3PSEA

Structure of a viral otu domain protease bound to interferon-stimulated gene 15 (isg15)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
164
structure length
164
Chain Sequence
GPMDFLRSLDWTQVIAGQYVSNPRFNISDYFEIVRQPGDGNCFYHSIAELTMPNKTDHSYHYIKRLTESAARKYYQEEPEARLVGLSLEDYLKRMLSDNEWGSTLEASMLAKEMGITIIIWTVAASDEVEAGIKFGDGDVFTAVNLLHSGQTHFDALRILPQFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the removal of ubiquitin and interferon-stimulated gene 15 by a viral ovarian tumor domain-containing protease.
pubmed doi rcsb
source organism Crimean-congo hemorrhagic fever virus
molecule tags Hydrolase/protein binding
molecule keywords RNA polymerase
total genus 48
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2010-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.80 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3pseA00
4BOZA 3ZNHA 3BY4A 4BOUA 5JZEA 3PHXA 3PHWA 4BOSA 4BOPA 3TMPA 3C0RA 3PT2A 3PHUA 3PRPA 3PRMA 4BOQA 4HXDB 3PSEA
chains in the Genus database with same CATH superfamily
3WXEA 1GCBA 1THEA 3F5VA 4RF1A 2DCAA 3AI8A 1YALA 4YYRA 2DC7A 3K8UA 1DEUA 1YK8A 3PT2A 3QJ3A 1MEMA 1YZBA 2PADA 1BQIA 3H7DA 1NQCA 5EF4A 5CHTA 3H8CA 2AYOA 1EWMA 2Z84A 2YJ2A 1QXPA 3D6SA 4PADA 1JQPA 4W5CA 3K24A 4CZWA 3BC3A 1PPPA 3BWKA 3RVXA 3MHHA 4Q8GA 4HXDB 2CIOA 2F1GA 1M6DA 3RVVA 4GUAA 5CVNB 2PREA 3PBHA 1PIPA 4IUMA 1VSNA 2FUDA 5EZQA 1KXRA 4HWYA 2DOSA 3IFUA 4ZUXU 4R3DA 1CVZA 2NQDB 1KHQA 2AUXA 3PDFA 1NPZA 2G8JA 4FK5A 3BCNA 2WBFX 3MTNA 1QDQA 3W30A 4P6GA 3IUTA 1U5IA 2PBHA 4W5BA 1CJLA 3B79A 1MHWA 1POPA 1NB3A 1UKFA 3CH3X 2HHNA 5FPWA 2BU3A 1Y4HA 3CBKA 4BS5A 2JQFR 4OEMA 3IOQA 4N79A 5CVMA 1NB5A 2R9NA 2R6NA 1TL9A 4DMXA 1EWPA 1BGOA 3O1GA 5J94A 3IV2A 2OP3A 2G6DA 4QH6A 2E00A 1ME4A 2XU4A 1HUCB 1EF7A 4W4UA 2DZZA 2AUZA 2G8EA 1O0EA 2IBIA 2Y5BA 4RNAA 4Q8HA 3OVZA 3BBAA 3OQCA 1AU0A 4QBBA 3P5VA 1YT7A 1BY8A 1MS6A 6PADA 3HHAA 2JRIA 1AU4A 1BP4A 2DJFB 4REZA 3BPMA 3LXSA 4IP3A 3P5XA 