1MEGA

Crystal structure of a caricain d158e mutant in complex with e-64
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
216
structure length
216
Chain Sequence
LPENVDWRKKGAVTPVRHQGSCGSCWAFSAVATVEGINKIRTGKLVELSEQELVDCERRSHGCKGGYPPYALEYVAKNGIHLRSKYPYKAKQGTCRAKQVGGPIVKTSGVGRVQPNNEGNLLNAIAKQPVSVVVESKGRPFQLYKGGIFEGPCGTKVEHAVTAVGYGKSGGKGYILIKNSWGTAWGEKGYIRIKRAPGNSPGVCGLYKSSYYPTKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARICAIN
publication title Crystal structure of a caricain D158E mutant in complex with E-64.
pubmed doi rcsb
source organism Carica papaya
molecule tags Hydrolase
total genus 60
structure length 216
sequence length 216
ec nomenclature ec 3.4.22.30: Caricain.
pdb deposition date 1996-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1megA00
1KFXL 4MZOA 4DMYA 1GMYA 1KHPA 3GCBA 2AUZA 3RVVA 1CV8A 3WXEA 3WXFA 1ITOA 2NQAA 2AUXA 2OULA 4N79A 3PBHA 1EF7A 1NB5A 4X6HA 1NLJA 2HH5A 2XU5A 1MEGA 4AXLA 3P5VA 1U5IA 2YJ9A 1ATKA 3MHSA 2AYNA 2P7UA 1EWLA 1ZCMA 2NQIA 5JA7A 1AYWA 4QRXA 2DCDA 3ERVA 5EF4A 4XR7A 1AYVA 1JQPA 3K24A 4OELA 1TLOA 4FJCA 2R9FA 2DZZA 1U9WA 2DC6A 3H6SA 3HHAA 1K3BB 2F1GA 3IHPA 4YV8A 4PADA 3MTNA 3CBJA 4RY2A 3CBKA 1BY8A 2AIMA 3D6SA 4N8WA 4N4ZA 1MHWA 4I07A 2DCBA 2FUDA 3MHHA 4G54A 4W4UA 3M99A 2R9NA 4WA6A 1PPPA 3OF8A 4QRGA 3QSDA 2AS8A 4QRVA 2P86A 5CHVA 4CDEB 1PCIA 3BWKA 2DJGB 2YJBA 1STFE 3K8UA 1AU4A 2IPPB 3IOQA 1F2AA 1MIRA 3IMAA 5J94A 2PADA 1F2BA 1QXPA 1YK7A 2PREA 3H8CA 4PP1A 1THEA 1IWDA 2GHUA 2VHFA 3IEJA 1CJLA 5EGWA 3I3TA 3KFQA 3LFYA 1BGOA 1U9VA 3HD3A 1GCBA 4CDFB 3HHIA 4YYQA 1QDQA 1YVBA 2DCAA 3PW3A 2VHSA 3S3RA 5CHTA 2G6DA 3HWNA 1ZIVA 4YYRA 4YYUA 1PPNA 2NQDB 1ME4A 1Y4HA 2DC8A 2DCCA 1AU0A 3O1GA 1QOLA 2ACTA 1S4VA 3WXGA 2XU4A 3KKUA 3U8EA 5F02A 1VJVA 3P5WA 3BPMA 5JH3A 2P0RA 1CTEA 3BPFA 4I04A 2HHNA 1KFUL 2G8JA 1EWOA 2R9OA 3KWZA 4MZSA 4FIPA 1F29A 4DMXA 1MEMA 2YJ8A 2F7DA 2E01A 4AXMA 4KLBA 1A6RA 2FYEA 3IV2A 3TNXA 2Y5BA 1Y08A 3P5UA 4CZWA 2G7YA 3O0UA 1PPOA 3F75A 4I05A 1CB5A 2OZ2A 1EWMA 3KWBX 2OP3A 5PADA 1ME3A 3OVZA 5CVOB 2FQ9A 1PADA 3B79A 2HD5A 3BC3A 1GECE 3H89A 1KHQA 1QMYA 1U9QX 1AIMA 1AYUA 3LXSA 3KW9A 3OF9A 4YYVA 1M6DA 1EWPA 2PBHA 3IUTA 2DC7A 4CDDB 2B1MA 3KSEA 4YYSA 3QT4A 4ZUXU 2FRQA 4BS5A 1YALA 5A24A 2XU1A 1PE6A 4Q8GA 1PXVA 1F2CA 7PCKA 4BQVA 1CS8A 5FPWA 1PBHA 3N3KA 3BOWA 3N3GA 3DF0A 3H7DA 1ICFA 2R6NA 1YK8A 2AU1A 4BPVA 2XU3A 3E1ZB 1BP4A 4PI3A 4X6IA 4BSQA 3RVWA 1SP4B 2FTDA 4YVAA 3F5VA 3N4CA 1POPA 5CVMA 2YJCA 2JQFR 3H8BA 1BQIA 1PIPA 4PP2E 1O0EA 2WBFX 4K7CA 1NB3A 1GLOA 