1MEGA

Crystal structure of a caricain d158e mutant in complex with e-64
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
216
structure length
216
Chain Sequence
LPENVDWRKKGAVTPVRHQGSCGSCWAFSAVATVEGINKIRTGKLVELSEQELVDCERRSHGCKGGYPPYALEYVAKNGIHLRSKYPYKAKQGTCRAKQVGGPIVKTSGVGRVQPNNEGNLLNAIAKQPVSVVVESKGRPFQLYKGGIFEGPCGTKVEHAVTAVGYGKSGGKGYILIKNSWGTAWGEKGYIRIKRAPGNSPGVCGLYKSSYYPTKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CARICAIN
publication title Crystal structure of a caricain D158E mutant in complex with E-64.
pubmed doi rcsb
source organism Carica papaya
total genus 60
structure length 216
sequence length 216
ec nomenclature ec 3.4.22.30: Caricain.
pdb deposition date 1996-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1megA00
3MHHA 3KFQA 3K8UA 4Q8HA 4P6EA 4X6JA 3HD3A 5EGWA 1GECE 1DEUA 1AU0A 2VHFA 4QRXA 5JA7A 1NLJA 1CTEA 4N4ZA 2E02A 5EF4A 2XU4A 8PCHA 2R9FA 1PXVA 3WXFA 4QRGA 4W4UA 4CDEB 1U9XA 3BOWA 1MIRA 3F75A 3OVXA 5JH3A 2ATOA 4FIPA 3RVWA 4I05A 4OELA 4X6IA 1F2AA 1YVBA 3NHEA 1PPOA 2G8EA 3ZUAA 1AYUA 1BGOA 3PBHA 4PP1A 3M99A 3BPMA 1U5IA 2OP3A 4YYRA 1U9VA 2R6NA 2E00A 2AS8A 3KW9A 3F5VA 2DCAA 1Y08A 5PADA 3P5UA 4N79A 3RVVA 2YJ2A 1YT7A 1THEA 2FQ9A 1IWDA 3N3GA 1U9QX 2DCDA 1EWMA 2P7UA 1PPNA 3QJ3A 4Q8GA 1Q6KA 3QT4A 1QXPA 3B79A 2GHUA 1ZIVA 2NQGA 4MZOA 4MSXA 2R9NA 1MEGA 2AIMA 4FJCA 1XKGA 2PREA 3H8CA 1AIMA 4HWYA 5K16A 1A6RA 4MZSA 2PADA 1NB3A 3D6SA 4BPVA 2PBHA 1YALA 1EF7A 4AXLA 3P5WA 4WA6A 3IEJA 3V6CA 1CPJA 1K3BB 2R9MA 3V6EA 2DCCA 2E03A 4YV8A 2CB5A 1TU6A 1KFXL 1BP4A 2JQGR 1KFUL 3S3RA 1EWPA 2DJGB 2XU3A 4CDCB 1GLOA 2AUZA 1MEMA 1AU2A 1POPA 1NB5A 1O0EA 1BY8A 4BS5A 1KHQA 1AU4A 3OF8A 2B1MA 1CJLA 2NQDB 3GCBA 2F7DA 2R9CA 2ARYA 4X6HA 1TLOA 3TNXA 3MTNA 3WXGA 1AYWA 2JQFR 3U8EA 2BDLA 4N8WA 4CDDB 1QOLA 5J94A 1EWLA 4I07A 3S3QA 3BPFA 2G8JA 4QBBA 2DC8A 2FO5A 2DC9A 2G7YA 4W5CA 1JQPA 4DMYA 5A24A 2DZZA 2R9OA 4K7CA 3BC3A 3KKUA 2P86A 3C9EA 2B1NA 2OZ2A 5CHVA 3MORA 2IBIA 2YJBA 2YJ8A 1YK7A 2FUDA 2XU5A 1CVZA 3H7DA 3I06A 4YYWA 3IV2A 2HH5A 2P0RA 1PIPA 3ERVA 2F1GA 4PI3A 4BQVA 4YYQA 3LXSA 1SP4B 4YYSA 1KXRA 2AU1A 4ZUXU 1ITOA 1YK8A 2C0YA 1ICFA 3H8BA 4CZWA 2FRAA 3CH3X 4QH6A 5CVOB 3BWKA 2DJFB 2Y5BA 4XR7A 4W5BA 2BDZA 3LFYA 3CBKA 1M6DA 4I04A 9PAPA 2NQAA 1VSNA 2OULA 3HHAA 1CSBB 3WXEA 2XU1A 1TL9A 2YJCA 3IUTA 3P5XA 3I3TA 3O1GA 1MHWA 3KWBX 3PW3A 3HWNA 2FRQA 4XUIA 1CQDA 5CVMA 2H7JA 1ZCMA 4PADA 2DCBA 3PDFA 3DF0A 3IMAA 2WBFX 1PPDA 2AYNA 5CVNB 2CIOA 2AYOA 5FPWA 3USVA 2GFOA 6PADA 3CBJA 1CS8A 3OF9A 1S4VA 2HHNA 1F2BA 1Y4HA 