1PBHA

Crystal structure of human recombinant procathepsin b at 3.2 angstrom resolution
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
317
structure length
317
Chain Sequence
MRSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Thiol protease
molecule keywords PROCATHEPSIN B
publication title Crystal structures of human procathepsin B at 3.2 and 3.3 Angstroms resolution reveal an interaction motif between a papain-like cysteine protease and its propeptide.
pubmed doi rcsb
source organism Homo sapiens
total genus 63
structure length 317
sequence length 317
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 1997-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
A PF08127 Propeptide_C1 Peptidase family C1 propeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1pbhA00
2E00A 3K8UA 2IBIA 1GECE 4CZWA 2Y6EA 4WA6A 4W5CA 1CS8A 5J94A 1BQIA 4G54A 1PPNA 3H7DA 1X9YA 2OZ2A 1ZCMA 2AIMA 3KWZA 1EWMA 1IWDA 2B1MA 4CDDB 2DCAA 3D6SA 2FO5A 5CVOB 1YK7A 2DCBA 3HD3A 4PADA 4X6HA 2E03A 3OF8A 2BDZA 3CBKA 5K16A 2NQDB 5F02A 4CDEB 1AYWA 2AYOA 1EWLA 3QSDA 2B1NA 5CVMA 1JQPA 2DC8A 4I05A 3USVA 1AECA 3CBJA 2DCCA 1YK8A 3KW9A 1U5IA 4BS6A 4PI3A 2HHNA 3H8BA 3B79A 4DMXA 4X6JA 2NQAA 1F2CA 2F7DA 2R9CA 1AIMA 4N79A 1MEMA 3IHPA 1GMYA 4X6IA 3GCBA 5JA7A 2DZYA 3V6EA 3WXEA 2YJ9A 2F1GA 3KSEA 3P5WA 2PREA 2FT2A 1EWOA 1NB3A 2O6XA 1CQDA 3IOQA 1F2BA 2YJCA 4MZOA 4W4UA 1ZIVA 2NQIA 1AU3A 1F2AA 1BGOA 1FH0A 2WBFX 4FJCA 3PNRA 3S3RA 4BPVA 2GFOA 4Q8GA 2P86A 2AS8A 4ZUXU 3KX1A 1NL6A 1AU0A 3ERVA 2VHFA 4PP1A 2DC6A 4FK5A 4YYWA 1SNKA 1TL9A 4QRGA 1PXVA 2XU4A 1YT7A 3K24A 4I07A 2PBHA 4KLBA 1KHPA 3O1GA 1PIPA 4QRXA 1PPPA 2ACTA 1CSBB 4YYSA 4AXMA 4XUIA 1VSNA 1Y08A 2E02A 5CVNB 4CDFB 2G8JA 4QH6A 2G8EA 2XU5A 3KKUA 2R6NA 4YYVA 4PP2E 4I04A 4YYRA 1NPZA 2FRAA 2OULA 3P5XA 3N4CA 1BY8A 3O0UA 5EGWA 4YV8A 1AU4A 8PCHA 3WXFA 1CJLA 2JQFR 3DF0A 4MZSA 1EWPA 3QJ3A 5EF4A 1GCBA 1MEGA 2HXZA 3M99A 3P5UA 3QT4A 4RY2A 3PBHA 5PADA 7PCKA 1MIRA 1PPDA 3BWKA 2ARYA 1POPA 1S4VA 2VHSA 4W5BA 1XKGA 4BS5A 2DJGB 3MORA 1Y4HA 1BP4A 3H6SA 4BQVA 4OEMA 2OP3A 3IUTA 2HD5A 1AU2A 4YYQA 2JQGR 3MHSA 3ZUAA 1PBHA 1KFUL 1U9QX 3H89A 3HHIA 2ATOA 3RVWA 3F5VA 4QRVA 2R9MA 1NLJA 1CPJA 4P6GA 3H8CA 3U8EA 2R9OA 2P0RA 1CV8A 2AVWA 3IEJA 2DCDA 4YVAA 3KWBX 3P5VA 3LXSA 1QXPA 1U9XA 2R9NA 1TU6A 3C9EA 1YALA 4QBBA 2XU3A 1KXRA 5FPWA 1U9WA 2NQGA 5A24A 1KHQA 5CHTA 1MHWA 9PAPA 3LFYA 2DC7A 3AI8A 3N3GA 3IMAA 4OELA 2H7JA 1PE6A 1KFXL 1QMYA 1ME3A 1SP4B 4CDCB 3NHEA 3BOWA 1EF7A 4N8WA 1GLOA 1AYUA 3MTNA 1M6DA 2YJ8A 1ME4A 