3PSEA

Structure of a viral otu domain protease bound to interferon-stimulated gene 15 (isg15)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
164
structure length
164
Chain Sequence
GPMDFLRSLDWTQVIAGQYVSNPRFNISDYFEIVRQPGDGNCFYHSIAELTMPNKTDHSYHYIKRLTESAARKYYQEEPEARLVGLSLEDYLKRMLSDNEWGSTLEASMLAKEMGITIIIWTVAASDEVEAGIKFGDGDVFTAVNLLHSGQTHFDALRILPQFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/protein binding
molecule keywords RNA polymerase
publication title Structural basis for the removal of ubiquitin and interferon-stimulated gene 15 by a viral ovarian tumor domain-containing protease.
pubmed doi rcsb
source organism Crimean-congo hemorrhagic fever virus
total genus 48
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2010-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.80 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3pseA00
3PHXA 3PT2A 3ZNHA 3PSEA 5JZEA 4BOZA 3C0RA 3PRPA 4BOPA 4BOQA 3PRMA 3PHUA 3BY4A 4BOUA 4BOSA 3PHWA 4HXDB 3TMPA
chains in the Genus database with same CATH superfamily
3F75A 4FJCA 1CS8A 1Y08A 2AYOA 1KHPA 3TMPA 1CVZA 4QRGA 4I04A 1PPDA 2XU4A 2ACTA 3TRKA 4YVAA 4QH6A 3PHWA 2AYNA 3QT4A 4XR7A 5FPWA 4M0WA 3WXEA 1QXPA 1EWOA 3KW9A 2UZJA 2NQAA 2FQ9A 1U9QX 3ZNHA 1SNKA 4BSQA 4REZA 4CDDB 5CHVA 1MS6A 4RF0A 1YK8A 4WURA 4N4ZA 4QRXA 3O0UA 4DMXA 4A5UA 4BQVA 4N8WA 3QJ3A 1POPA 1AECA 1CB5A 1PBHA 2YJCA 4IUMA 4YYSA 3C0RA 1VSNA 1KFXL 2C0YA 1ZIVA 1CV8A 1BGOA 2R9NA 4RY2A 1PIPA 3V6CA 2DC6A 3BBAA 3I3TA 1PXVA 3W30A 1KHQA 3OF9A 1PPOA 3P5WA 1M6DA 2BTWB 1UKFA 4PT5A 1XKGA 3BPFA 2VHFA 2YJBA 5JA7A 3MJ5A 3I06A 1NL6A 4P16A 2R6NA 1AU0A 3PDFA 1BY8A 2IBIA 2DZZA 1AYWA 3H89A 2WBFX 5CHTA 3RVXA 9PAPA 5CVOB 2PNSA 3BB7A 2NQGA 2J7QC 2BTWA 4YV8A 5PADA 3MTVA 4OELA 3DF0A 3WXFA 3P5XA 2YJ9A 3IOQA 1MEMA 2DJFB 4X6IA 5J94A 1K3BB 4I05A 2R9FA 1QDQA 2B1MA 3RVWA 5E6JA 3O1GA 1X9YA 1AU2A 1CJLA 2E00A 1DKIA 1AIMA 1O0EA 1TU6A 1QMYA 3IHPA 1U9XA 4D8EA 1KFUL 3MHSA 3IUTA 4YYVA 2FRQA 3N4CA 3HWNA 3MP2A 3KKUA 3S3QA 1CSBB 1F29A 3F5VA 2HH5A 1MDWA 1VJVA 2DC8A 2DOSA 2PREA 4BOUA 4KLBA 4I07A 1ITOA 4RNAA 2GHUA 3IFUA 3KWZA 4HXDB 4W4UA 4YYQA 1EWLA 2FT2A 1CPJA 4W5CA 1KXRA 2ATOA 1PPPA 4WA6A 2DZYA 3CH3X 5CVMA 4AXLA 5JH3A 3N3GA 2J7QA 2PADA 3OF8A 2E01A 3CBJA 5A24A 4BOPA 4BOQA 2AVWA 1ATKA 2DCAA 1F2BA 1CQDA 3W31A 1GMYA 1NB3A 1TLOA 5K16A 3IMAA 1AYVA 1STFE 4GUAA 4K7CA 4PI3A 2P7UA 4R3DA 1YZBA 5EZSA 2E03A 1DEUA 4Q8HA 3OVXA 1YK7A 2H7JA 2JRIA 4D8BA 2XU1A 