3KX1A 1PE6A 4BSQA 4PP2E 3KSEA 1EWOA 1NL6A 3H89A 3K24A 1STFE 1NPZA 3PNRA 1KHPA 2AUXA 2VHSA 2HXZA 2DZYA 3H6SA 1BQIA 4QRVA 1AYVA 2AVWA 1MS6A 1AU3A 1FH0A 1ATKA 3OISA 3CH2X 4P6GA 1ME4A 1CV8A 4CDFB 3N3KA 1HUCB 1PBHA 2IPPB 2FTDA 4AXMA 3BCNA 4G54A 2DC6A 1GMYA 1ME3A 2NQIA 2DC7A 2ACTA 1PCIA 3MHSA 1X9YA 1NQCA 3E1ZB 1PADA 7PCKA 1GCBA 1DF0A 2HD5A 2O6XA 3OVZA 2PNSA 3QSDA 4FK5A 1QDQA 1VJVA 2G6DA 1PPPA 4RY2A 2FYEA 3N4CA 1CB5A 3AI8A 4BS6A 3O0UA 4YYVA 1SNKA 1AECA 1QMYA 4DMXA 1F2CA 1MDWA 2YJ9A 3RVXA 3IHPA 4OEMA 5CHTA 1U9WA 4YYUA 4KLBA 3HHIA 2Y6EA 3IOQA 3P5VA 2E01A 4YVAA 5F02A 2FT2A 3K9MA 3KWZA 1F29A
chains in the Genus database with same CATH superfamily
3MHHA 3BY4A 4BOQA 3KFQA 3K8UA 4Q8HA 4P6EA 4GUAA 4X6JA 3HD3A 5EGWA 1GECE 1DEUA 1AU0A 2VHFA 4QRXA 5JA7A 1NLJA 1CTEA 4N4ZA 2E02A 5EF4A 2XU4A 8PCHA 2FE8A 2R9FA 1PXVA 3WXFA 4QRGA 4W4UA 4CDEB 1U9XA 3BOWA 1MIRA 3F75A 3OVXA 4RF1A 5JH3A 3BB7A 2ATOA 4FIPA 3RVWA 4I05A 4OELA 4X6IA 1F2AA 1YVBA 3NHEA 1PPOA 2G8EA 3ZUAA 1AYUA 1BGOA 3PBHA 4PP1A 3M99A 3B21A 3BPMA 3MP2A 1U5IA 2OP3A 4YYRA 1U9VA 4D8BA 2BTWA 3PHUA 1DKIA 2R6NA 2E00A 3E9SA 2AS8A 3KW9A 3F5VA 2DCAA 3ZNHA 1Y08A 5PADA 2HWKA 3P5UA 4N79A 3RVVA 2YJ2A 1YT7A 1THEA 2J7QA 2FQ9A 1IWDA 3N3GA 1U9QX 2DCDA 2UZJA 1EWMA 5EZQA 3MJ5A 2P7UA 1PPNA 2AGAA 3QJ3A 4D8IA 4Q8GA 1Q6KA 3QT4A 1QXPA 3B79A 2GHUA 1ZIVA 2NQGA 3TRKA 4MZOA 4MSXA 2R9NA 1MEGA 2AIMA 4FJCA 1XKGA 2PREA 3H8CA 3PT2A 1AIMA 4HWYA 5K16A 1A6RA 3W31A 5EZSA 4MZSA 2PADA 1NB3A 3D6SA 4BPVA 3RNVA 2PBHA 1YALA 1EF7A 4AXLA 3P5WA 4BOZA 4MM3B 4WA6A 3O65A 3IEJA 3V6CA 1CPJA 3PHXA 1K3BB 2R9MA 3V6EA 2DCCA 3W30A 2E03A 4YV8A 2CB5A 1TU6A 4RKXA 1KFXL 3BBAA 1BP4A 2JQGR 1KFUL 3S3RA 1EWPA 2DJGB 2XU3A 4CDCB 1GLOA 2AUZA 1MEMA 1AU2A 1POPA 1NB5A 1O0EA 1BY8A 4BS5A 1KHQA 1PVJA 1AU4A 3OF8A 2B1MA 1CJLA 2NQDB 3GCBA 2F7DA 2R9CA 2ARYA 4X6HA 1TLOA 3TNXA 3MTNA 3WXGA 1AYWA 2JQFR 3U8EA 2BDLA 4XZXA 4N8WA 4CDDB 1QOLA 5J94A 5JZEA 1EWLA 4I07A 3S3QA 3BPFA 2G8JA 2DC8A 2FO5A 2G7YA 2DC9A 4QBBA 4W5CA 2J7QC 4M0WA 1JQPA 4DMYA 5A24A 2DZZA 2R9OA 4K7CA 3BC3A 3KKUA 2P86A 3C9EA 2B1NA 2OZ2A 5CHVA 3MORA 2IBIA 2YJBA 2YJ8A 1YK7A 2FUDA 2JTCA 2XU5A 1CVZA 3H7DA 3I06A 4YYWA 3PSEA 3IV2A 2HH5A 2P0RA 1PIPA 3ERVA 2F1GA 4PI3A 3C0RA 4BQVA 4YYQA 3LXSA 1SP4B 4YYSA 3PRMA 1KXRA 2AU1A 4ZUXU 1ITOA 1YK8A 2C0YA 1ICFA 3H8BA 4CZWA 2FRAA 3CH3X 4QH6A 5CVOB 4REZA 3BWKA 4OVZB 2DJFB 2Y5BA 4XR7A 4W5BA 2BDZA 3LFYA 3CBKA 1M6DA 4I04A 9PAPA 2NQAA 1VSNA 2OULA 4BOSA 3HHAA 1CSBB 3WXEA 2BU3A 2XU1A 1TL9A 2YJCA 3IUTA 3P5XA 4PT5A 3I3TA 3O1GA 1MHWA 3KWBX 3PW3A 3HWNA 