1CQDA 4HWYA 1NPZA 3CH3X 1TU6A 1PPDA 2NQGA 2B1NA 1SNKA 1CSBB 1YT7A 1CVZA 3V6CA 1VSNA 3V6EA 2DC9A 2PNSA 2IBIA 1XKGA 1NQCA 3BCNA 4QBBA 4QH6A 4BS6A 1HUCB 2FO5A 3ZUAA 4MSXA 3MORA 3K9MA 9PAPA 3QJ3A 4Q8HA 2HXZA 1AU2A 1MDWA 3KX1A 1DEUA 4YYWA 2DZYA 3USVA 1KXRA 4OEMA 2GFOA 2BDLA 2FT2A 1CPJA 4XUIA 5CVNB 1AU3A 3NHEA 5K16A 2ARYA 2G8EA 8PCHA 2O6XA 2E03A 3AI8A 4W5CA 2AYOA 1U9XA 1FH0A 2ATOA 3OISA 2E00A 1AECA 2JQGR 1TL9A 3P5XA 4P6GA 2CB5A 2Y6EA 1Q6KA 3RVXA 3PNRA 2CIOA 4W5BA 3C9EA 1MS6A 1NL6A 2FRAA 2R9CA 4P6EA 2BDZA 6PADA 4CDCB 2C0YA 3OVXA 3S3QA 3I06A 2AVWA 4FK5A 2E02A 1X9YA 3PDFA 2YJ2A 2DJFB 4X6JA 2H7JA 3CH2X 2R9MA 1DF0A
chains in the Genus database with same CATH superfamily
4A5UA 1KFXL 3OQCA 4MZOA 4DMYA 1GMYA 1KHPA 3GCBA 2AUZA 3RVVA 1CV8A 3WXEA 5EZSA 3WXFA 1ITOA 2NQAA 2JRIA 2AUXA 2OULA 4N79A 4P16A 3PBHA 1EF7A 1NB5A 4D8IA 4RF0A 1NLJA 2HH5A 2XU5A 4X6HA 1MEGA 4AXLA 3P5VA 3PHXA 1U5IA 2YJ9A 1ATKA 3MHSA 2AYNA 2P7UA 1EWLA 1ZCMA 2NQIA 2BU3A 5JA7A 1AYWA 4QRXA 2DCDA 3ERVA 2BTWA 5EZQA 5EF4A 4XR7A 4D8BA 2J7QC 1AYVA 3MTVA 1JQPA 3K24A 1PVJA 4OELA 1TLOA 4FJCA 2R9FA 2DZZA 3BB7A 1U9WA 2DC6A 3H6SA 3HHAA 1K3BB 2F1GA 3IHPA 4YV8A 4PADA 3MTNA 3CBJA 4RY2A 3CBKA 4IP3A 1BY8A 4ZTBA 2AIMA 3D6SA 4N8WA 4N4ZA 1MHWA 4I07A 2DCBA 3TRKA 2FUDA 3MHHA 4G54A 4W4UA 3M99A 2R9NA 4WA6A 1PPPA 3PRPA 3OF8A 4QRGA 3QSDA 2AS8A 3E9SA 4QRVA 2P86A 5CHVA 4CDEB 1PCIA 3BWKA 4RF1A 2DJGB 2YJBA 1STFE 3K8UA 1AU4A 2IPPB 3IOQA 1F2AA 1MIRA 3IMAA 5J94A 2PADA 1F2BA 1QXPA 1YK7A 4RKXA 2PREA 3H8CA 4PP1A 1THEA 1IWDA 2GHUA 2VHFA 3IEJA 1CJLA 5EGWA 3I3TA 4BOQA 3KFQA 3LFYA 1YZBA 4BOUA 3C0RA 1BGOA 1U9VA 3HD3A 1GCBA 4CDFB 3HHIA 4YYQA 1QDQA 1YVBA 2DCAA 3RNVA 3PW3A 2VHSA 3S3RA 5CHTA 3TMPA 2G6DA 3HWNA 1ZIVA 4YYRA 4YYUA 1PPNA 2NQDB 1ME4A 1Y4HA 2DC8A 2DCCA 1AU0A 3O1GA 1QOLA 2ACTA 1S4VA 2HWKA 3WXGA 2XU4A 4BOZA 3KKUA 3U8EA 5F02A 1VJVA 3P5WA 3BPMA 5JH3A 2P0RA 1CTEA 4REZA 3BPFA 4I04A 2HHNA 1KFUL 2BTWB 2G8JA 1EWOA 2R9OA 3W31A 3KWZA 4MZSA 4FIPA 1F29A 4DMXA 1MEMA 2YJ8A 2F7DA 2E01A 4AXMA 4KLBA 4D8EA 5KO3A 1A6RA 2FYEA 3IV2A 3TNXA 2Y5BA 1Y08A 3P5UA 4CZWA 2G7YA 3O0UA 3MJ5A 1PPOA 3F75A 4I05A 1CB5A 2OZ2A 1EWMA 3KWBX 2OP3A 5PADA 1ME3A 3OVZA 5CVOB 2FQ9A 1PADA 3B79A 2HD5A 3BC3A 3H89A 1GECE 2FE8A 1KHQA 1QMYA 1U9QX 1AIMA 5E6JA 1AYUA 3LXSA 3KW9A 3OF9A 4YYVA 1M6DA 1EWPA 4XZXA 2PBHA 3IUTA 2DC7A 4CDDB 2B1MA 3KSEA 4YYSA 3QT4A 4ZUXU 2FRQA 4BS5A 1YALA 5A24A 2XU1A 1PE6A 4Q8GA 1PXVA 1F2CA 7PCKA 4BQVA 1CS8A 5FPWA 1PBHA 3N3KA 3BOWA 3N3GA 3DF0A 3H7DA 4PT5A 1ICFA 2R6NA 1YK8A 2AU1A 4BPVA 2XU3A 3E1ZB 1BP4A 4PI3A 