2AU1A 1DF0A 1Q6KA 3MHHA 1PCIA 1PADA 2G6DA 4HWYA 2XU1A 4Q8HA 4BSQA 2DJFB 1TLOA 3V6CA 3OISA 1HUCB 2GHUA 1DEUA 2DC9A 1QOLA 2R9FA 4N4ZA 1A6RA 2FUDA 4DMYA 3BPMA 1MDWA 3PW3A 3OVZA 3K9MA 2FYEA 2C0YA 3WXGA 2P7UA 2PADA 1U9VA 2CB5A 2FRQA 1THEA 4FIPA 3HWNA 1CTEA 1PPOA 2E01A 2PNSA 4XR7A 3S3QA 2BDLA 3E1ZB 1O0EA 3CH3X 3BCNA 3OF9A 1STFE 5JH3A 3HHAA 2Y5BA 1ITOA 1F29A 1ICFA 1ATKA 4P6EA 4AXLA 3BPFA 1NQCA 1CVZA 3OVXA 1YVBA 1CB5A 3TNXA 3KFQA 3IV2A 3F75A 3PDFA 1QDQA 3I06A 2IPPB 1VJVA 4YYUA 4MSXA 1AYVA 2YJBA 1K3BB 2YJ2A 2G7YA 2AUXA 3RVXA 3N3KA 3I3TA 2FTDA 3RVVA 1MS6A 3BC3A 3CH2X 2FQ9A 2AYNA 6PADA 5CHVA 2DZZA 2AUZA 1NB5A 4K7CA 2CIOA 2HH5A
chains in the Genus database with same CATH superfamily
2E00A 3K8UA 2IBIA 3BY4A 1GECE 4CZWA 2Y6EA 4WA6A 4W5CA 3TMPA 1CS8A 3PHXA 5J94A 1BQIA 4G54A 1PPNA 3H7DA 1X9YA 2OZ2A 1ZCMA 3E9SA 2AIMA 3KWZA 4HXDB 1EWMA 1IWDA 5EZQA 2B1MA 4CDDB 2DCAA 3D6SA 2FO5A 5CVOB 1YK7A 2DCBA 3HD3A 4PADA 4X6HA 2E03A 3OF8A 2UZJA 2BDZA 4R3DA 3CBKA 5K16A 2BU3A 2NQDB 5F02A 4CDEB 1AYWA 2AYOA 1EWLA 3QSDA 2B1NA 5CVMA 4D8IA 1JQPA 2DC8A 4I05A 4OW0A 3USVA 1AECA 3IFUA 3CBJA 2DCCA 2JRIA 1YK8A 2AGAA 3KW9A 1U5IA 4BS6A 4PI3A 2HHNA 3H8BA 3B79A 4DMXA 4X6JA 2NQAA 1F2CA 2F7DA 2R9CA 1AIMA 1MEMA 4N79A 3IHPA 1GMYA 3RNVA 4X6IA 3GCBA 5JA7A 2DZYA 3V6EA 3WXEA 2YJ9A 2F1GA 3KSEA 3P5WA 5E6JA 2PREA 2FT2A 1EWOA 1NB3A 2O6XA 3TRKA 3C0RA 1CQDA 3IOQA 1F2BA 2YJCA 4MZOA 4BOQA 4W4UA 1ZIVA 2BTWB 1AU3A 2NQIA 1F2AA 3PHWA 1BGOA 1FH0A 2WBFX 4FJCA 3PNRA 3S3RA 4RF1A 4BPVA 2GFOA 4Q8GA 2P86A 2AS8A 4ZUXU 4RKXA 4XZXA 3KX1A 3MP2A 1NL6A 1AU0A 3ERVA 2VHFA 4PP1A 2DC6A 4FK5A 4YYWA 1SNKA 1TL9A 4QRGA 1PXVA 2XU4A 1YT7A 3K24A 4I07A 2PBHA 4KLBA 1KHPA 3O1GA 1PIPA 4QRXA 1PPPA 2ACTA 1CSBB 4YYSA 4AXMA 4XUIA 1VSNA 1Y08A 2E02A 4MI7A 5CVNB 4CDFB 2G8JA 4QH6A 2DOSA 2G8EA 2XU5A 3KKUA 2R6NA 4YYVA 4PP2E 4I04A 4YYRA 1NPZA 2FRAA 4GUAA 2OULA 3P5XA 3N4CA 1BY8A 4A5UA 4BOSA 3O0UA 5EGWA 4YV8A 1AU4A 8PCHA 3WXFA 1CJLA 2JQFR 3DF0A 4MZSA 1EWPA 4REZA 3QJ3A 5EF4A 1GCBA 2BTWA 2J7QC 4WURA 1MEGA 4MM3B 2HXZA 3M99A 3P5UA 3QT4A 4RY2A 5EZSA 3PBHA 5PADA 7PCKA 1MIRA 1PPDA 3BWKA 2ARYA 1POPA 1S4VA 2VHSA 2Z84A 4W5BA 1XKGA 4BS5A 2DJGB 3MORA 1Y4HA 1BP4A 3H6SA 4BQVA 4OEMA 2OP3A 3IUTA 2HD5A 1AU2A 4YYQA 2JQGR 3MHSA 3ZUAA 2HWKA 1PBHA 4RF0A 1KFUL 1U9QX 4BOUA 3H89A 3HHIA 2ATOA 3RVWA 3F5VA 4QRVA 3MTVA 2R9MA 1NLJA 1CPJA 4P6GA 3PT2A 3H8CA 3U8EA 2R9OA 2P0RA 1CV8A 2AVWA 3PRPA 3IEJA 4D8EA 2DCDA 4YVAA 3KWBX 3P5VA 4D8BA 3LXSA 1QXPA 1U9XA 2R9NA 1TU6A 3C9EA 1YALA 4QBBA 4IP3A 2XU3A 1KXRA 5FPWA 1U9WA 2NQGA 5A24A 1KHQA 