3PHWA 2FRQA 4XUIA 1CQDA 5CVMA 2JRIA 4IP3A 2Z84A 2H7JA 1ZCMA 4PADA 3IFUA 2DCBA 3PDFA 4RF0A 3DF0A 3IMAA 2WBFX 1PPDA 2AYNA 5CVNB 2CIOA 2AYOA 5FPWA 3USVA 4RNAA 2GFOA 6PADA 3CBJA 1CS8A 3OF9A 1S4VA 2HHNA 1F2BA 1Y4HA 3KX1A 1PE6A 4BSQA 4PP2E 3KSEA 1EWOA 1NL6A 3PRPA 3H89A 1UKFA 3K24A 4HXDB 1STFE 4MI7A 1NPZA 3PNRA 4OW0A 1KHPA 2AUXA 2DOSA 2VHSA 2HXZA 2DZYA 3H6SA 1BQIA 3OQCA 4QRVA 1AYVA 2AVWA 1MS6A 4OVZA 1AU3A 1FH0A 1ATKA 3OISA 3CH2X 3MTVA 4P6GA 1ME4A 1CV8A 4CDFB 3N3KA 1HUCB 1PBHA 5E6JA 2IPPB 2FTDA 4AXMA 3BCNA 4G54A 2DC6A 1GMYA 1ME3A 2NQIA 1YZBA 4IUMA 2DC7A 2ACTA 1PCIA 3MHSA 1X9YA 1NQCA 3E1ZB 1PADA 7PCKA 1GCBA 1DF0A 4A5UA 2HD5A 2O6XA 3OVZA 2PNSA 3QSDA 4FK5A 1QDQA 1VJVA 2G6DA 1PPPA 4ZTBA 4RY2A 2FYEA 4WURA 3N4CA 1CB5A 3AI8A 4R3DA 4BS6A 2BTWB 3TMPA 3O0UA 4YYVA 1SNKA 1AECA 5KO3A 1QMYA 4DMXA 1F2CA 1MDWA 4BOUA 2YJ9A 3RVXA 3IHPA 4OEMA 5CHTA 1U9WA 4YYUA 4KLBA 3HHIA 4D8EA 2Y6EA 3IOQA 3P5VA 4P16A 2E01A 4YVAA 5F02A 4BOPA 2FT2A 3K9MA 3KWZA 1F29A
chains in the Genus database with same CATH topology
3MHHA 3KFQA 3K8UA 4Q8HA 4P6EA 4X6JA 3HD3A 5EGWA 1GECE 1DEUA 1AU0A 2VHFA 4QRXA 5JA7A 1NLJA 1CTEA 4N4ZA 2E02A 5EF4A 2XU4A 8PCHA 2R9FA 1PXVA 3WXFA 4QRGA 4W4UA 4CDEB 1U9XA 3BOWA 1MIRA 3F75A 3OVXA 5JH3A 2ATOA 4FIPA 3RVWA 4I05A 4OELA 4X6IA 1F2AA 1YVBA 3NHEA 1PPOA 2G8EA 1W5RA 3ZUAA 1AYUA 1BGOA 3PBHA 4PP1A 3M99A 3BPMA 1U5IA 1W6FA 2OP3A 4YYRA 1U9VA 2R6NA 2E00A 2AS8A 3KW9A 3F5VA 2DCAA 1Y08A 5PADA 3P5UA 4N79A 3RVVA 2YJ2A 1YT7A 1THEA 2FQ9A 1IWDA 3N3GA 1U9QX 2DCDA 1EWMA 2P7UA 1PPNA 4C5PA 3QJ3A 4Q8GA 1Q6KA 3QT4A 1QXPA 3B79A 2GHUA 1ZIVA 2NQGA 4MZOA 4MSXA 2R9NA 1MEGA 2AIMA 4FJCA 1XKGA 2PREA 3H8CA 1AIMA 4HWYA 5K16A 1A6RA 4MZSA 2PADA 1NB3A 3D6SA 4BPVA 2PBHA 1YALA 1EF7A 4AXLA 3P5WA 4WA6A 3IEJA 2BSZA 3V6CA 1CPJA 1K3BB 2R9MA 4NV8A 2DCCA 3V6EA 2E03A 4YV8A 2CB5A 1TU6A 1KFXL 1BP4A 2JQGR 1KFUL 3S3RA 1EWPA 2DJGB 2XU3A 4CDCB 1GLOA 2AUZA 1MEMA 1AU2A 1POPA 1NB5A 1O0EA 1BY8A 4BS5A 1KHQA 1AU4A 3OF8A 2B1MA 1CJLA 2NQDB 3GCBA 2F7DA 2R9CA 2ARYA 4X6HA 1TLOA 3TNXA 3MTNA 3WXGA 1AYWA 2JQFR 3U8EA 2BDLA 4N8WA 4CDDB 1QOLA 5J94A 1EWLA 4I07A 3S3QA 3BPFA 2G8JA 2DC8A 2FO5A 2G7YA 2DC9A 4QBBA 4W5CA 1JQPA 4DMYA 2VFCA 5A24A 2DZZA 2R9OA 4K7CA 3BC3A 3KKUA 2P86A 3C9EA 2B1NA 2OZ2A 5CHVA 3MORA 2IBIA 2YJBA 2YJ8A 3LTWA 1YK7A 2FUDA 2XU5A 1CVZA 3H7DA 3I06A 4YYWA 3IV2A 2HH5A 2P0RA 1PIPA 3ERVA 2F1GA 4PI3A 4BQVA 4YYQA 3LXSA 1SP4B 4YYSA 1KXRA 2AU1A 4ZUXU 1ITOA 1YK8A 2C0YA 1ICFA 3H8BA 4CZWA 2FRAA 3CH3X 4QH6A 5CVOB 3BWKA 2DJFB 2Y5BA 4XR7A 4W5BA 2BDZA 3LFYA 3CBKA 1M6DA 4I04A 