4X6IA 4BSQA 4R3DA 3RVWA 1SP4B 2FTDA 4YVAA 4BOPA 3F5VA 3N4CA 3MP2A 3BY4A 3PRMA 1POPA 5CVMA 2YJCA 2JQFR 3H8BA 1BQIA 1PIPA 3PSEA 4PP2E 1O0EA 2WBFX 4K7CA 1NB3A 1GLOA 1DKIA 1CQDA 4HWYA 1NPZA 3CH3X 1TU6A 1PPDA 2NQGA 2B1NA 1SNKA 1CSBB 1YT7A 1CVZA 3V6CA 4M0WA 3B21A 4BOSA 1VSNA 3BBAA 3V6EA 2DC9A 3W30A 2PNSA 2IBIA 1XKGA 4WURA 1NQCA 3BCNA 4QBBA 4QH6A 4BS6A 1HUCB 2FO5A 4IUMA 3ZUAA 4MSXA 3MORA 3K9MA 9PAPA 3QJ3A 4Q8HA 1UKFA 2HXZA 1AU2A 1MDWA 3KX1A 1DEUA 4YYWA 2DZYA 3USVA 2UZJA 1KXRA 4OEMA 2GFOA 2BDLA 2FT2A 1CPJA 3ZNHA 4XUIA 5CVNB 1AU3A 3NHEA 4OVZA 5K16A 2ARYA 2G8EA 8PCHA 4OVZB 4OW0A 2O6XA 2E03A 3AI8A 4W5CA 2AYOA 1U9XA 1FH0A 2ATOA 3O65A 4RNAA 3PHUA 3OISA 4GUAA 2E00A 1AECA 2JQGR 1TL9A 3P5XA 4P6GA 2CB5A 2J7QA 2Y6EA 1Q6KA 3RVXA 3PNRA 2CIOA 4W5BA 3C9EA 1MS6A 1NL6A 2FRAA 2R9CA 3IFUA 4P6EA 2BDZA 6PADA 4CDCB 2C0YA 3OVXA 4HXDB 3S3QA 3I06A 2DOSA 2AVWA 4FK5A 4MI7A 2E02A 1X9YA 5JZEA 2Z84A 3PT2A 3PDFA 2YJ2A 2DJFB 2AGAA 2JTCA 4X6JA 2H7JA 3CH2X 2R9MA 3PHWA 1DF0A 4MM3B
chains in the Genus database with same CATH topology
1KFXL 4MZOA 4DMYA 1GMYA 1KHPA 3GCBA 2AUZA 3RVVA 1CV8A 3WXEA 3WXFA 1ITOA 2NQAA 2AUXA 2OULA 4N79A 4GUZA 3PBHA 1EF7A 1NB5A 4X6HA 1NLJA 2HH5A 2XU5A 1MEGA 4AXLA 3P5VA 1U5IA 2YJ9A 1ATKA 3MHSA 2AYNA 2P7UA 1EWLA 1ZCMA 2NQIA 5JA7A 1AYWA 4QRXA 2DCDA 3ERVA 5EF4A 4XR7A 1AYVA 4B55A 1JQPA 3K24A 4OELA 1TLOA 4FJCA 2R9FA 2DZZA 1U9WA 2DC6A 3H6SA 3HHAA 1K3BB 2F1GA 3IHPA 4YV8A 4PADA 3MTNA 3CBJA 4RY2A 3CBKA 1BY8A 2AIMA 3D6SA 4N8WA 4N4ZA 1MHWA 4I07A 2DCBA 2FUDA 3MHHA 4G54A 4W4UA 3M99A 2R9NA 4WA6A 1PPPA 3OF8A 4QRGA 3QSDA 2AS8A 4QRVA 2P86A 5CHVA 4CDEB 1PCIA 3BWKA 2DJGB 2YJBA 1STFE 3K8UA 1AU4A 2IPPB 3IOQA 1F2AA 1MIRA 3IMAA 5J94A 2PADA 1F2BA 1QXPA 1YK7A 2PREA 3H8CA 4PP1A 1THEA 1IWDA 2GHUA 2VHFA 3IEJA 1CJLA 5EGWA 3I3TA 3KFQA 3LFYA 1BGOA 1U9VA 3HD3A 1GCBA 4CDFB 3HHIA 4YYQA 1QDQA 1YVBA 2DCAA 3PW3A 2VHSA 3S3RA 4NV8A 5CHTA 2G6DA 3HWNA 1ZIVA 4YYRA 4YYUA 1PPNA 2NQDB 1ME4A 1Y4HA 2DC8A 2DCCA 1AU0A 3O1GA 1QOLA 2ACTA 1S4VA 1W5RA 3WXGA 2XU4A 3KKUA 3U8EA 5F02A 1VJVA 3P5WA 3BPMA 5JH3A 4C5PA 2P0RA 1CTEA 3BPFA 4I04A 2HHNA 1KFUL 2G8JA 1EWOA 2R9OA 3KWZA 4NV7A 4MZSA 4FIPA 1F29A 2VFCA 4DMXA 1MEMA 2YJ8A 2F7DA 2E01A 4AXMA 4KLBA 1A6RA 2FYEA 3IV2A 3TNXA 2Y5BA 1Y08A 3P5UA 4CZWA 2G7YA 3O0UA 1PPOA 3F75A 4I05A 1CB5A 2OZ2A 1EWMA 3KWBX 2OP3A 5PADA 1ME3A 3OVZA 5CVOB 2FQ9A 1PADA 3B79A 2HD5A 3BC3A 1GECE 3H89A 1KHQA 1QMYA 1U9QX 1AIMA 1AYUA 3LXSA 3KW9A 3OF9A 4YYVA 1M6DA 1EWPA 2PBHA 3IUTA 2DC7A 4BGFA 4CDDB 2B1MA 3KSEA 2VFBA 4YYSA 3QT4A 4ZUXU 2FRQA 4BS5A 