4X6JA 3P5VA 4MSXA 2XU5A 2R9CA 3OQCA 3WXGA 1ZCMA 1U9VA 2FE8A 2JQFR 3D6SA 3PT2A 3BOWA 2BDZA 2BU3A 3K8UA 1PPNA 5CVNB 1THEA 5EZQA 4QRVA 3V6EA 3S3RA 3CH2X 1F2AA 1AU3A 3LFYA 1A6RA 2P86A 4ZUXU 1CTEA 4CDEB 1NLJA 3H8BA 4P6GA 2FTDA 3K24A 2AU1A 3H8CA 1TL9A 4P6EA 4ZTBA 4X6HA 1NQCA 3OISA 2DC7A 2OULA 1JQPA 4D8IA 4W5BA 4BS5A 3AI8A 1GECE 3P5UA 4HWYA 2B1NA 3KX1A 3OVZA 2ARYA 2P0RA 3BCNA 2BDLA 2G6DA 1GLOA 3BPMA 1AYUA 4MI7A 4BOZA 4BPVA 2YJ2A 1EWMA 3PRMA 3BY4A 1DF0A 2G8JA 1EWPA 4FIPA 1U5IA 2HD5A 2DCCA 1F2CA 1IWDA 1ME3A 1QOLA 2NQIA 4PP2E 3USVA 2NQDB 3ERVA 1EF7A 4DMYA 1YALA 2Y6EA 3MTNA 3NHEA 3H6SA 2HWKA 3PHXA 3IEJA 3H7DA 4BOSA 3CBKA 1PVJA 4AXMA 1S4VA 1ME4A 3RNVA 3RVVA 2FUDA 3E1ZB 5F02A 2XU3A 5JZEA 2AUZA 8PCHA 4RKXA 2DCDA 1SP4B 3M99A 1NPZA 2GFOA 2OP3A 4OVZA 1MEGA 2YJ8A 4MZOA 3PRPA 3IV2A 3KSEA 2HXZA 2Y5BA 3PW3A 3PSEA 2OZ2A 2G7YA 3BC3A 3MORA 5EGWA 3PHUA 3PBHA 1MIRA 2R9OA 4FK5A 3GCBA 2IPPB 5KO3A 3O65A 2R9MA 4YYUA 3MHHA 5EF4A 1PE6A 2DJGB 4YYRA 3TNXA 3ZUAA 3B79A 2E02A 4BS6A 4IP3A 2VHSA 3HHIA 4MZSA 3KWBX 3U8EA 2JQGR 4OEMA 1PCIA 2FYEA 3PNRA 3QSDA 4Q8GA 2AIMA 1YVBA 2PBHA 3HHAA 4CZWA 2FO5A 7PCKA 4G54A 1NB5A 2DCBA 1PADA 4CDCB 4QBBA 1MHWA 2AS8A 2F7DA 3HD3A 4YYWA 2FRAA 1AU4A 4MM3B 4CDFB 1HUCB 4OW0A 2G8EA 1U9WA 3LXSA 2CB5A 3N3KA 3KFQA 3B21A 4RF1A 1BQIA 3C9EA 4N79A 4PP1A 2HHNA 1FH0A 2Z84A 2CIOA 2AUXA 2DC9A 4PADA 2AGAA 1Y4HA 3BWKA 2O6XA 4OVZB 2F1GA 1ICFA 4XZXA 3K9MA 1GCBA 4XUIA 1BP4A 2JTCA 6PADA 1YT7A 1Q6KA 3E9SA
chains in the Genus database with same CATH topology
5E6JA 4ZTBA 3TMPA 1DKIA 4IP3A 4D8EA 4D8IA 3TRKA 3PHWA 4M0WA 3MP2A 2UZJA 3ZNHA 4REZA 2DOSA 4BOUA 4RF0A 4WURA 4MI7A 4BOZA 3PRMA 4RNAA 3BY4A 3IFUA 4A5UA 4HXDB 4IUMA 3C0RA 2J7QA 3BBAA 4BOPA 4BOQA 3W30A 4MM3B 2HWKA 3PHXA 4OW0A 3W31A 2BTWB 1UKFA 4PT5A 4BOSA 1PVJA 3RNVA 3MJ5A 3B21A 4RF1A 4GUAA 5JZEA 4R3DA 1YZBA 4P16A 5EZSA 2Z84A 4RKXA 2JRIA 4D8BA 2AGAA 4OVZB 4OVZA 3OQCA 2FE8A 3PRPA 3BB7A 4XZXA 2J7QC 3PT2A 2BTWA 3MTVA 2BU3A 3PSEA 5EZQA 3PHUA 2JTCA 5KO3A 3O65A 3E9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PHX A;  3PT2 A;  3ZNH A;  3PSE A;  5JZE A;  4BOZ A;  3C0R A;  3PRP A;  4BOP A;  4BOQ A;  3PRM A;  3PHU A;  3BY4 A;  4BOU A;  4BOS A;  3PHW A;  4HXD B;  3TMP A; 
#chains in the Genus database with same CATH topology