1GECE 1YK7A 5A24A 1U9QX 1ME3A 5JA7A 2IPPB 4YVAA 3ZNHA 4RY2A 1DKIA 4DMYA 3TMPA 3I3TA 3V6EA 5KO3A 1U9XA 2R9OA 2DZYA 3ZUAA 4FJCA 1CB5A 4YV8A 2GFOA 2ATOA 2XU5A 2YJ9A 3OF9A 4WURA 4BSQA 4OVZB 1ITOA 1AYVA 3K9MA 2Y6EA 5PADA 2XU3A 5JZEA 1AIMA 1CTEA 4YYQA 4BS6A 2PNSA 2FT2A 1DF0A 5K16A 3N3GA 4K7CA 1PBHA 3I06A 4QRVA 1F29A 2XU1A 2FYEA 4OW0A 4OELA 2VHSA 2DC9A 2H7JA 4X6IA 2OZ2A 3H8BA 1Q6KA 1TLOA 4N8WA 4D8IA 4YYWA 3HWNA 3PHXA 4BOSA 3PHUA 4D8EA 1STFE 3HHIA 2FRAA 3KW9A 4X6HA 1S4VA 1X9YA 5F02A 3PW3A 3IHPA 1GLOA 1ZCMA 4CDDB 2FQ9A 1F2CA 2FTDA 2HXZA 4I05A 4QRXA 2R9FA 1AYUA 2FE8A 2BTWB 1PADA 4BOQA 3B21A 4I07A 4BPVA 2ACTA 7PCKA 3HD3A 3P5WA 3TNXA 2ARYA 3U8EA 1MDWA 2NQIA 4XZXA 5EZSA 3E9SA 4PT5A 4G54A 4AXMA 2R9MA 2GHUA 2UZJA 3PNRA 1U9WA 1F2BA 2JTCA 2E02A 4XR7A 1MEGA 1PE6A 3IMAA 1PPOA 2FRQA 1GMYA 3GCBA 3MORA 3V6CA 1AECA 1KFXL 2HH5A 4RF0A 1MIRA 4KLBA 3CBJA 2VHFA 4P6EA 1SNKA 3CH2X 3OVXA 3PSEA 4A5UA 1QOLA 1SP4B 1PCIA 1KHPA 1PVJA 3H6SA 2DCCA 3NHEA 3S3QA 2AS8A 3OF8A 3MTVA 2NQAA 5EGWA 3BPFA 3C0RA 3WXGA 2P86A 3H89A 2YJ8A 1VJVA 3KKUA 3KFQA 3PRPA 3N4CA 2YJCA 1A6RA 3KWZA 1PXVA 3DF0A 1TU6A 2BTWA 2B1NA 2R9CA 2J7QC 3MJ5A 1ICFA 1F2AA 2AVWA 3OISA 2DC6A 1PPDA 4QRGA 1AYWA 2NQGA 4YYUA 3MP2A 3PRMA 3S3RA 2AU1A 3PHWA 4MZOA 1EWLA 1YVBA 2AYNA 4YYSA 3QT4A 3KSEA 4BOPA 4D8BA 1FH0A 3BOWA 2B1MA 3RNVA 1NLJA 2OULA 3LFYA 1IWDA 1ATKA 2P7UA 4N4ZA 1NL6A 1KFUL 1CQDA 3F75A 3USVA 1AU2A 4BOUA 4PP2E 3KWBX 3WXFA 1U9VA 2HD5A 3ERVA 2YJBA 2JQGR 1CV8A 4ZTBA 3RVWA 1EWOA 3TRKA 8PCHA 4I04A 4PP1A 2AIMA 2DJGB 1QMYA 4OVZA 3M99A 1PPNA 4CDFB 1Y08A 4XUIA 4PI3A 5CHVA 5JH3A 3BB7A 3O65A 3N3KA 2DCDA 4BOZA 4AXLA 5CVOB 4M0WA 2AGAA 3IEJA 2F7DA 2J7QA 1AU3A 4CDCB 3O0UA 3W31A 2HWKA 2DC8A 4MM3B 1ZIVA 3C9EA 5E6JA 4MI7A 2CB5A 4FIPA 4BQVA 3BY4A 1K3BB 1CSBB 2BDZA 2E01A 2G7YA 2FO5A 4P16A 3MHSA 4MSXA 3P5UA 2DCBA 2P0RA 3KX1A 4RKXA 1CPJA 4MZSA 4X6JA 2O6XA 2E03A 3QSDA 9PAPA 1CS8A 4WA6A 4YYVA 1XKGA 2BDLA 2C0YA 3E1ZB 4CDEB