1YALA 5A24A 2XU1A 1GX3A 1PE6A 4Q8GA 1PXVA 1F2CA 7PCKA 4BQVA 1CS8A 5FPWA 1PBHA 3N3KA 3BOWA 3N3GA 3DF0A 3H7DA 1ICFA 2R6NA 1YK8A 2AU1A 4BPVA 2XU3A 3E1ZB 1BP4A 4PI3A 4X6IA 4BSQA 3RVWA 1SP4B 2FTDA 4YVAA 3F5VA 3N4CA 1POPA 5CVMA 2YJCA 2JQFR 3H8BA 1BQIA 1PIPA 4PP2E 1O0EA 1W6FA 1W4TA 2WBFX 4K7CA 1NB3A 1GLOA 1CQDA 4HWYA 1NPZA 3CH3X 1TU6A 1PPDA 2NQGA 2B1NA 1SNKA 1CSBB 1YT7A 1CVZA 3V6CA 1VSNA 3V6EA 2DC9A 1E2TA 2PNSA 2IBIA 1XKGA 1NQCA 3BCNA 4QBBA 4QH6A 4BS6A 1HUCB 2FO5A 3ZUAA 4MSXA 3MORA 3K9MA 9PAPA 3QJ3A 4Q8HA 2HXZA 1AU2A 1MDWA 3KX1A 1DEUA 2BSZA 4YYWA 2DZYA 3USVA 1KXRA 4OEMA 2GFOA 2BDLA 2FT2A 1CPJA 4XUIA 5CVNB 1AU3A 3NHEA 5K16A 2ARYA 2G8EA 8PCHA 2O6XA 2E03A 3AI8A 4W5CA 2AYOA 1U9XA 1FH0A 2ATOA 3OISA 2E00A 1AECA 2JQGR 1TL9A 3P5XA 4P6GA 2CB5A 2Y6EA 1Q6KA 3RVXA 3PNRA 2CIOA 4W5BA 3C9EA 3D9WA 1MS6A 1NL6A 2FRAA 2R9CA 4P6EA 2BDZA 6PADA 4CDCB 2C0YA 3OVXA 3S3QA 3I06A 2AVWA 4FK5A 2E02A 1X9YA 3PDFA 2YJ2A 2DJFB 4X6JA 3LTWA 2H7JA 3CH2X 2R9MA 1DF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KFX L;  4MZO A;  4DMY A;  1GMY A;  1KHP A;  3GCB A;  2AUZ A;  3RVV A;  1CV8 A;  3WXE A;  3WXF A;  1ITO A;  2NQA A;  2AUX A;  2OUL A;  4N79 A;  3PBH A;  1EF7 A;  1NB5 A;  4X6H A;  1NLJ A;  2HH5 A;  2XU5 A;  1MEG A;  4AXL A;  3P5V A;  1U5I A;  2YJ9 A;  1ATK A;  3MHS A;  2AYN A;  2P7U A;  1EWL A;  1ZCM A;  2NQI A;  5JA7 A;  1AYW A;  4QRX A;  2DCD A;  3ERV A;  5EF4 A;  4XR7 A;  1AYV A;  1JQP A;  3K24 A;  4OEL A;  1TLO A;  4FJC A;  2R9F A;  2DZZ A;  1U9W A;  2DC6 A;  3H6S A;  3HHA A;  1K3B B;  2F1G A;  3IHP A;  4YV8 A;  4PAD A;  3MTN A;  3CBJ A;  4RY2 A;  3CBK A;  1BY8 A;  2AIM A;  3D6S A;  4N8W A;  4N4Z A;  1MHW A;  4I07 A;  2DCB A;  2FUD A;  3MHH A;  4G54 A;  4W4U A;  3M99 A;  2R9N A;  4WA6 A;  1PPP A;  3OF8 A;  4QRG A;  3QSD A;  2AS8 A;  4QRV A;  2P86 A;  5CHV A;  4CDE B;  1PCI A;  3BWK A;  2DJG B;  2YJB A;  1STF E;  3K8U A;  1AU4 A;  2IPP B;  3IOQ A;  1F2A A;  1MIR A;  3IMA A;  5J94 A;  2PAD A;  1F2B A;  1QXP A;  1YK7 A;  2PRE A;  3H8C A;  4PP1 A;  1THE A;  1IWD A;  2GHU A;  2VHF A;  3IEJ A;  1CJL A;  5EGW A;  3I3T A;  3KFQ A;  3LFY A;  1BGO A;  1U9V A;  3HD3 A;  1GCB A;  4CDF B;  3HHI A;  4YYQ A;  1QDQ A;  1YVB A;  2DCA A;  3PW3 A;  2VHS A;  3S3R A;  5CHT A;  2G6D A;  3HWN A;  1ZIV A;  4YYR A;  4YYU A;  1PPN A;  2NQD B;  1ME4 A;  1Y4H A;  2DC8 A;  2DCC A;  1AU0 A;  3O1G A;  1QOL A;  2ACT A;  1S4V A;  3WXG A;  2XU4 A;  3KKU A;  3U8E A;  5F02 A;  1VJV A;  3P5W A;  3BPM A;  5JH3 A;  2P0R A;  1CTE A;  3BPF A;  4I04 A;  