5CHTA 1MHWA 9PAPA 3LFYA 2DC7A 3AI8A 3N3GA 3IMAA 4OELA 2H7JA 1PE6A 1KFXL 1QMYA 1ME3A 1PVJA 1SP4B 4CDCB 3B21A 4BOPA 3NHEA 3BOWA 1EF7A 1GLOA 4N8WA 1AYUA 3MTNA 1M6DA 2YJ8A 1ME4A 2AU1A 1DF0A 1Q6KA 3ZNHA 3MHHA 1PCIA 1PADA 2JTCA 2G6DA 4HWYA 2XU1A 4Q8HA 4BSQA 2DJFB 1TLOA 3W31A 3V6CA 3O65A 3OISA 1HUCB 2GHUA 1DEUA 2DC9A 3PRMA 1QOLA 3W30A 2R9FA 4N4ZA 1A6RA 2FUDA 4DMYA 3BPMA 1MDWA 3PW3A 1YZBA 3OVZA 3K9MA 2FYEA 2C0YA 4IUMA 3PHUA 1DKIA 3WXGA 2P7UA 2PADA 3BB7A 1U9VA 2CB5A 2FRQA 4OVZA 5KO3A 4M0WA 1THEA 4PT5A 4FIPA 3BBAA 3HWNA 1CTEA 1PPOA 2E01A 2PNSA 4XR7A 3S3QA 2BDLA 2J7QA 3E1ZB 1O0EA 3CH3X 3BCNA 3PSEA 3OF9A 1STFE 5JH3A 1UKFA 3HHAA 2Y5BA 1ITOA 3OQCA 1F29A 5JZEA 1ICFA 1ATKA 4P6EA 4AXLA 3BPFA 4BOZA 1NQCA 1CVZA 3OVXA 4OVZB 3MJ5A 1YVBA 1CB5A 4ZTBA 3TNXA 3KFQA 3IV2A 4RNAA 3F75A 3PDFA 1QDQA 3I06A 2IPPB 1VJVA 4YYUA 4MSXA 1AYVA 2YJBA 1K3BB 2YJ2A 2G7YA 2AUXA 3RVXA 3N3KA 3I3TA 2FTDA 3RVVA 1MS6A 3BC3A 3CH2X 2FQ9A 2AYNA 6PADA 5CHVA 2DZZA 2AUZA 1NB5A 2FE8A 4K7CA 2CIOA 2HH5A 4P16A
chains in the Genus database with same CATH topology
2E00A 3K8UA 2IBIA 1GECE 4CZWA 2Y6EA 4WA6A 4W5CA 1CS8A 5J94A 1BQIA 4G54A 1PPNA 3H7DA 1X9YA 2OZ2A 1ZCMA 2AIMA 3KWZA 1EWMA 1IWDA 2B1MA 4CDDB 2DCAA 3D6SA 4BGFA 2FO5A 5CVOB 1YK7A 2DCBA 3HD3A 4PADA 4X6HA 2E03A 3OF8A 2BDZA 3CBKA 5K16A 2NQDB 5F02A 4CDEB 1AYWA 2AYOA 1EWLA 3QSDA 2B1NA 5CVMA 1JQPA 2DC8A 4I05A 3LTWA 3USVA 1AECA 3CBJA 2DCCA 1W5RA 1YK8A 3KW9A 1U5IA 4BS6A 4PI3A 2HHNA 3H8BA 3B79A 4DMXA 4X6JA 2NQAA 1F2CA 2F7DA 2R9CA 1AIMA 4N79A 1MEMA 3IHPA 1GMYA 4X6IA 3GCBA 5JA7A 2DZYA 3V6EA 3WXEA 2YJ9A 2F1GA 3KSEA 3P5WA 2PREA 2FT2A 1EWOA 1NB3A 2O6XA 4NV8A 1CQDA 3IOQA 1F2BA 2YJCA 4MZOA 4W4UA 1ZIVA 2NQIA 1AU3A 1F2AA 1BGOA 1FH0A 4NV7A 2WBFX 4FJCA 3PNRA 3S3RA 4BPVA 2GFOA 4Q8GA 2P86A 2AS8A 4ZUXU 3KX1A 1NL6A 1AU0A 3ERVA 2VHFA 4PP1A 2DC6A 4FK5A 4YYWA 1SNKA 1TL9A 4QRGA 1PXVA 2XU4A 1YT7A 3K24A 4I07A 2PBHA 4KLBA 1KHPA 3O1GA 1PIPA 4QRXA 1PPPA 2ACTA 1CSBB 4YYSA 4AXMA 4XUIA 1VSNA 1Y08A 2E02A 5CVNB 4CDFB 2G8JA 4QH6A 2G8EA 2XU5A 1GX3A 3KKUA 2R6NA 4YYVA 4PP2E 4I04A 4YYRA 1NPZA 2FRAA 2OULA 3P5XA 3N4CA 1BY8A 3O0UA 5EGWA 4YV8A 1AU4A 8PCHA 3WXFA 1CJLA 2JQFR 3DF0A 4MZSA 1EWPA 3QJ3A 5EF4A 1GCBA 1MEGA 2HXZA 3M99A 3P5UA 3QT4A 4RY2A 3PBHA 5PADA 7PCKA 1MIRA 1PPDA 3BWKA 2ARYA 1POPA 1S4VA 2VHSA 4W5BA 1XKGA 4BS5A 2DJGB 3MORA 1Y4HA 1BP4A 3H6SA 4BQVA 4OEMA 2OP3A 3IUTA 2HD5A 1AU2A 4YYQA 2JQGR 3MHSA 3ZUAA 1PBHA 1KFUL 1U9QX 2VFBA 3H89A 3HHIA 2ATOA 3RVWA 3F5VA 4QRVA 2R9MA 1NLJA 1CPJA 4P6GA 3H8CA 3U8EA 2R9OA 2P0RA 1CV8A 2AVWA 3IEJA 2DCDA 