9PAPA 2NQAA 1VSNA 2OULA 3HHAA 1CSBB 3WXEA 4BGFA 2XU1A 1TL9A 2YJCA 3IUTA 3P5XA 3D9WA 3I3TA 3O1GA 1MHWA 3KWBX 3PW3A 3HWNA 2FRQA 4XUIA 1CQDA 5CVMA 2H7JA 1ZCMA 4PADA 2DCBA 3PDFA 3DF0A 3IMAA 2WBFX 1PPDA 2AYNA 5CVNB 2CIOA 2AYOA 5FPWA 3USVA 2GFOA 6PADA 3CBJA 1CS8A 3OF9A 1E2TA 4B55A 1S4VA 1W4TA 2HHNA 1F2BA 1Y4HA 3KX1A 1PE6A 4BSQA 4PP2E 3KSEA 1EWOA 1NL6A 3H89A 4GUZA 3K24A 1STFE 1NPZA 3PNRA 1KHPA 2AUXA 2VHSA 2HXZA 2DZYA 3H6SA 1BQIA 4QRVA 1AYVA 2AVWA 1MS6A 2VFBA 1AU3A 1FH0A 1ATKA 3OISA 4NV7A 3CH2X 4P6GA 1ME4A 1CV8A 4CDFB 3N3KA 1HUCB 1PBHA 2IPPB 2FTDA 4AXMA 3BCNA 4G54A 2DC6A 1GMYA 1ME3A 2NQIA 2DC7A 2ACTA 1PCIA 3MHSA 1X9YA 1NQCA 3E1ZB 1PADA 7PCKA 1GCBA 1DF0A 2HD5A 2O6XA 3OVZA 2PNSA 3QSDA 4FK5A 1QDQA 1VJVA 2G6DA 1PPPA 4RY2A 2FYEA 3N4CA 1CB5A 3AI8A 1GX3A 4BS6A 3O0UA 4YYVA 1SNKA 1AECA 1QMYA 4DMXA 1F2CA 1MDWA 2YJ9A 3RVXA 3IHPA 4OEMA 5CHTA 1U9WA 4YYUA 4KLBA 3HHIA 2Y6EA 3IOQA 3P5VA 2E01A 4YVAA 5F02A 2FT2A 3K9MA 3KWZA 1F29A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MHH A;  3KFQ A;  3K8U A;  4Q8H A;  4P6E A;  4X6J A;  3HD3 A;  5EGW A;  1GEC E;  1DEU A;  1AU0 A;  2VHF A;  4QRX A;  5JA7 A;  1NLJ A;  1CTE A;  4N4Z A;  2E02 A;  5EF4 A;  2XU4 A;  8PCH A;  2R9F A;  1PXV A;  3WXF A;  4QRG A;  4W4U A;  4CDE B;  1U9X A;  3BOW A;  1MIR A;  3F75 A;  3OVX A;  5JH3 A;  2ATO A;  4FIP A;  3RVW A;  4I05 A;  4OEL A;  4X6I A;  1F2A A;  1YVB A;  3NHE A;  1PPO A;  2G8E A;  3ZUA A;  1AYU A;  1BGO A;  3PBH A;  4PP1 A;  3M99 A;  3BPM A;  1U5I A;  2OP3 A;  4YYR A;  1U9V A;  2R6N A;  2E00 A;  2AS8 A;  3KW9 A;  3F5V A;  2DCA A;  1Y08 A;  5PAD A;  3P5U A;  4N79 A;  3RVV A;  2YJ2 A;  1YT7 A;  1THE A;  2FQ9 A;  1IWD A;  3N3G A;  1U9Q X;  2DCD A;  1EWM A;  2P7U A;  1PPN A;  3QJ3 A;  4Q8G A;  1Q6K A;  3QT4 A;  1QXP A;  3B79 A;  2GHU A;  1ZIV A;  2NQG A;  4MZO A;  4MSX A;  2R9N A;  1MEG A;  2AIM A;  4FJC A;  1XKG A;  2PRE A;  3H8C A;  1AIM A;  4HWY A;  5K16 A;  1A6R A;  4MZS A;  2PAD A;  1NB3 A;  3D6S A;  4BPV A;  2PBH A;  1YAL A;  1EF7 A;  4AXL A;  3P5W A;  4WA6 A;  3IEJ A;  3V6C A;  1CPJ A;  1K3B B;  2R9M A;  3V6E A;  2DCC A;  2E03 A;  4YV8 A;  2CB5 A;  1TU6 A;  1KFX L;  1BP4 A;  2JQG R;  1KFU L;  3S3R A;  1EWP A;  2DJG B;  2XU3 A;  4CDC B;  1GLO A;  2AUZ A;  1MEM A;  1AU2 A;  1POP A;  1NB5 A;  1O0E A;  1BY8 A;  4BS5 A;  1KHQ A;  1AU4 A;  3OF8 A;  2B1M A;  1CJL A;  2NQD B;  3GCB A;  2F7D A;  2R9C A;  2ARY A;  4X6H A;  1TLO A;  3TNX A;  3MTN A;  3WXG A;  1AYW A;  2JQF R;  3U8E A;  2BDL A;  4N8W A;  4CDD B;  1QOL A;  5J94 