chains in the Genus database with same CATH topology
4R3DA 1PVJA 4D8BA 3TRKA 3ZNHA 4D8IA 2J7QA 1DKIA 4BOQA 3PHXA 4BOSA 4RNAA 4RF1A 3TMPA 3RNVA 5KO3A 2BU3A 3W31A 3BBAA 3PHUA 3OQCA 4D8EA 2BTWA 2HWKA 3MTVA 4MM3B 4RKXA 2J7QC 3MJ5A 4OVZA 4RF0A 3C0RA 3PT2A 4XZXA 4HXDB 4OW0A 4MI7A 5E6JA 2JRIA 4GUAA 5EZSA 4REZA 3W30A 4BOUA 3BB7A 4WURA 3E9SA 1YZBA 3O65A 4OVZB 3MP2A 3PSEA 3PRPA 3PRMA 4IP3A 4PT5A 4A5UA 2UZJA 4BOZA 2FE8A 3BY4A 5JZEA 2BTWB 3PHWA 4IUMA 4M0WA 4BOPA 2AGAA 4ZTBA 5EZQA 2JTCA 2DOSA 2Z84A 3IFUA 1UKFA 3B21A 4P16A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BOZ A;  3ZNH A;  3BY4 A;  4BOU A;  5JZE A;  3PHX A;  3PHW A;  4BOS A;  4BOP A;  3TMP A;  3C0R A;  3PT2 A;  3PHU A;  3PRP A;  3PRM A;  4BOQ A;  4HXD B;  3PSE A; 
#chains in the Genus database with same CATH topology
 3WXE A;  1GCB A;  1THE A;  3F5V A;  4RF1 A;  2DCA A;  3AI8 A;  1YAL A;  4YYR A;  2DC7 A;  3K8U A;  1DEU A;  1YK8 A;  3PT2 A;  3QJ3 A;  1MEM A;  1YZB A;  2PAD A;  1BQI A;  3H7D A;  1NQC A;  5EF4 A;  5CHT A;  3H8C A;  2AYO A;  1EWM A;  2Z84 A;  2YJ2 A;  1QXP A;  3D6S A;  4PAD A;  1JQP A;  4W5C A;  3K24 A;  4CZW A;  3BC3 A;  1PPP A;  3BWK A;  3RVX A;  3MHH A;  4Q8G A;  4HXD B;  2CIO A;  2F1G A;  1M6D A;  3RVV A;  4GUA A;  5CVN B;  2PRE A;  3PBH A;  1PIP A;  4IUM A;  1VSN A;  2FUD A;  5EZQ A;  1KXR A;  4HWY A;  2DOS A;  3IFU A;  4ZUX U;  4R3D A;  1CVZ A;  2NQD B;  1KHQ A;  2AUX A;  3PDF A;  1NPZ A;  2G8J A;  4FK5 A;  3BCN A;  2WBF X;  3MTN A;  1QDQ A;  3W30 A;  4P6G A;  3IUT A;  1U5I A;  2PBH A;  4W5B A;  1CJL A;  3B79 A;  1MHW A;  1POP A;  1NB3 A;  1UKF A;  3CH3 X;  2HHN A;  5FPW A;  2BU3 A;  1Y4H A;  3CBK A;  4BS5 A;  2JQF R;  4OEM A;  3IOQ A;  4N79 A;  5CVM A;  1NB5 A;  2R9N A;  2R6N A;  1TL9 A;  4DMX A;  1EWP A;  1BGO A;  3O1G A;  5J94 A;  3IV2 A;  2OP3 A;  2G6D A;  4QH6 A;  2E00 A;  1ME4 A;  2XU4 A;  1HUC B;  1EF7 A;  4W4U A;  2DZZ A;  2AUZ A;  2G8E A;  1O0E A;  2IBI A;  2Y5B A;  4RNA A;  4Q8H A;  3OVZ A;  3BBA A;  3OQC A;  1AU0 A;  4QBB A;  3P5V A;  1YT7 A;  1BY8 A;  1MS6 A;  6PAD A;  3HHA A;  2JRI A;  1AU4 A;  1BP4 A;  2DJF B;  4REZ A;  3BPM A;  3LXS A;  4IP3 A;  3P5X A;  1GEC E;  1YK7 A;  5A24 A;  1U9Q X;  1ME3 A;  5JA7 A;  2IPP B;  4YVA A;  3ZNH A;  4RY2 A;  1DKI A;  4DMY A;  3TMP A;  3I3T A;  3V6E A;  5KO3 A;  1U9X A;  2R9O A;  2DZY A;  3ZUA A;  4FJC A;  1CB5 A;  4YV8 A;  2GFO A;  2ATO A;  2XU5 A;  2YJ9 A;  3OF9 A;  4WUR A;  4BSQ A;  4OVZ B;  1ITO A;  1AYV A;  3K9M A;  2Y6E A;  5PAD A;  2XU3 A;  5JZE A;  1AIM A;  1CTE A;  4YYQ A;  4BS6 A;  2PNS A;  2FT2 A;  1DF0 A;  5K16 A;  3N3G A;  4K7C A;  1PBH A;  3I06 A;  4QRV A;  1F29 A;  2XU1 A;  2FYE A;  4OW0 A;  4OEL A;  2VHS A;  2DC9 A;  2H7J A;  4X6I A;  2OZ2 A;  3H8B A;  1Q6K A;  1TLO A;  4N8W A;  4D8I A;  4YYW A;  3HWN A;  3PHX A;  4BOS A;  3PHU A;  4D8E A;  1STF E;  3HHI A;  2FRA A;  3KW9 A;  4X6H A;  1S4V A;  1X9Y A;  5F02 A;  3PW3 A;  3IHP A;  1GLO A;  1ZCM A;  4CDD B;  2FQ9 A;  1F2C A;  2FTD A;  2HXZ A;  4I05 A;  4QRX A;  2R9F A;  1AYU A;  2FE8 A;  2BTW B;  1PAD A;  4BOQ A;  3B21 A;  4I07 A;  4BPV A;  2ACT A;  7PCK A;  3HD3 A;  3P5W A;  3TNX A;  2ARY A;  3U8E A;  1MDW A;  2NQI A;  4XZX A;  5EZS A;  3E9S A;  4PT5 A;  4G54 A;  4AXM A;  2R9M A;  2GHU A;  2UZJ A;  3PNR A;  1U9W A;  1F2B A;  2JTC A;  2E02 A;  4XR7 A;  1MEG A;  1PE6 A;  3IMA A;  1PPO A;  2FRQ A;  1GMY A;  3GCB A;  3MOR A;  3V6C A;  1AEC A;  1KFX L;  2HH5 A;  4RF0 A;  1MIR A;  4KLB A;  3CBJ A;  2VHF A;  4P6E A;  1SNK A;  3CH2 X;  3OVX A;  3PSE A;  4A5U A;  1QOL A;  1SP4 B;  1PCI A;  1KHP A;  1PVJ A;  3H6S A;  2DCC A;  3NHE A;  3S3Q A;  2AS8 A;  3OF8 A;  3MTV A;  2NQA A;  5EGW A;  3BPF A;  3C0R A;  3WXG A;  2P86 A;  3H89 A;  2YJ8 A;  1VJV A;  3KKU A;  3KFQ A;  3PRP A;  3N4C A;  2YJC A;  1A6R A;  3KWZ A;  1PXV A;  3DF0 A;  1TU6 A;  2BTW A;  2B1N A;  2R9C A;  2J7Q C;  3MJ5 A;  1ICF A;  1F2A A;  2AVW A;  3OIS A;  2DC6 A;  1PPD A;  