4YVAA 3KWBX 3P5VA 3LXSA 1QXPA 1U9XA 2R9NA 1TU6A 3C9EA 1YALA 4QBBA 2XU3A 1KXRA 5FPWA 1U9WA 2NQGA 5A24A 1KHQA 5CHTA 1MHWA 9PAPA 3LFYA 2DC7A 3AI8A 3N3GA 3IMAA 4OELA 2H7JA 1PE6A 1KFXL 1QMYA 1ME3A 1SP4B 2VFCA 4CDCB 3NHEA 3BOWA 1EF7A 4N8WA 1GLOA 1AYUA 3MTNA 1M6DA 2YJ8A 1ME4A 2AU1A 1DF0A 1Q6KA 3MHHA 1PCIA 1PADA 2G6DA 4C5PA 4HWYA 2XU1A 4Q8HA 4BSQA 2DJFB 1TLOA 3V6CA 3OISA 1HUCB 4B55A 2GHUA 1DEUA 2DC9A 1QOLA 2R9FA 4N4ZA 1A6RA 2FUDA 4DMYA 3BPMA 1MDWA 3PW3A 3OVZA 3K9MA 2FYEA 2C0YA 3WXGA 1W6FA 2P7UA 2PADA 1U9VA 2CB5A 2FRQA 1W4TA 1THEA 4FIPA 3HWNA 1CTEA 1PPOA 2E01A 2PNSA 4XR7A 3S3QA 2BDLA 3E1ZB 1O0EA 3CH3X 3BCNA 3OF9A 1STFE 5JH3A 3HHAA 2Y5BA 1ITOA 1F29A 1ICFA 1ATKA 4P6EA 4AXLA 3BPFA 1NQCA 1CVZA 3OVXA 4GUZA 1YVBA 1CB5A 3TNXA 3KFQA 3IV2A 3F75A 3PDFA 1QDQA 3I06A 2IPPB 1VJVA 4YYUA 4MSXA 1AYVA 2YJBA 1K3BB 2YJ2A 2G7YA 2AUXA 3RVXA 3N3KA 3I3TA 2FTDA 3RVVA 1MS6A 3BC3A 3CH2X 2FQ9A 2AYNA 6PADA 5CHVA 1E2TA 2DZZA 2AUZA 1NB5A 4K7CA 2CIOA 3D9WA 2BSZA 2HH5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E00 A;  3K8U A;  2IBI A;  1GEC E;  4CZW A;  2Y6E A;  4WA6 A;  4W5C A;  1CS8 A;  5J94 A;  1BQI A;  4G54 A;  1PPN A;  3H7D A;  1X9Y A;  2OZ2 A;  1ZCM A;  2AIM A;  3KWZ A;  1EWM A;  1IWD A;  2B1M A;  4CDD B;  2DCA A;  3D6S A;  2FO5 A;  5CVO B;  1YK7 A;  2DCB A;  3HD3 A;  4PAD A;  4X6H A;  2E03 A;  3OF8 A;  2BDZ A;  3CBK A;  5K16 A;  2NQD B;  5F02 A;  4CDE B;  1AYW A;  2AYO A;  1EWL A;  3QSD A;  2B1N A;  5CVM A;  1JQP A;  2DC8 A;  4I05 A;  3USV A;  1AEC A;  3CBJ A;  2DCC A;  1YK8 A;  3KW9 A;  1U5I A;  4BS6 A;  4PI3 A;  2HHN A;  3H8B A;  3B79 A;  4DMX A;  4X6J A;  2NQA A;  1F2C A;  2F7D A;  2R9C A;  1AIM A;  4N79 A;  1MEM A;  3IHP A;  1GMY A;  4X6I A;  3GCB A;  5JA7 A;  2DZY A;  3V6E A;  3WXE A;  2YJ9 A;  2F1G A;  3KSE A;  3P5W A;  2PRE A;  2FT2 A;  1EWO A;  1NB3 A;  2O6X A;  1CQD A;  3IOQ A;  1F2B A;  2YJC A;  4MZO A;  4W4U A;  1ZIV A;  2NQI A;  1AU3 A;  1F2A A;  1BGO A;  1FH0 A;  2WBF X;  4FJC A;  3PNR A;  3S3R A;  4BPV A;  2GFO A;  4Q8G A;  2P86 A;  2AS8 A;  4ZUX U;  3KX1 A;  1NL6 A;  1AU0 A;  3ERV A;  2VHF A;  4PP1 A;  2DC6 A;  4FK5 A;  4YYW A;  1SNK A;  1TL9 A;  4QRG A;  1PXV A;  2XU4 A;  1YT7 A;  3K24 A;  4I07 A;  2PBH A;  4KLB A;  1KHP A;  3O1G A;  1PIP A;  4QRX A;  1PPP A;  2ACT A;  1CSB B;  4YYS A;  4AXM A;  4XUI A;  1VSN A;  1Y08 A;  2E02 A;  5CVN B;  4CDF B;  2G8J A;  4QH6 A;  2G8E A;  2XU5 A;  3KKU A;  2R6N A;  4YYV A;  4PP2 E;  4I04 A;  4YYR A;  1NPZ A;  2FRA A;  2OUL A;  3P5X A;  3N4C A;  1BY8 A;  3O0U