 3F75 A;  4FJC A;  1CS8 A;  1Y08 A;  2AYO A;  1KHP A;  3TMP A;  1CVZ A;  4QRG A;  4I04 A;  1PPD A;  2XU4 A;  2ACT A;  3TRK A;  4YVA A;  4QH6 A;  3PHW A;  2AYN A;  3QT4 A;  4XR7 A;  5FPW A;  4M0W A;  3WXE A;  1QXP A;  1EWO A;  3KW9 A;  2UZJ A;  2NQA A;  2FQ9 A;  1U9Q X;  3ZNH A;  1SNK A;  4BSQ A;  4REZ A;  4CDD B;  5CHV A;  1MS6 A;  4RF0 A;  1YK8 A;  4WUR A;  4N4Z A;  4QRX A;  3O0U A;  4DMX A;  4A5U A;  4BQV A;  4N8W A;  3QJ3 A;  1POP A;  1AEC A;  1CB5 A;  1PBH A;  2YJC A;  4IUM A;  4YYS A;  3C0R A;  1VSN A;  1KFX L;  2C0Y A;  1ZIV A;  1CV8 A;  1BGO A;  2R9N A;  4RY2 A;  1PIP A;  3V6C A;  2DC6 A;  3BBA A;  3I3T A;  1PXV A;  3W30 A;  1KHQ A;  3OF9 A;  1PPO A;  3P5W A;  1M6D A;  2BTW B;  1UKF A;  4PT5 A;  1XKG A;  3BPF A;  2VHF A;  2YJB A;  5JA7 A;  3MJ5 A;  3I06 A;  1NL6 A;  4P16 A;  2R6N A;  1AU0 A;  3PDF A;  1BY8 A;  2IBI A;  2DZZ A;  1AYW A;  3H89 A;  2WBF X;  5CHT A;  3RVX A;  9PAP A;  5CVO B;  2PNS A;  3BB7 A;  2NQG A;  2J7Q C;  2BTW A;  4YV8 A;  5PAD A;  3MTV A;  4OEL A;  3DF0 A;  3WXF A;  3P5X A;  2YJ9 A;  3IOQ A;  1MEM A;  2DJF B;  4X6I A;  5J94 A;  1K3B B;  4I05 A;  2R9F A;  1QDQ A;  2B1M A;  3RVW A;  5E6J A;  3O1G A;  1X9Y A;  1AU2 A;  1CJL A;  2E00 A;  1DKI A;  1AIM A;  1O0E A;  1TU6 A;  1QMY A;  3IHP A;  1U9X A;  4D8E A;  1KFU L;  3MHS A;  3IUT A;  4YYV A;  2FRQ A;  3N4C A;  3HWN A;  3MP2 A;  3KKU A;  3S3Q A;  1CSB B;  1F29 A;  3F5V A;  2HH5 A;  1MDW A;  1VJV A;  2DC8 A;  2DOS A;  2PRE A;  4BOU A;  4KLB A;  4I07 A;  1ITO A;  4RNA A;  2GHU A;  3IFU A;  3KWZ A;  4HXD B;  4W4U A;  4YYQ A;  1EWL A;  2FT2 A;  1CPJ A;  4W5C A;  1KXR A;  2ATO A;  1PPP A;  4WA6 A;  2DZY A;  3CH3 X;  5CVM A;  4AXL A;  5JH3 A;  3N3G A;  2J7Q A;  2PAD A;  3OF8 A;  2E01 A;  3CBJ A;  5A24 A;  4BOP A;  4BOQ A;  2AVW A;  1ATK A;  2DCA A;  1F2B A;  1CQD A;  3W31 A;  1GMY A;  1NB3 A;  1TLO A;  5K16 A;  3IMA A;  1AYV A;  1STF E;  4GUA A;  4K7C A;  4PI3 A;  2P7U A;  4R3D A;  1YZB A;  5EZS A;  2E03 A;  1DEU A;  4Q8H A;  3OVX A;  1YK7 A;  2H7J A;  2JRI A;  4D8B A;  2XU1 A;  4X6J A;  3P5V A;  4MSX A;  2XU5 A;  2R9C A;  3OQC A;  3WXG A;  1ZCM A;  1U9V A;  2FE8 A;  2JQF R;  3D6S A;  3PT2 A;  3BOW A;  2BDZ A;  2BU3 A;  3K8U A;  1PPN A;  5CVN B;  1THE A;  5EZQ A;  4QRV A;  3V6E A;  3S3R A;  3CH2 X;  1F2A A;  1AU3 A;  3LFY A;  1A6R A;  2P86 A;  4ZUX U;  1CTE A;  4CDE B;  1NLJ A;  3H8B A;  4P6G A;  2FTD A;  3K24 A;  2AU1 A;  3H8C A;  1TL9 A;  4P6E A;  4ZTB A;  4X6H A;  1NQC A;  3OIS A;  2DC7 A;  2OUL A;  1JQP A;  4D8I A;  4W5B A;  4BS5 A;  3AI8 A;  1GEC E;  3P5U A;  4HWY A;  2B1N A;  3KX1 A;  3OVZ A;  2ARY A;  2P0R