2HHN A;  1KFU L;  2G8J A;  1EWO A;  2R9O A;  3KWZ A;  4MZS A;  4FIP A;  1F29 A;  4DMX A;  1MEM A;  2YJ8 A;  2F7D A;  2E01 A;  4AXM A;  4KLB A;  1A6R A;  2FYE A;  3IV2 A;  3TNX A;  2Y5B A;  1Y08 A;  3P5U A;  4CZW A;  2G7Y A;  3O0U A;  1PPO A;  3F75 A;  4I05 A;  1CB5 A;  2OZ2 A;  1EWM A;  3KWB X;  2OP3 A;  5PAD A;  1ME3 A;  3OVZ A;  5CVO B;  2FQ9 A;  1PAD A;  3B79 A;  2HD5 A;  3BC3 A;  1GEC E;  3H89 A;  1KHQ A;  1QMY A;  1U9Q X;  1AIM A;  1AYU A;  3LXS A;  3KW9 A;  3OF9 A;  4YYV A;  1M6D A;  1EWP A;  2PBH A;  3IUT A;  2DC7 A;  4CDD B;  2B1M A;  3KSE A;  4YYS A;  3QT4 A;  4ZUX U;  2FRQ A;  4BS5 A;  1YAL A;  5A24 A;  2XU1 A;  1PE6 A;  4Q8G A;  1PXV A;  1F2C A;  7PCK A;  4BQV A;  1CS8 A;  5FPW A;  1PBH A;  3N3K A;  3BOW A;  3N3G A;  3DF0 A;  3H7D A;  1ICF A;  2R6N A;  1YK8 A;  2AU1 A;  4BPV A;  2XU3 A;  3E1Z B;  1BP4 A;  4PI3 A;  4X6I A;  4BSQ A;  3RVW A;  1SP4 B;  2FTD A;  4YVA A;  3F5V A;  3N4C A;  1POP A;  5CVM A;  2YJC A;  2JQF R;  3H8B A;  1BQI A;  1PIP A;  4PP2 E;  1O0E A;  2WBF X;  4K7C A;  1NB3 A;  1GLO A;  1CQD A;  4HWY A;  1NPZ A;  3CH3 X;  1TU6 A;  1PPD A;  2NQG A;  2B1N A;  1SNK A;  1CSB B;  1YT7 A;  1CVZ A;  3V6C A;  1VSN A;  3V6E A;  2DC9 A;  2PNS A;  2IBI A;  1XKG A;  1NQC A;  3BCN A;  4QBB A;  4QH6 A;  4BS6 A;  1HUC B;  2FO5 A;  3ZUA A;  4MSX A;  3MOR A;  3K9M A;  9PAP A;  3QJ3 A;  4Q8H A;  2HXZ A;  1AU2 A;  1MDW A;  3KX1 A;  1DEU A;  4YYW A;  2DZY A;  3USV A;  1KXR A;  4OEM A;  2GFO A;  2BDL A;  2FT2 A;  1CPJ A;  4XUI A;  5CVN B;  1AU3 A;  3NHE A;  5K16 A;  2ARY A;  2G8E A;  8PCH A;  2O6X A;  2E03 A;  3AI8 A;  4W5C A;  2AYO A;  1U9X A;  1FH0 A;  2ATO A;  3OIS A;  2E00 A;  1AEC A;  2JQG R;  1TL9 A;  3P5X A;  4P6G A;  2CB5 A;  2Y6E A;  1Q6K A;  3RVX A;  3PNR A;  2CIO A;  4W5B A;  3C9E A;  1MS6 A;  1NL6 A;  2FRA A;  2R9C A;  4P6E A;  2BDZ A;  6PAD A;  4CDC B;  2C0Y A;  3OVX A;  3S3Q A;  3I06 A;  2AVW A;  4FK5 A;  2E02 A;  1X9Y A;  3PDF A;  2YJ2 A;  2DJF B;  4X6J A;  2H7J A;  3CH2 X;  2R9M A;  1DF0 A; 
#chains in the Genus database with same CATH topology
 4A5U A;  1KFX L;  3OQC A;  4MZO A;  4DMY A;  1GMY A;  1KHP A;  3GCB A;  2AUZ A;  3RVV A;  1CV8 A;  3WXE A;  5EZS A;  3WXF A;  1ITO A;  2NQA A;  2JRI A;  2AUX A;  2OUL A;  4N79 A;  4P16 A;  3PBH A;  1EF7 A;  1NB5 A;  4D8I A;  4RF0 A;  1NLJ A;  2HH5 A;  2XU5 A;  4X6H A;  1MEG A;  4AXL A;  3P5V A;  3PHX A;  1U5I A;  2YJ9 A;  1ATK A;  3MHS A;  2AYN A;  2P7U A;  1EWL A;  1ZCM A;  2NQI A;  2BU3 A;  5JA7 A;  1AYW A;  4QRX A;  2DCD A;  