A;  5EGW A;  4YV8 A;  1AU4 A;  8PCH A;  3WXF A;  1CJL A;  2JQF R;  3DF0 A;  4MZS A;  1EWP A;  3QJ3 A;  5EF4 A;  1GCB A;  1MEG A;  2HXZ A;  3M99 A;  3P5U A;  3QT4 A;  4RY2 A;  3PBH A;  5PAD A;  7PCK A;  1MIR A;  1PPD A;  3BWK A;  2ARY A;  1POP A;  1S4V A;  2VHS A;  4W5B A;  1XKG A;  4BS5 A;  2DJG B;  3MOR A;  1Y4H A;  1BP4 A;  3H6S A;  4BQV A;  4OEM A;  2OP3 A;  3IUT A;  2HD5 A;  1AU2 A;  4YYQ A;  2JQG R;  3MHS A;  3ZUA A;  1PBH A;  1KFU L;  1U9Q X;  3H89 A;  3HHI A;  2ATO A;  3RVW A;  3F5V A;  4QRV A;  2R9M A;  1NLJ A;  1CPJ A;  4P6G A;  3H8C A;  3U8E A;  2R9O A;  2P0R A;  1CV8 A;  2AVW A;  3IEJ A;  2DCD A;  4YVA A;  3KWB X;  3P5V A;  3LXS A;  1QXP A;  1U9X A;  2R9N A;  1TU6 A;  3C9E A;  1YAL A;  4QBB A;  2XU3 A;  1KXR A;  5FPW A;  1U9W A;  2NQG A;  5A24 A;  1KHQ A;  5CHT A;  1MHW A;  9PAP A;  3LFY A;  2DC7 A;  3AI8 A;  3N3G A;  3IMA A;  4OEL A;  2H7J A;  1PE6 A;  1KFX L;  1QMY A;  1ME3 A;  1SP4 B;  4CDC B;  3NHE A;  3BOW A;  1EF7 A;  4N8W A;  1GLO A;  1AYU A;  3MTN A;  1M6D A;  2YJ8 A;  1ME4 A;  2AU1 A;  1DF0 A;  1Q6K A;  3MHH A;  1PCI A;  1PAD A;  2G6D A;  4HWY A;  2XU1 A;  4Q8H A;  4BSQ A;  2DJF B;  1TLO A;  3V6C A;  3OIS A;  1HUC B;  2GHU A;  1DEU A;  2DC9 A;  1QOL A;  2R9F A;  4N4Z A;  1A6R A;  2FUD A;  4DMY A;  3BPM A;  1MDW A;  3PW3 A;  3OVZ A;  3K9M A;  2FYE A;  2C0Y A;  3WXG A;  2P7U A;  2PAD A;  1U9V A;  2CB5 A;  2FRQ A;  1THE A;  4FIP A;  3HWN A;  1CTE A;  1PPO A;  2E01 A;  2PNS A;  4XR7 A;  3S3Q A;  2BDL A;  3E1Z B;  1O0E A;  3CH3 X;  3BCN A;  3OF9 A;  1STF E;  5JH3 A;  3HHA A;  2Y5B A;  1ITO A;  1F29 A;  1ICF A;  1ATK A;  4P6E A;  4AXL A;  3BPF A;  1NQC A;  1CVZ A;  3OVX A;  1YVB A;  1CB5 A;  3TNX A;  3KFQ A;  3IV2 A;  3F75 A;  3PDF A;  1QDQ A;  3I06 A;  2IPP B;  1VJV A;  4YYU A;  4MSX A;  1AYV A;  2YJB A;  1K3B B;  2YJ2 A;  2G7Y A;  2AUX A;  3RVX A;  3N3K A;  3I3T A;  2FTD A;  3RVV A;  1MS6 A;  3BC3 A;  3CH2 X;  2FQ9 A;  2AYN A;  6PAD A;  5CHV A;  2DZZ A;  2AUZ A;  1NB5 A;  4K7C A;  2CIO A;  2HH5 A; 
#chains in the Genus database with same CATH topology
 2E00 A;  3K8U A;  2IBI A;  3BY4 A;  1GEC E;  4CZW A;  2Y6E A;  4WA6 A;  4W5C A;  3TMP A;  1CS8 A;  3PHX A;  5J94 A;  1BQI A;  4G54 A;  1PPN A;  3H7D A;  1X9Y A;  2OZ2 A;  1ZCM A;  3E9S A;  2AIM A;  3KWZ A;  4HXD B;  1EWM A;  1IWD A;  5EZQ A;  2B1M A;  4CDD B;  2DCA A;  3D6S A;  2FO5 A;  5CVO B;  1YK7 A;  2DCB A;  3HD3 A;  4PAD A;  4X6H A;  2E03 A;  3OF8 A;  2UZJ A;  2BDZ A;  4R3D A;  3CBK A;  5K16 A;  2BU3 A;  2NQD B;  5F02 A;  4CDE B;  1AYW A;  2AYO A;  1EWL A;  3QSD A;  2B1N A;  5CVM A;  4D8I A;  1JQP A;  2DC8 A;  4I05 A;  4OW0 A;  3USV A;  1AEC A;  3IFU A;  3CBJ A;  2DCC A;  2JRI A;  1YK8 A;  2AGA A;  3KW9 A;  1U5I A;  4BS6 A;  4PI3 A;  2HHN A;  3H8B A;  3B79 A;  4DMX A;  4X6J A;  2NQA A;  1F2C A;  2F7D A;  2R9C A;  1AIM A;  1MEM A;  4N79 A;  3IHP A;  1GMY A;  3RNV A;  4X6I A;  3GCB A;  5JA7 A;  2DZY A;  3V6E A;  3WXE A;  2YJ9 A;  2F1G A;  3KSE A;  3P5W A;  5E6J A;  2PRE A;  2FT2 A;  1EWO A;  1NB3 A;  2O6X A;  3TRK A;  3C0R A;  1CQD A;  3IOQ A;  1F2B A;  2YJC A;  4MZO A;  4BOQ A;  4W4U A;  1ZIV A;  2BTW B;  1AU3 A;  2NQI A;  1F2A A;  3PHW A;  1BGO A;  1FH0 A;  2WBF X;  4FJC A;  3PNR A;  3S3R A;  4RF1 A;  4BPV A;  2GFO A;  4Q8G A;  2P86 A;  2AS8 A;  4ZUX U;  4RKX A;  4XZX A;  3KX1 A;  3MP2 A;  1NL6 A;  1AU0 A;  3ERV A;  2VHF A;  4PP1 A;  2DC6 A;  4FK5 A;  4YYW A;  1SNK A;  1TL9 A;  4QRG A;  1PXV A;  2XU4 A;  1YT7 A;  3K24 A;  4I07 A;  2PBH A;  4KLB A;  1KHP A;  3O1G A;  1PIP A;  4QRX A;  1PPP A;  2ACT A;  1CSB B;  4YYS A;  4AXM A;  4XUI A;  1VSN A;  1Y08 A;  2E02 A;  4MI7 A;  5CVN B;  4CDF B;  2G8J A;  4QH6 A;  2DOS A;  2G8E A;  2XU5 A;  3KKU A;  2R6N A;  4YYV A;  4PP2 E;  4I04 A;  4YYR A;  1NPZ A;  2FRA A;  4GUA A;  2OUL A;  3P5X A;  3N4C A;  1BY8 A;  4A5U A;  4BOS A;  3O0U A;  5EGW A;  4YV8 A;  1AU4 A;  8PCH A;  3WXF A;  1CJL A;  2JQF R;  3DF0 A;  4MZS A;  1EWP A;  4REZ A;  3QJ3 A;  5EF4 A;  1GCB A;  2BTW A;  2J7Q C;  4WUR A;  1MEG A;  4MM3 B;  2HXZ A;  3M99 A;  3P5U A;  3QT4 A;  4RY2 A;  5EZS A;  3PBH A;  5PAD A;  7PCK A;  1MIR A;  1PPD A;  3BWK A;  2ARY A;  1POP A;  1S4V A;  2VHS A;  2Z84 A;  4W5B A;  1XKG A;  4BS5 A;  2DJG B;  3MOR A;  1Y4H A;  1BP4 A;  3H6S A;  4BQV A;  4OEM A;  2OP3 A;  3IUT A;  2HD5 A;  1AU2 A;  4YYQ A;  2JQG R;  3MHS A;  3ZUA A;  2HWK A;  1PBH A;  4RF0 A;  1KFU L;  1U9Q X;  4BOU A;  3H89 A;  3HHI A;  2ATO A;  3RVW A;  3F5V A;  4QRV A;  3MTV A;  2R9M A;  1NLJ A;  1CPJ A;  4P6G A;  3PT2 A;  3H8C A;  3U8E A;  2R9O A;  2P0R A;  1CV8 A;  2AVW A;  3PRP A;  3IEJ A;  4D8E A;  2DCD A;  4YVA A;  3KWB X;  3P5V A;  4D8B A;  3LXS A;  1QXP A;  1U9X A;  2R9N A;  1TU6 A;  3C9E A;  1YAL A;  4QBB A;  4IP3 A;  2XU3 A;  1KXR A;  5FPW A;  1U9W A;  2NQG A;  5A24 A;  1KHQ A;  5CHT A;  1MHW A;  9PAP A;  3LFY A;  2DC7 A;  3AI8 A;  3N3G A;  3IMA A;  4OEL A;  2H7J A;  1PE6 A;  1KFX L;  1QMY A;  1ME3 A;  1PVJ A;  1SP4 B;  4CDC B;  3B21 A;  4BOP A;  3NHE A;  3BOW A;  1EF7 A;  1GLO A;  4N8W A;  1AYU A;  