A;  3BCN A;  2BDL A;  2G6D A;  1GLO A;  3BPM A;  1AYU A;  4MI7 A;  4BOZ A;  4BPV A;  2YJ2 A;  1EWM A;  3PRM A;  3BY4 A;  1DF0 A;  2G8J A;  1EWP A;  4FIP A;  1U5I A;  2HD5 A;  2DCC A;  1F2C A;  1IWD A;  1ME3 A;  1QOL A;  2NQI A;  4PP2 E;  3USV A;  2NQD B;  3ERV A;  1EF7 A;  4DMY A;  1YAL A;  2Y6E A;  3MTN A;  3NHE A;  3H6S A;  2HWK A;  3PHX A;  3IEJ A;  3H7D A;  4BOS A;  3CBK A;  1PVJ A;  4AXM A;  1S4V A;  1ME4 A;  3RNV A;  3RVV A;  2FUD A;  3E1Z B;  5F02 A;  2XU3 A;  5JZE A;  2AUZ A;  8PCH A;  4RKX A;  2DCD A;  1SP4 B;  3M99 A;  1NPZ A;  2GFO A;  2OP3 A;  4OVZ A;  1MEG A;  2YJ8 A;  4MZO A;  3PRP A;  3IV2 A;  3KSE A;  2HXZ A;  2Y5B A;  3PW3 A;  3PSE A;  2OZ2 A;  2G7Y A;  3BC3 A;  3MOR A;  5EGW A;  3PHU A;  3PBH A;  1MIR A;  2R9O A;  4FK5 A;  3GCB A;  2IPP B;  5KO3 A;  3O65 A;  2R9M A;  4YYU A;  3MHH A;  5EF4 A;  1PE6 A;  2DJG B;  4YYR A;  3TNX A;  3ZUA A;  3B79 A;  2E02 A;  4BS6 A;  4IP3 A;  2VHS A;  3HHI A;  4MZS A;  3KWB X;  3U8E A;  2JQG R;  4OEM A;  1PCI A;  2FYE A;  3PNR A;  3QSD A;  4Q8G A;  2AIM A;  1YVB A;  2PBH A;  3HHA A;  4CZW A;  2FO5 A;  7PCK A;  4G54 A;  1NB5 A;  2DCB A;  1PAD A;  4CDC B;  4QBB A;  1MHW A;  2AS8 A;  2F7D A;  3HD3 A;  4YYW A;  2FRA A;  1AU4 A;  4MM3 B;  4CDF B;  1HUC B;  4OW0 A;  2G8E A;  1U9W A;  3LXS A;  2CB5 A;  3N3K A;  3KFQ A;  3B21 A;  4RF1 A;  1BQI A;  3C9E A;  4N79 A;  4PP1 A;  2HHN A;  1FH0 A;  2Z84 A;  2CIO A;  2AUX A;  2DC9 A;  4PAD A;  2AGA A;  1Y4H A;  3BWK A;  2O6X A;  4OVZ B;  2F1G A;  1ICF A;  4XZX A;  3K9M A;  1GCB A;  4XUI A;  1BP4 A;  2JTC A;  6PAD A;  1YT7 A;  1Q6K A;  3E9S A; 
#chains in the Genus database with same CATH homology
 5E6J A;  4ZTB A;  3TMP A;  1DKI A;  4IP3 A;  4D8E A;  4D8I A;  3TRK A;  3PHW A;  4M0W A;  3MP2 A;  2UZJ A;  3ZNH A;  4REZ A;  2DOS A;  4BOU A;  4RF0 A;  4WUR A;  4MI7 A;  4BOZ A;  3PRM A;  4RNA A;  3BY4 A;  3IFU A;  4A5U A;  4HXD B;  4IUM A;  3C0R A;  2J7Q A;  3BBA A;  4BOP A;  4BOQ A;  3W30 A;  4MM3 B;  2HWK A;  3PHX A;  4OW0 A;  3W31 A;  2BTW B;  1UKF A;  4PT5 A;  4BOS A;  1PVJ A;  3RNV A;  3MJ5 A;  3B21 A;  4RF1 A;  4GUA A;  5JZE A;  4R3D A;  1YZB A;  4P16 A;  5EZS A;  2Z84 A;  4RKX A;  2JRI A;  4D8B A;  2AGA A;  4OVZ B;  4OVZ A;  3OQC A;  2FE8 A;  3PRP A;  3BB7 A;  4XZX A;  2J7Q C;  3PT2 A;  2BTW A;  3MTV A;  2BU3 A;  3PSE A;  5EZQ A;  3PHU A;  2JTC A;  5KO3 A;  3O65 A;  3E9S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...