3ERV A;  2BTW A;  5EZQ A;  5EF4 A;  4XR7 A;  4D8B A;  2J7Q C;  1AYV A;  3MTV A;  1JQP A;  3K24 A;  1PVJ A;  4OEL A;  1TLO A;  4FJC A;  2R9F A;  2DZZ A;  3BB7 A;  1U9W A;  2DC6 A;  3H6S A;  3HHA A;  1K3B B;  2F1G A;  3IHP A;  4YV8 A;  4PAD A;  3MTN A;  3CBJ A;  4RY2 A;  3CBK A;  4IP3 A;  1BY8 A;  4ZTB A;  2AIM A;  3D6S A;  4N8W A;  4N4Z A;  1MHW A;  4I07 A;  2DCB A;  3TRK A;  2FUD A;  3MHH A;  4G54 A;  4W4U A;  3M99 A;  2R9N A;  4WA6 A;  1PPP A;  3PRP A;  3OF8 A;  4QRG A;  3QSD A;  2AS8 A;  3E9S A;  4QRV A;  2P86 A;  5CHV A;  4CDE B;  1PCI A;  3BWK A;  4RF1 A;  2DJG B;  2YJB A;  1STF E;  3K8U A;  1AU4 A;  2IPP B;  3IOQ A;  1F2A A;  1MIR A;  3IMA A;  5J94 A;  2PAD A;  1F2B A;  1QXP A;  1YK7 A;  4RKX A;  2PRE A;  3H8C A;  4PP1 A;  1THE A;  1IWD A;  2GHU A;  2VHF A;  3IEJ A;  1CJL A;  5EGW A;  3I3T A;  4BOQ A;  3KFQ A;  3LFY A;  1YZB A;  4BOU A;  3C0R A;  1BGO A;  1U9V A;  3HD3 A;  1GCB A;  4CDF B;  3HHI A;  4YYQ A;  1QDQ A;  1YVB A;  2DCA A;  3RNV A;  3PW3 A;  2VHS A;  3S3R A;  5CHT A;  3TMP A;  2G6D A;  3HWN A;  1ZIV A;  4YYR A;  4YYU A;  1PPN A;  2NQD B;  1ME4 A;  1Y4H A;  2DC8 A;  2DCC A;  1AU0 A;  3O1G A;  1QOL A;  2ACT A;  1S4V A;  2HWK A;  3WXG A;  2XU4 A;  4BOZ A;  3KKU A;  3U8E A;  5F02 A;  1VJV A;  3P5W A;  3BPM A;  5JH3 A;  2P0R A;  1CTE A;  4REZ A;  3BPF A;  4I04 A;  2HHN A;  1KFU L;  2BTW B;  2G8J A;  1EWO A;  2R9O A;  3W31 A;  3KWZ A;  4MZS A;  4FIP A;  1F29 A;  4DMX A;  1MEM A;  2YJ8 A;  2F7D A;  2E01 A;  4AXM A;  4KLB A;  4D8E A;  5KO3 A;  1A6R A;  2FYE A;  3IV2 A;  3TNX A;  2Y5B A;  1Y08 A;  3P5U A;  4CZW A;  2G7Y A;  3O0U A;  3MJ5 A;  1PPO A;  3F75 A;  4I05 A;  1CB5 A;  2OZ2 A;  1EWM A;  3KWB X;  2OP3 A;  5PAD A;  1ME3 A;  3OVZ A;  5CVO B;  2FQ9 A;  1PAD A;  3B79 A;  2HD5 A;  3BC3 A;  3H89 A;  1GEC E;  2FE8 A;  1KHQ A;  1QMY A;  1U9Q X;  1AIM A;  5E6J A;  1AYU A;  3LXS A;  3KW9 A;  3OF9 A;  4YYV A;  1M6D A;  1EWP A;  4XZX A;  2PBH A;  3IUT A;  2DC7 A;  4CDD B;  2B1M A;  3KSE A;  4YYS A;  3QT4 A;  4ZUX U;  2FRQ A;  4BS5 A;  1YAL A;  5A24 A;  2XU1 A;  1PE6 A;  4Q8G A;  1PXV A;  1F2C A;  7PCK A;  4BQV A;  1CS8 A;  5FPW A;  1PBH A;  3N3K A;  3BOW A;  3N3G A;  3DF0 A;  3H7D A;  4PT5 A;  1ICF A;  2R6N A;  1YK8 A;  2AU1 A;  4BPV A;  2XU3 A;  3E1Z B;  1BP4 A;  4PI3 A;  4X6I A;  4BSQ A;  4R3D A;  3RVW A;  1SP4 B;  2FTD A;  4YVA A;  4BOP A;  3F5V A;  3N4C A;  3MP2 A;  3BY4 A;  3PRM A;  1POP A;  5CVM A;  2YJC A;  2JQF R;  3H8B A;  1BQI A;  1PIP A;  3PSE A;  4PP2 E;  1O0E A;  2WBF