3MTN A;  1M6D A;  2YJ8 A;  1ME4 A;  2AU1 A;  1DF0 A;  1Q6K A;  3ZNH A;  3MHH A;  1PCI A;  1PAD A;  2JTC A;  2G6D A;  4HWY A;  2XU1 A;  4Q8H A;  4BSQ A;  2DJF B;  1TLO A;  3W31 A;  3V6C A;  3O65 A;  3OIS A;  1HUC B;  2GHU A;  1DEU A;  2DC9 A;  3PRM A;  1QOL A;  3W30 A;  2R9F A;  4N4Z A;  1A6R A;  2FUD A;  4DMY A;  3BPM A;  1MDW A;  3PW3 A;  1YZB A;  3OVZ A;  3K9M A;  2FYE A;  2C0Y A;  4IUM A;  3PHU A;  1DKI A;  3WXG A;  2P7U A;  2PAD A;  3BB7 A;  1U9V A;  2CB5 A;  2FRQ A;  4OVZ A;  5KO3 A;  4M0W A;  1THE A;  4PT5 A;  4FIP A;  3BBA A;  3HWN A;  1CTE A;  1PPO A;  2E01 A;  2PNS A;  4XR7 A;  3S3Q A;  2BDL A;  2J7Q A;  3E1Z B;  1O0E A;  3CH3 X;  3BCN A;  3PSE A;  3OF9 A;  1STF E;  5JH3 A;  1UKF A;  3HHA A;  2Y5B A;  1ITO A;  3OQC A;  1F29 A;  5JZE A;  1ICF A;  1ATK A;  4P6E A;  4AXL A;  3BPF A;  4BOZ A;  1NQC A;  1CVZ A;  3OVX A;  4OVZ B;  3MJ5 A;  1YVB A;  1CB5 A;  4ZTB A;  3TNX A;  3KFQ A;  3IV2 A;  4RNA A;  3F75 A;  3PDF A;  1QDQ A;  3I06 A;  2IPP B;  1VJV A;  4YYU A;  4MSX A;  1AYV A;  2YJB A;  1K3B B;  2YJ2 A;  2G7Y A;  2AUX A;  3RVX A;  3N3K A;  3I3T A;  2FTD A;  3RVV A;  1MS6 A;  3BC3 A;  3CH2 X;  2FQ9 A;  2AYN A;  6PAD A;  5CHV A;  2DZZ A;  2AUZ A;  1NB5 A;  2FE8 A;  4K7C A;  2CIO A;  2HH5 A;  4P16 A; 
#chains in the Genus database with same CATH homology
 2E00 A;  3K8U A;  2IBI A;  1GEC E;  4CZW A;  2Y6E A;  4WA6 A;  4W5C A;  1CS8 A;  5J94 A;  1BQI A;  4G54 A;  1PPN A;  3H7D A;  1X9Y A;  2OZ2 A;  1ZCM A;  2AIM A;  3KWZ A;  1EWM A;  1IWD A;  2B1M A;  4CDD B;  2DCA A;  3D6S A;  4BGF A;  2FO5 A;  5CVO B;  1YK7 A;  2DCB A;  3HD3 A;  4PAD A;  4X6H A;  2E03 A;  3OF8 A;  2BDZ A;  3CBK A;  5K16 A;  2NQD B;  5F02 A;  4CDE B;  1AYW A;  2AYO A;  1EWL A;  3QSD A;  2B1N A;  5CVM A;  1JQP A;  2DC8 A;  4I05 A;  3LTW A;  3USV A;  1AEC A;  3CBJ A;  2DCC A;  1W5R A;  1YK8 A;  3KW9 A;  1U5I A;  4BS6 A;  4PI3 A;  2HHN A;  3H8B A;  3B79 A;  4DMX A;  4X6J A;  2NQA A;  1F2C A;  2F7D A;  2R9C A;  1AIM A;  4N79 A;  1MEM A;  3IHP A;  1GMY A;  4X6I A;  3GCB A;  5JA7 A;  2DZY A;  3V6E A;  3WXE A;  2YJ9 A;  2F1G A;  3KSE A;  3P5W A;  2PRE A;  2FT2 A;  1EWO A;  1NB3 A;  2O6X A;  4NV8 A;  1CQD A;  3IOQ A;  1F2B A;  2YJC A;  4MZO A;  4W4U A;  1ZIV A;  2NQI A;  1AU3 A;  1F2A A;  1BGO A;  1FH0 A;  4NV7 A;  2WBF X;  4FJC A;  3PNR A;  3S3R A;  4BPV A;  2GFO A;  4Q8G A;  2P86 A;  2AS8 A;  4ZUX U;  3KX1 A;  1NL6 A;  1AU0 A;  3ERV A;  2VHF A;  4PP1 A;  2DC6 A;  4FK5 A;  4YYW A;  1SNK A;  1TL9 A;  4QRG A;  1PXV A;  2XU4 A;  