A;  1EWL A;  4I07 A;  3S3Q A;  3BPF A;  2G8J A;  4QBB A;  2DC8 A;  2FO5 A;  2DC9 A;  2G7Y A;  4W5C A;  1JQP A;  4DMY A;  5A24 A;  2DZZ A;  2R9O A;  4K7C A;  3BC3 A;  3KKU A;  2P86 A;  3C9E A;  2B1N A;  2OZ2 A;  5CHV A;  3MOR A;  2IBI A;  2YJB A;  2YJ8 A;  1YK7 A;  2FUD A;  2XU5 A;  1CVZ A;  3H7D A;  3I06 A;  4YYW A;  3IV2 A;  2HH5 A;  2P0R A;  1PIP A;  3ERV A;  2F1G A;  4PI3 A;  4BQV A;  4YYQ A;  3LXS A;  1SP4 B;  4YYS A;  1KXR A;  2AU1 A;  4ZUX U;  1ITO A;  1YK8 A;  2C0Y A;  1ICF A;  3H8B A;  4CZW A;  2FRA A;  3CH3 X;  4QH6 A;  5CVO B;  3BWK A;  2DJF B;  2Y5B A;  4XR7 A;  4W5B A;  2BDZ A;  3LFY A;  3CBK A;  1M6D A;  4I04 A;  9PAP A;  2NQA A;  1VSN A;  2OUL A;  3HHA A;  1CSB B;  3WXE A;  2XU1 A;  1TL9 A;  2YJC A;  3IUT A;  3P5X A;  3I3T A;  3O1G A;  1MHW A;  3KWB X;  3PW3 A;  3HWN A;  2FRQ A;  4XUI A;  1CQD A;  5CVM A;  2H7J A;  1ZCM A;  4PAD A;  2DCB A;  3PDF A;  3DF0 A;  3IMA A;  2WBF X;  1PPD A;  2AYN A;  5CVN B;  2CIO A;  2AYO A;  5FPW A;  3USV A;  2GFO A;  6PAD A;  3CBJ A;  1CS8 A;  3OF9 A;  1S4V A;  2HHN A;  1F2B A;  1Y4H A;  3KX1 A;  1PE6 A;  4BSQ A;  4PP2 E;  3KSE A;  1EWO A;  1NL6 A;  3H89 A;  3K24 A;  1STF E;  1NPZ A;  3PNR A;  1KHP A;  2AUX A;  2VHS A;  2HXZ A;  2DZY A;  3H6S A;  1BQI A;  4QRV A;  1AYV A;  2AVW A;  1MS6 A;  1AU3 A;  1FH0 A;  1ATK A;  3OIS A;  3CH2 X;  4P6G A;  1ME4 A;  1CV8 A;  4CDF B;  3N3K A;  1HUC B;  1PBH A;  2IPP B;  2FTD A;  4AXM A;  3BCN A;  4G54 A;  2DC6 A;  1GMY A;  1ME3 A;  2NQI A;  2DC7 A;  2ACT A;  1PCI A;  3MHS A;  1X9Y A;  1NQC A;  3E1Z B;  1PAD A;  7PCK A;  1GCB A;  1DF0 A;  2HD5 A;  2O6X A;  3OVZ A;  2PNS A;  3QSD A;  4FK5 A;  1QDQ A;  1VJV A;  2G6D A;  1PPP A;  4RY2 A;  2FYE A;  3N4C A;  1CB5 A;  3AI8 A;  4BS6 A;  3O0U A;  4YYV A;  1SNK A;  1AEC A;  1QMY A;  4DMX A;  1F2C A;  1MDW A;  2YJ9 A;  3RVX A;  3IHP A;  4OEM A;  5CHT A;  1U9W A;  4YYU A;  4KLB A;  3HHI A;  2Y6E A;  3IOQ A;  3P5V A;  2E01 A;  4YVA A;  5F02 A;  2FT2 A;  3K9M A;  3KWZ A;  1F29 A; 
#chains in the Genus database with same CATH topology
 3MHH A;  3BY4 A;  4BOQ A;  3KFQ A;  3K8U A;  4Q8H A;  4P6E A;  4GUA A;  4X6J A;  3HD3 A;  5EGW A;  1GEC E;  1DEU A;  1AU0 A;  2VHF A;  4QRX A;  5JA7 A;  1NLJ A;  1CTE A;  4N4Z A;  2E02 A;  5EF4 A;  2XU4 A;  8PCH A;  2FE8 A;  2R9F A;  1PXV A;  3WXF A;  4QRG A;  4W4U A;  4CDE B;  1U9X A;  3BOW A;  1MIR A;  3F75 A;  3OVX A;  4RF1 A;  5JH3 A;  3BB7 A;  2ATO A;  4FIP A;  3RVW A;  4I05 A;  4OEL A;  4X6I A;  1F2A A;  1YVB A;  3NHE A;  1PPO A;  