X;  4K7C A;  1NB3 A;  1GLO A;  1DKI A;  1CQD A;  4HWY A;  1NPZ A;  3CH3 X;  1TU6 A;  1PPD A;  2NQG A;  2B1N A;  1SNK A;  1CSB B;  1YT7 A;  1CVZ A;  3V6C A;  4M0W A;  3B21 A;  4BOS A;  1VSN A;  3BBA A;  3V6E A;  2DC9 A;  3W30 A;  2PNS A;  2IBI A;  1XKG A;  4WUR A;  1NQC A;  3BCN A;  4QBB A;  4QH6 A;  4BS6 A;  1HUC B;  2FO5 A;  4IUM A;  3ZUA A;  4MSX A;  3MOR A;  3K9M A;  9PAP A;  3QJ3 A;  4Q8H A;  1UKF A;  2HXZ A;  1AU2 A;  1MDW A;  3KX1 A;  1DEU A;  4YYW A;  2DZY A;  3USV A;  2UZJ A;  1KXR A;  4OEM A;  2GFO A;  2BDL A;  2FT2 A;  1CPJ A;  3ZNH A;  4XUI A;  5CVN B;  1AU3 A;  3NHE A;  4OVZ A;  5K16 A;  2ARY A;  2G8E A;  8PCH A;  4OVZ B;  4OW0 A;  2O6X A;  2E03 A;  3AI8 A;  4W5C A;  2AYO A;  1U9X A;  1FH0 A;  2ATO A;  3O65 A;  4RNA A;  3PHU A;  3OIS A;  4GUA A;  2E00 A;  1AEC A;  2JQG R;  1TL9 A;  3P5X A;  4P6G A;  2CB5 A;  2J7Q A;  2Y6E A;  1Q6K A;  3RVX A;  3PNR A;  2CIO A;  4W5B A;  3C9E A;  1MS6 A;  1NL6 A;  2FRA A;  2R9C A;  3IFU A;  4P6E A;  2BDZ A;  6PAD A;  4CDC B;  2C0Y A;  3OVX A;  4HXD B;  3S3Q A;  3I06 A;  2DOS A;  2AVW A;  4FK5 A;  4MI7 A;  2E02 A;  1X9Y A;  5JZE A;  2Z84 A;  3PT2 A;  3PDF A;  2YJ2 A;  2DJF B;  2AGA A;  2JTC A;  4X6J A;  2H7J A;  3CH2 X;  2R9M A;  3PHW A;  1DF0 A;  4MM3 B; 
#chains in the Genus database with same CATH homology
 1KFX L;  4MZO A;  4DMY A;  1GMY A;  1KHP A;  3GCB A;  2AUZ A;  3RVV A;  1CV8 A;  3WXE A;  3WXF A;  1ITO A;  2NQA A;  2AUX A;  2OUL A;  4N79 A;  4GUZ A;  3PBH A;  1EF7 A;  1NB5 A;  4X6H A;  1NLJ A;  2HH5 A;  2XU5 A;  1MEG A;  4AXL A;  3P5V A;  1U5I A;  2YJ9 A;  1ATK A;  3MHS A;  2AYN A;  2P7U A;  1EWL A;  1ZCM A;  2NQI A;  5JA7 A;  1AYW A;  4QRX A;  2DCD A;  3ERV A;  5EF4 A;  4XR7 A;  1AYV A;  4B55 A;  1JQP A;  3K24 A;  4OEL A;  1TLO A;  4FJC A;  2R9F A;  2DZZ A;  1U9W A;  2DC6 A;  3H6S A;  3HHA A;  1K3B B;  2F1G A;  3IHP A;  4YV8 A;  4PAD A;  3MTN A;  3CBJ A;  4RY2 A;  3CBK A;  1BY8 A;  2AIM A;  3D6S A;  4N8W A;  4N4Z A;  1MHW A;  4I07 A;  2DCB A;  2FUD A;  3MHH A;  4G54 A;  4W4U A;  3M99 A;  2R9N A;  4WA6 A;  1PPP A;  3OF8 A;  4QRG A;  3QSD A;  2AS8 A;  4QRV A;  2P86 A;  5CHV A;  4CDE B;  1PCI A;  3BWK A;  2DJG B;  2YJB A;  1STF E;  3K8U A;  1AU4 A;  2IPP B;  3IOQ A;  1F2A A;  1MIR A;  3IMA A;  5J94 A;  2PAD A;  1F2B A;  1QXP A;  1YK7 A;  2PRE A;  3H8C A;  4PP1 A;  1THE A;  1IWD A;  2GHU A;  2VHF A;  3IEJ A;  1CJL A;  5EGW A;  3I3T A;  3KFQ A;  3LFY A;  1BGO A;  1U9V A;  3HD3 A;  1GCB A;  4CDF B;  3HHI A;  4YYQ A;  1QDQ A;  1YVB A;  