1YT7 A;  3K24 A;  4I07 A;  2PBH A;  4KLB A;  1KHP A;  3O1G A;  1PIP A;  4QRX A;  1PPP A;  2ACT A;  1CSB B;  4YYS A;  4AXM A;  4XUI A;  1VSN A;  1Y08 A;  2E02 A;  5CVN B;  4CDF B;  2G8J A;  4QH6 A;  2G8E A;  2XU5 A;  1GX3 A;  3KKU A;  2R6N A;  4YYV A;  4PP2 E;  4I04 A;  4YYR A;  1NPZ A;  2FRA A;  2OUL A;  3P5X A;  3N4C A;  1BY8 A;  3O0U A;  5EGW A;  4YV8 A;  1AU4 A;  8PCH A;  3WXF A;  1CJL A;  2JQF R;  3DF0 A;  4MZS A;  1EWP A;  3QJ3 A;  5EF4 A;  1GCB A;  1MEG A;  2HXZ A;  3M99 A;  3P5U A;  3QT4 A;  4RY2 A;  3PBH A;  5PAD A;  7PCK A;  1MIR A;  1PPD A;  3BWK A;  2ARY A;  1POP A;  1S4V A;  2VHS A;  4W5B A;  1XKG A;  4BS5 A;  2DJG B;  3MOR A;  1Y4H A;  1BP4 A;  3H6S A;  4BQV A;  4OEM A;  2OP3 A;  3IUT A;  2HD5 A;  1AU2 A;  4YYQ A;  2JQG R;  3MHS A;  3ZUA A;  1PBH A;  1KFU L;  1U9Q X;  2VFB A;  3H89 A;  3HHI A;  2ATO A;  3RVW A;  3F5V A;  4QRV A;  2R9M A;  1NLJ A;  1CPJ A;  4P6G A;  3H8C A;  3U8E A;  2R9O A;  2P0R A;  1CV8 A;  2AVW A;  3IEJ A;  2DCD A;  4YVA A;  3KWB X;  3P5V A;  3LXS A;  1QXP A;  1U9X A;  2R9N A;  1TU6 A;  3C9E A;  1YAL A;  4QBB A;  2XU3 A;  1KXR A;  5FPW A;  1U9W A;  2NQG A;  5A24 A;  1KHQ A;  5CHT A;  1MHW A;  9PAP A;  3LFY A;  2DC7 A;  3AI8 A;  3N3G A;  3IMA A;  4OEL A;  2H7J A;  1PE6 A;  1KFX L;  1QMY A;  1ME3 A;  1SP4 B;  2VFC A;  4CDC B;  3NHE A;  3BOW A;  1EF7 A;  4N8W A;  1GLO A;  1AYU A;  3MTN A;  1M6D A;  2YJ8 A;  1ME4 A;  2AU1 A;  1DF0 A;  1Q6K A;  3MHH A;  1PCI A;  1PAD A;  2G6D A;  4C5P A;  4HWY A;  2XU1 A;  4Q8H A;  4BSQ A;  2DJF B;  1TLO A;  3V6C A;  3OIS A;  1HUC B;  4B55 A;  2GHU A;  1DEU A;  2DC9 A;  1QOL A;  2R9F A;  4N4Z A;  1A6R A;  2FUD A;  4DMY A;  3BPM A;  1MDW A;  3PW3 A;  3OVZ A;  3K9M A;  2FYE A;  2C0Y A;  3WXG A;  1W6F A;  2P7U A;  2PAD A;  1U9V A;  2CB5 A;  2FRQ A;  1W4T A;  1THE A;  4FIP A;  3HWN A;  1CTE A;  1PPO A;  2E01 A;  2PNS A;  4XR7 A;  3S3Q A;  2BDL A;  3E1Z B;  1O0E A;  3CH3 X;  3BCN A;  3OF9 A;  1STF E;  5JH3 A;  3HHA A;  2Y5B A;  1ITO A;  1F29 A;  1ICF A;  1ATK A;  4P6E A;  4AXL A;  3BPF A;  1NQC A;  1CVZ A;  3OVX A;  4GUZ A;  1YVB A;  1CB5 A;  3TNX A;  3KFQ A;  3IV2 A;  3F75 A;  3PDF A;  1QDQ A;  3I06 A;  2IPP B;  1VJV A;  4YYU A;  4MSX A;  1AYV A;  2YJB A;  1K3B B;  2YJ2 A;  2G7Y A;  2AUX A;  3RVX A;  3N3K A;  3I3T A;  2FTD A;  3RVV A;  1MS6 A;  3BC3 A;  3CH2 X;  2FQ9 A;  2AYN A;  6PAD A;  5CHV A;  1E2T A;  2DZZ A;  2AUZ A;  1NB5 A;  4K7C A;  2CIO A;  3D9W A;  2BSZ A;  2HH5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...