2G8E A;  3ZUA A;  1AYU A;  1BGO A;  3PBH A;  4PP1 A;  3M99 A;  3B21 A;  3BPM A;  3MP2 A;  1U5I A;  2OP3 A;  4YYR A;  1U9V A;  4D8B A;  2BTW A;  3PHU A;  1DKI A;  2R6N A;  2E00 A;  3E9S A;  2AS8 A;  3KW9 A;  3F5V A;  2DCA A;  3ZNH A;  1Y08 A;  5PAD A;  2HWK A;  3P5U A;  4N79 A;  3RVV A;  2YJ2 A;  1YT7 A;  1THE A;  2J7Q A;  2FQ9 A;  1IWD A;  3N3G A;  1U9Q X;  2DCD A;  2UZJ A;  1EWM A;  5EZQ A;  3MJ5 A;  2P7U A;  1PPN A;  2AGA A;  3QJ3 A;  4D8I A;  4Q8G A;  1Q6K A;  3QT4 A;  1QXP A;  3B79 A;  2GHU A;  1ZIV A;  2NQG A;  3TRK A;  4MZO A;  4MSX A;  2R9N A;  1MEG A;  2AIM A;  4FJC A;  1XKG A;  2PRE A;  3H8C A;  3PT2 A;  1AIM A;  4HWY A;  5K16 A;  1A6R A;  3W31 A;  5EZS A;  4MZS A;  2PAD A;  1NB3 A;  3D6S A;  4BPV A;  3RNV A;  2PBH A;  1YAL A;  1EF7 A;  4AXL A;  3P5W A;  4BOZ A;  4MM3 B;  4WA6 A;  3O65 A;  3IEJ A;  3V6C A;  1CPJ A;  3PHX A;  1K3B B;  2R9M A;  3V6E A;  2DCC A;  3W30 A;  2E03 A;  4YV8 A;  2CB5 A;  1TU6 A;  4RKX A;  1KFX L;  3BBA A;  1BP4 A;  2JQG R;  1KFU L;  3S3R A;  1EWP A;  2DJG B;  2XU3 A;  4CDC B;  1GLO A;  2AUZ A;  1MEM A;  1AU2 A;  1POP A;  1NB5 A;  1O0E A;  1BY8 A;  4BS5 A;  1KHQ A;  1PVJ A;  1AU4 A;  3OF8 A;  2B1M A;  1CJL A;  2NQD B;  3GCB A;  2F7D A;  2R9C A;  2ARY A;  4X6H A;  1TLO A;  3TNX A;  3MTN A;  3WXG A;  1AYW A;  2JQF R;  3U8E A;  2BDL A;  4XZX A;  4N8W A;  4CDD B;  1QOL A;  5J94 A;  5JZE A;  1EWL A;  4I07 A;  3S3Q A;  3BPF A;  2G8J A;  2DC8 A;  2FO5 A;  2G7Y A;  2DC9 A;  4QBB A;  4W5C A;  2J7Q C;  4M0W A;  1JQP A;  4DMY A;  5A24 A;  2DZZ A;  2R9O A;  4K7C A;  3BC3 A;  3KKU A;  2P86 A;  3C9E A;  2B1N A;  2OZ2 A;  5CHV A;  3MOR A;  2IBI A;  2YJB A;  2YJ8 A;  1YK7 A;  2FUD A;  2JTC A;  2XU5 A;  1CVZ A;  3H7D A;  3I06 A;  4YYW A;  3PSE A;  3IV2 A;  2HH5 A;  2P0R A;  1PIP A;  3ERV A;  2F1G A;  4PI3 A;  3C0R A;  4BQV A;  4YYQ A;  3LXS A;  1SP4 B;  4YYS A;  3PRM A;  1KXR A;  2AU1 A;  4ZUX U;  1ITO A;  1YK8 A;  2C0Y A;  1ICF A;  3H8B A;  4CZW A;  2FRA A;  3CH3 X;  4QH6 A;  5CVO B;  4REZ A;  3BWK A;  4OVZ B;  2DJF B;  2Y5B A;  4XR7 A;  4W5B A;  2BDZ A;  3LFY A;  3CBK A;  1M6D A;  4I04 A;  9PAP A;  2NQA A;  1VSN A;  2OUL A;  4BOS A;  3HHA A;  1CSB B;  3WXE A;  2BU3 A;  2XU1 A;  1TL9 A;  2YJC A;  3IUT A;  3P5X A;  4PT5 A;  3I3T A;  3O1G A;  1MHW A;  3KWB X;  3PW3 A;  3HWN A;  3PHW A;  2FRQ A;  4XUI A;  1CQD A;  5CVM A;  2JRI A;  4IP3 A;  2Z84 A;  2H7J A;  1ZCM A;  4PAD A;  3IFU A;  2DCB A;  3PDF A;  4RF0 A;  3DF0 A;  3IMA A;  2WBF X;  1PPD A;  2AYN A;  5CVN B;  