6X A;  3P5U A;  3CBJ A;  3PBH A;  3HHI A;  1NQC A;  3CBK A;  1KFU L;  2DJG B;  2NQG A;  2B1M A;  1PE6 A;  3USV A;  3IEJ A;  1DEU A;  3ZUA A;  1CQD A;  3P5W A;  1VSN A;  1W6F A;  5JH3 A;  3LFY A;  3KWZ A;  2AYN A;  2DC9 A;  1U5I A;  3PDF A;  2FO5 A;  1CB5 A;  2CIO A;  3N4C A;  3IOQ A;  4X6J A;  3BCN A;  3U8E A;  3WXE A;  2ATO A;  3V6C A;  2OP3 A;  3IHP A;  1O0E A;  1ME3 A;  4BSQ A;  2DCD A;  3PW3 A;  3H8C A;  2P0R A;  1U9X A;  4MZS A;  1CV8 A;  2R6N A;  3BC3 A;  2VFB A;  4AXM A;  3O0U A;  1AEC A;  1PIP A;  1SP4 B;  4XUI A;  4YYU A;  1AYV A;  4YYW A;  1EWL A;  2E00 A;  2AS8 A;  4NV8 A;  2BDZ A;  2ACT A;  4PP2 E;  1Q6K A;  1BY8 A;  2AUX A;  1HUC B;  4W5C A;  1AU0 A;  3QSD A;  4QRG A;  1NB5 A;  3HHA A;  1YT7 A;  3B79 A;  1NPZ A;  1THE A;  4BS6 A;  4X6H A;  3MHS A;  1AU2 A;  4QH6 A;  5K16 A;  3KKU A;  1QOL A;  2NQD B;  3WXF A;  4YV8 A;  3D9W A;  6PAD A;  3P5X A;  1CTE A;  4CDD B;  3IMA A;  1MS6 A;  5A24 A;  1KHQ A;  4W5B A;  1A6R A;  2G8E A;  4QRX A;  3HD3 A;  4DMY A;  2HXZ A;  1F2A A;  3OF9 A;  4XR7 A;  1ATK A;  1PXV A;  1KHP A;  4KLB A;  5PAD A;  3K24 A;  3H7D A;  1F2C A;  2JQG R;  2F1G A;  3QJ3 A;  1EWO A;  4BPV A;  1SNK A;  4N8W A;  1KFX L;  1PAD A;  4GUZ A;  3BWK A;  2PRE A;  1MHW A;  3OF8 A;  1YK7 A;  4YYR A;  3MOR A;  5FPW A;  2IBI A;  4B55 A;  3KSE A;  3H6S A;  9PAP A;  2B1N A;  2FRQ A;  3HWN A;  2H7J A;  1QDQ A;  1M6D A;  2FUD A;  2G8J A;  1PBH A;  4MZO A;  2CB5 A;  8PCH A;  3KX1 A;  4FIP A;  5EGW A;  2E03 A;  1AIM A;  2Y6E A;  1U9W A;  2WBF X;  3MTN A;  3IUT A;  2AVW A;  3OIS A;  1GX3 A;  2DZZ A;  2VHF A;  3CH3 X;  4K7C A;  1YAL A;  4QBB A;  4YYQ A;  4CDE B;  2PBH A;  4WA6 A;  5JA7 A;  1XKG A;  1MEM A;  2DCB A;  3KWB X;  2BDL A;  2XU5 A;  2XU4 A;  1YK8 A;  3V6E A;  1PPP A;  1KXR A;  1F2B A;  2E02 A;  4YVA A;  1F29 A;  2Y5B A;  4N4Z A;  4X6I A;  3AI8 A;  4W4U A;  3RVV A;  1ME4 A;  1QMY A;  1ZIV A;  2E01 A;  2R9O A;  1QXP A;  3KFQ A;  2R9N A;  1VJV A;  2BSZ A;  4AXL A;  4QRV A;  1YVB A;  1AYW A;  2P7U A;  2FTD A;  5CHV A;  5F02 A;  4RY2 A;  1W4T A;  1X9Y A;  2R9C A;  1GEC E;  4OEM A;  3N3G A;  4NV7 A;  1CSB B;  3K8U A;  2ARY A;  2YJ9 A;  1PPO A;  4P6E A;  4I07 A;  3BPF A;  2OUL A;  2AU1 A;  4OEL A;  1TLO A;  3CH2 X;  2HH5 A;  3WXG A;  4YYS A;  1POP A;  2G6D A;  2VFC A;  7PCK A;  1GLO A;  4PP1 A;  1FH0 A;  2VHS A;  1NL6 A;  5J94 A;  4BQV A;  1Y4H A;  2NQI A;  3TNX A;  1EF7 A;  3PNR A;  2DJF B;  5CHT A;  3GCB A;  1BQI A;  2HD5 A;  1AU3 A;  3LXS A;  3F5V A;  5CVM A;  3RVX A;  1PPN A;  4ZUX U;  3OVX A;  4G54 A;  3P5V A;  4FJC A;  1PCI A;  1BP4 A;  4CDC B;  2FQ9 A;  2AUZ A;  2AIM A;  1GCB A;  2FT2 A;  4P6G A;  1DF0 A;  1NLJ A;  2DCA A;  3IV2 A;  4PI3 A;  2GFO A;  1TU6 A;  2DCC A;  2DC7 A;  4C5P A;  1CVZ A;  2R9M A;  2XU3 A;  4PAD A;  5EF4 A;  3MHH A;  1CJL A;  3C9E A;  2XU1 A;  3H89 A;  1STF E;  4CZW A;  2G7Y A;  5CVO B;  2R9F A;  1PPD A;  2AYO A;  2FRA A;  3K9M A;  1AU4 A;  4N79 A;  2IPP B;  4BS5 A;  3M99 A;  4HWY A;  3ERV A;  3O1G A;  1E2T A;  3F75 A;  3BPM A;  1ZCM A;  3DF0 A;  1TL9 A;  4BGF A;  1NB3 A;  1BGO A;  3OVZ A;  4FK5 A;  1W5R A;  3E1Z B;  3KW9 A;  2YJC A;  3N3K A;  2YJ2 A;  1EWM A;  2GHU A;  4YYV A;  2C0Y A;  2P86 A;  2DC6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...