2DCA A;  3PW3 A;  2VHS A;  3S3R A;  4NV8 A;  5CHT A;  2G6D A;  3HWN A;  1ZIV A;  4YYR A;  4YYU A;  1PPN A;  2NQD B;  1ME4 A;  1Y4H A;  2DC8 A;  2DCC A;  1AU0 A;  3O1G A;  1QOL A;  2ACT A;  1S4V A;  1W5R A;  3WXG A;  2XU4 A;  3KKU A;  3U8E A;  5F02 A;  1VJV A;  3P5W A;  3BPM A;  5JH3 A;  4C5P A;  2P0R A;  1CTE A;  3BPF A;  4I04 A;  2HHN A;  1KFU L;  2G8J A;  1EWO A;  2R9O A;  3KWZ A;  4NV7 A;  4MZS A;  4FIP A;  1F29 A;  2VFC A;  4DMX A;  1MEM A;  2YJ8 A;  2F7D A;  2E01 A;  4AXM A;  4KLB A;  1A6R A;  2FYE A;  3IV2 A;  3TNX A;  2Y5B A;  1Y08 A;  3P5U A;  4CZW A;  2G7Y A;  3O0U A;  1PPO A;  3F75 A;  4I05 A;  1CB5 A;  2OZ2 A;  1EWM A;  3KWB X;  2OP3 A;  5PAD A;  1ME3 A;  3OVZ A;  5CVO B;  2FQ9 A;  1PAD A;  3B79 A;  2HD5 A;  3BC3 A;  1GEC E;  3H89 A;  1KHQ A;  1QMY A;  1U9Q X;  1AIM A;  1AYU A;  3LXS A;  3KW9 A;  3OF9 A;  4YYV A;  1M6D A;  1EWP A;  2PBH A;  3IUT A;  2DC7 A;  4BGF A;  4CDD B;  2B1M A;  3KSE A;  2VFB A;  4YYS A;  3QT4 A;  4ZUX U;  2FRQ A;  4BS5 A;  1YAL A;  5A24 A;  2XU1 A;  1GX3 A;  1PE6 A;  4Q8G A;  1PXV A;  1F2C A;  7PCK A;  4BQV A;  1CS8 A;  5FPW A;  1PBH A;  3N3K A;  3BOW A;  3N3G A;  3DF0 A;  3H7D A;  1ICF A;  2R6N A;  1YK8 A;  2AU1 A;  4BPV A;  2XU3 A;  3E1Z B;  1BP4 A;  4PI3 A;  4X6I A;  4BSQ A;  3RVW A;  1SP4 B;  2FTD A;  4YVA A;  3F5V A;  3N4C A;  1POP A;  5CVM A;  2YJC A;  2JQF R;  3H8B A;  1BQI A;  1PIP A;  4PP2 E;  1O0E A;  1W6F A;  1W4T A;  2WBF X;  4K7C A;  1NB3 A;  1GLO A;  1CQD A;  4HWY A;  1NPZ A;  3CH3 X;  1TU6 A;  1PPD A;  2NQG A;  2B1N A;  1SNK A;  1CSB B;  1YT7 A;  1CVZ A;  3V6C A;  1VSN A;  3V6E A;  2DC9 A;  1E2T A;  2PNS A;  2IBI A;  1XKG A;  1NQC A;  3BCN A;  4QBB A;  4QH6 A;  4BS6 A;  1HUC B;  2FO5 A;  3ZUA A;  4MSX A;  3MOR A;  3K9M A;  9PAP A;  3QJ3 A;  4Q8H A;  2HXZ A;  1AU2 A;  1MDW A;  3KX1 A;  1DEU A;  2BSZ A;  4YYW A;  2DZY A;  3USV A;  1KXR A;  4OEM A;  2GFO A;  2BDL A;  2FT2 A;  1CPJ A;  4XUI A;  5CVN B;  1AU3 A;  3NHE A;  5K16 A;  2ARY A;  2G8E A;  8PCH A;  2O6X A;  2E03 A;  3AI8 A;  4W5C A;  2AYO A;  1U9X A;  1FH0 A;  2ATO A;  3OIS A;  2E00 A;  1AEC A;  2JQG R;  1TL9 A;  3P5X A;  4P6G A;  2CB5 A;  2Y6E A;  1Q6K A;  3RVX A;  3PNR A;  2CIO A;  4W5B A;  3C9E A;  3D9W A;  1MS6 A;  1NL6 A;  2FRA A;  2R9C A;  4P6E A;  2BDZ A;  6PAD A;  4CDC B;  2C0Y A;  3OVX A;  3S3Q A;  3I06 A;  2AVW A;  4FK5 A;  2E02 A;  1X9Y A;  3PDF A;  2YJ2 A;  2DJF B;  4X6J A;  3LTW A;  2H7J A;  3CH2 X;  2R9M A;  1DF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...