2CIO A;  2AYO A;  5FPW A;  3USV A;  4RNA A;  2GFO A;  6PAD A;  3CBJ A;  1CS8 A;  3OF9 A;  1S4V A;  2HHN A;  1F2B A;  1Y4H A;  3KX1 A;  1PE6 A;  4BSQ A;  4PP2 E;  3KSE A;  1EWO A;  1NL6 A;  3PRP A;  3H89 A;  1UKF A;  3K24 A;  4HXD B;  1STF E;  4MI7 A;  1NPZ A;  3PNR A;  4OW0 A;  1KHP A;  2AUX A;  2DOS A;  2VHS A;  2HXZ A;  2DZY A;  3H6S A;  1BQI A;  3OQC A;  4QRV A;  1AYV A;  2AVW A;  1MS6 A;  4OVZ A;  1AU3 A;  1FH0 A;  1ATK A;  3OIS A;  3CH2 X;  3MTV A;  4P6G A;  1ME4 A;  1CV8 A;  4CDF B;  3N3K A;  1HUC B;  1PBH A;  5E6J A;  2IPP B;  2FTD A;  4AXM A;  3BCN A;  4G54 A;  2DC6 A;  1GMY A;  1ME3 A;  2NQI A;  1YZB A;  4IUM A;  2DC7 A;  2ACT A;  1PCI A;  3MHS A;  1X9Y A;  1NQC A;  3E1Z B;  1PAD A;  7PCK A;  1GCB A;  1DF0 A;  4A5U A;  2HD5 A;  2O6X A;  3OVZ A;  2PNS A;  3QSD A;  4FK5 A;  1QDQ A;  1VJV A;  2G6D A;  1PPP A;  4ZTB A;  4RY2 A;  2FYE A;  4WUR A;  3N4C A;  1CB5 A;  3AI8 A;  4R3D A;  4BS6 A;  2BTW B;  3TMP A;  3O0U A;  4YYV A;  1SNK A;  1AEC A;  5KO3 A;  1QMY A;  4DMX A;  1F2C A;  1MDW A;  4BOU A;  2YJ9 A;  3RVX A;  3IHP A;  4OEM A;  5CHT A;  1U9W A;  4YYU A;  4KLB A;  3HHI A;  4D8E A;  2Y6E A;  3IOQ A;  3P5V A;  4P16 A;  2E01 A;  4YVA A;  5F02 A;  4BOP A;  2FT2 A;  3K9M A;  3KWZ A;  1F29 A; 
#chains in the Genus database with same CATH homology
 3MHH A;  3KFQ A;  3K8U A;  4Q8H A;  4P6E A;  4X6J A;  3HD3 A;  5EGW A;  1GEC E;  1DEU A;  1AU0 A;  2VHF A;  4QRX A;  5JA7 A;  1NLJ A;  1CTE A;  4N4Z A;  2E02 A;  5EF4 A;  2XU4 A;  8PCH A;  2R9F A;  1PXV A;  3WXF A;  4QRG A;  4W4U A;  4CDE B;  1U9X A;  3BOW A;  1MIR A;  3F75 A;  3OVX A;  5JH3 A;  2ATO A;  4FIP A;  3RVW A;  4I05 A;  4OEL A;  4X6I A;  1F2A A;  1YVB A;  3NHE A;  1PPO A;  2G8E A;  1W5R A;  3ZUA A;  1AYU A;  1BGO A;  3PBH A;  4PP1 A;  3M99 A;  3BPM A;  1U5I A;  1W6F A;  2OP3 A;  4YYR A;  1U9V A;  2R6N A;  2E00 A;  2AS8 A;  3KW9 A;  3F5V A;  2DCA A;  1Y08 A;  5PAD A;  3P5U A;  4N79 A;  3RVV A;  2YJ2 A;  1YT7 A;  1THE A;  2FQ9 A;  1IWD A;  3N3G A;  1U9Q X;  2DCD A;  1EWM A;  2P7U A;  1PPN A;  4C5P A;  3QJ3 A;  4Q8G A;  1Q6K A;  3QT4 A;  1QXP A;  3B79 A;  2GHU A;  1ZIV A;  2NQG A;  4MZO A;  4MSX A;  2R9N A;  1MEG A;  2AIM A;  4FJC A;  1XKG A;  2PRE A;  3H8C A;  1AIM A;  4HWY A;  5K16 A;  1A6R A;  4MZS A;  2PAD A;  1NB3 A;  3D6S A;  4BPV A;  2PBH A;  1YAL A;  1EF7 A;  4AXL A;  3P5W A;  4WA6 A;  3IEJ A;  2BSZ A;  3V6C A;  1CPJ A;  1K3B B;  2R9M A;  4NV8 A;  2DCC A;  3V6E A;  2E03 A;  4YV8 A;  2CB5 A;  1TU6 A;  1KFX L;  1BP4 A;  2JQG