4QRG A;  1AYW A;  2NQG A;  4YYU A;  3MP2 A;  3PRM A;  3S3R A;  2AU1 A;  3PHW A;  4MZO A;  1EWL A;  1YVB A;  2AYN A;  4YYS A;  3QT4 A;  3KSE A;  4BOP A;  4D8B A;  1FH0 A;  3BOW A;  2B1M A;  3RNV A;  1NLJ A;  2OUL A;  3LFY A;  1IWD A;  1ATK A;  2P7U A;  4N4Z A;  1NL6 A;  1KFU L;  1CQD A;  3F75 A;  3USV A;  1AU2 A;  4BOU A;  4PP2 E;  3KWB X;  3WXF A;  1U9V A;  2HD5 A;  3ERV A;  2YJB A;  2JQG R;  1CV8 A;  4ZTB A;  3RVW A;  1EWO A;  3TRK A;  8PCH A;  4I04 A;  4PP1 A;  2AIM A;  2DJG B;  1QMY A;  4OVZ A;  3M99 A;  1PPN A;  4CDF B;  1Y08 A;  4XUI A;  4PI3 A;  5CHV A;  5JH3 A;  3BB7 A;  3O65 A;  3N3K A;  2DCD A;  4BOZ A;  4AXL A;  5CVO B;  4M0W A;  2AGA A;  3IEJ A;  2F7D A;  2J7Q A;  1AU3 A;  4CDC B;  3O0U A;  3W31 A;  2HWK A;  2DC8 A;  4MM3 B;  1ZIV A;  3C9E A;  5E6J A;  4MI7 A;  2CB5 A;  4FIP A;  4BQV A;  3BY4 A;  1K3B B;  1CSB B;  2BDZ A;  2E01 A;  2G7Y A;  2FO5 A;  4P16 A;  3MHS A;  4MSX A;  3P5U A;  2DCB A;  2P0R A;  3KX1 A;  4RKX A;  1CPJ A;  4MZS A;  4X6J A;  2O6X A;  2E03 A;  3QSD A;  9PAP A;  1CS8 A;  4WA6 A;  4YYV A;  1XKG A;  2BDL A;  2C0Y A;  3E1Z B;  4CDE B; 
#chains in the Genus database with same CATH homology
 4R3D A;  1PVJ A;  4D8B A;  3TRK A;  3ZNH A;  4D8I A;  2J7Q A;  1DKI A;  4BOQ A;  3PHX A;  4BOS A;  4RNA A;  4RF1 A;  3TMP A;  3RNV A;  5KO3 A;  2BU3 A;  3W31 A;  3BBA A;  3PHU A;  3OQC A;  4D8E A;  2BTW A;  2HWK A;  3MTV A;  4MM3 B;  4RKX A;  2J7Q C;  3MJ5 A;  4OVZ A;  4RF0 A;  3C0R A;  3PT2 A;  4XZX A;  4HXD B;  4OW0 A;  4MI7 A;  5E6J A;  2JRI A;  4GUA A;  5EZS A;  4REZ A;  3W30 A;  4BOU A;  3BB7 A;  4WUR A;  3E9S A;  1YZB A;  3O65 A;  4OVZ B;  3MP2 A;  3PSE A;  3PRP A;  3PRM A;  4IP3 A;  4PT5 A;  4A5U A;  2UZJ A;  4BOZ A;  2FE8 A;  3BY4 A;  5JZE A;  2BTW B;  3PHW A;  4IUM A;  4M0W A;  4BOP A;  2AGA A;  4ZTB A;  5EZQ A;  2JTC A;  2DOS A;  2Z84 A;  3IFU A;  1UKF A;  3B21 A;  4P16 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...