R;  1KFU L;  3S3R A;  1EWP A;  2DJG B;  2XU3 A;  4CDC B;  1GLO A;  2AUZ A;  1MEM A;  1AU2 A;  1POP A;  1NB5 A;  1O0E A;  1BY8 A;  4BS5 A;  1KHQ A;  1AU4 A;  3OF8 A;  2B1M A;  1CJL A;  2NQD B;  3GCB A;  2F7D A;  2R9C A;  2ARY A;  4X6H A;  1TLO A;  3TNX A;  3MTN A;  3WXG A;  1AYW A;  2JQF R;  3U8E A;  2BDL A;  4N8W A;  4CDD B;  1QOL A;  5J94 A;  1EWL A;  4I07 A;  3S3Q A;  3BPF A;  2G8J A;  2DC8 A;  2FO5 A;  2G7Y A;  2DC9 A;  4QBB A;  4W5C A;  1JQP A;  4DMY A;  2VFC A;  5A24 A;  2DZZ A;  2R9O A;  4K7C A;  3BC3 A;  3KKU A;  2P86 A;  3C9E A;  2B1N A;  2OZ2 A;  5CHV A;  3MOR A;  2IBI A;  2YJB A;  2YJ8 A;  3LTW A;  1YK7 A;  2FUD A;  2XU5 A;  1CVZ A;  3H7D A;  3I06 A;  4YYW A;  3IV2 A;  2HH5 A;  2P0R A;  1PIP A;  3ERV A;  2F1G A;  4PI3 A;  4BQV A;  4YYQ A;  3LXS A;  1SP4 B;  4YYS A;  1KXR A;  2AU1 A;  4ZUX U;  1ITO A;  1YK8 A;  2C0Y A;  1ICF A;  3H8B A;  4CZW A;  2FRA A;  3CH3 X;  4QH6 A;  5CVO B;  3BWK A;  2DJF B;  2Y5B A;  4XR7 A;  4W5B A;  2BDZ A;  3LFY A;  3CBK A;  1M6D A;  4I04 A;  9PAP A;  2NQA A;  1VSN A;  2OUL A;  3HHA A;  1CSB B;  3WXE A;  4BGF A;  2XU1 A;  1TL9 A;  2YJC A;  3IUT A;  3P5X A;  3D9W A;  3I3T A;  3O1G A;  1MHW A;  3KWB X;  3PW3 A;  3HWN A;  2FRQ A;  4XUI A;  1CQD A;  5CVM A;  2H7J A;  1ZCM A;  4PAD A;  2DCB A;  3PDF A;  3DF0 A;  3IMA A;  2WBF X;  1PPD A;  2AYN A;  5CVN B;  2CIO A;  2AYO A;  5FPW A;  3USV A;  2GFO A;  6PAD A;  3CBJ A;  1CS8 A;  3OF9 A;  1E2T A;  4B55 A;  1S4V A;  1W4T A;  2HHN A;  1F2B A;  1Y4H A;  3KX1 A;  1PE6 A;  4BSQ A;  4PP2 E;  3KSE A;  1EWO A;  1NL6 A;  3H89 A;  4GUZ A;  3K24 A;  1STF E;  1NPZ A;  3PNR A;  1KHP A;  2AUX A;  2VHS A;  2HXZ A;  2DZY A;  3H6S A;  1BQI A;  4QRV A;  1AYV A;  2AVW A;  1MS6 A;  2VFB A;  1AU3 A;  1FH0 A;  1ATK A;  3OIS A;  4NV7 A;  3CH2 X;  4P6G A;  1ME4 A;  1CV8 A;  4CDF B;  3N3K A;  1HUC B;  1PBH A;  2IPP B;  2FTD A;  4AXM A;  3BCN A;  4G54 A;  2DC6 A;  1GMY A;  1ME3 A;  2NQI A;  2DC7 A;  2ACT A;  1PCI A;  3MHS A;  1X9Y A;  1NQC A;  3E1Z B;  1PAD A;  7PCK A;  1GCB A;  1DF0 A;  2HD5 A;  2O6X A;  3OVZ A;  2PNS A;  3QSD A;  4FK5 A;  1QDQ A;  1VJV A;  2G6D A;  1PPP A;  4RY2 A;  2FYE A;  3N4C A;  1CB5 A;  3AI8 A;  1GX3 A;  4BS6 A;  3O0U A;  4YYV A;  1SNK A;  1AEC A;  1QMY A;  4DMX A;  1F2C A;  1MDW A;  2YJ9 A;  3RVX A;  3IHP A;  4OEM A;  5CHT A;  1U9W A;  4YYU A;  4KLB A;  3HHI A;  2Y6E A;  3IOQ A;  3P5V A;  2E01 A;  4YVA A;  5F02 A;  2FT2 A;  3K9M A;  3KWZ A;  1F29 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...