1PBHA

Crystal structure of human recombinant procathepsin b at 3.2 angstrom resolution
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
317
structure length
317
Chain Sequence
MRSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROCATHEPSIN B
publication title Crystal structures of human procathepsin B at 3.2 and 3.3 Angstroms resolution reveal an interaction motif between a papain-like cysteine protease and its propeptide.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Thiol protease
total genus 63
structure length 317
sequence length 317
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 1997-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
A PF08127 Propeptide_C1 Peptidase family C1 propeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1pbhA00
4BS6A 2GFOA 2VHSA 1SNKA 2XU3A 2YJBA 3KSEA 1MEMA 2Y5BA 2G8EA 7PCKA 2DJGB 2HHNA 1CS8A 1CB5A 4XUIA 1S4VA 3P5XA 3K9MA 1SP4B 2H7JA 3O0UA 2IBIA 4KLBA 4PP2E 2P7UA 3P5UA 4X6HA 3BC3A 4I05A 5CVOB 3ZUAA 1KHQA 4QBBA 3BWKA 2FQ9A 4BS5A 4MSXA 4OEMA 4QRGA 2CIOA 4G54A 3U8EA 3QT4A 1DEUA 3I3TA 1F2AA 2XU5A 1KFXL 1Q6KA 1PIPA 1BY8A 1F2BA 5EF4A 3S3QA 3ERVA 1AU4A 3F5VA 1KHPA 1ME4A 4CDFB 3OF9A 1YVBA 2XU4A 2AUXA 3B79A 2DCDA 3KX1A 2R9MA 1ME3A 2DJFB 4HWYA 2YJCA 3BCNA 3H8BA 1JQPA 3N4CA 1O0EA 2FO5A 1GLOA 1KFUL 4ZUXU 1U9XA 2PREA 2AYNA 2R6NA 3V6CA 3MHSA 2C0YA 1YALA 3CBKA 2G7YA 2PBHA 4YYVA 1THEA 2JQFR 4YVAA 2HXZA 1PXVA 3F75A 2Y6EA 3M99A 2DZZA 1AU0A 2IPPB 2VHFA 3H8CA 4W5BA 2AUZA 4P6EA 1NQCA 3USVA 2GHUA 1F29A 2HD5A 3AI8A 2DCBA 5F02A 3O1GA 4OELA 3BPFA 3H7DA 1KXRA 5CVNB 4I04A 1PCIA 3I06A 1PADA 4N4ZA 1VJVA 1ICFA 1CV8A 3KWBX 2B1NA 4DMXA 2AS8A 3KW9A 4YYRA 2F7DA 3NHEA 1CJLA 1FH0A 1MDWA 1HUCB 3PW3A 1NB5A 2PADA 2DC9A 4YYSA 2NQAA 3IMAA 1EWMA 4BSQA 1ATKA 1EWOA 1U9WA 4FJCA 1AIMA 3IHPA 1U9VA 1Y08A 4DMYA 2R9FA 4FK5A 4QH6A 3PBHA 2AVWA 4CDCB 4I07A 5JH3A 2AYOA 3HD3A 3S3RA 1AYVA 4CDEB 1NPZA 1BP4A 2R9NA 3BPMA 1CQDA 3RVWA 1MS6A 1YK7A 2PNSA 3LFYA 2YJ9A 3RVVA 1QOLA 2NQIA 1QXPA 2BDLA 1EF7A 4PP1A 2E01A 1GECE 2JQGR 3K24A 5A24A 2WBFX 3D6SA 1A6RA 4AXLA 4WA6A 1ITOA 1U5IA 3QSDA 1M6DA 3BOWA 4YYUA 2F1GA 1CSBB 1U9QX 4W4UA 6PADA 1ZCMA 1CTEA 5EGWA 4YV8A 3IV2A 2OULA 3K8UA 4PI3A 3OISA 1YK8A 1MHWA 1PBHA 1K3BB 3OF8A 3CH3X 4Q8HA 1EWLA 2DC7A 4MZOA 2R9CA 1F2CA 1BGOA 4N79A 2ATOA 4CZWA 1QMYA 4P6GA 2O6XA 1CPJA 1AU2A 2G6DA 4K7CA 4BQVA 3N3KA 1STFE 4PADA 1IWDA 1PPOA 4W5CA 1AU3A 3HHAA 3KFQA 3C9EA 2R9OA 1DF0A 5J94A 2DCCA 4QRVA 3V6EA 2FT2A 3LXSA 1BQIA 1PPDA 1NLJA 3CBJA 1AYWA 2E02A 1YT7A 1TL9A 4YYWA 3H89A 1EWPA 4AXMA 2FRQA 3MHHA 3WXEA 2ACTA 2B1MA 2AU1A 5CHTA 1TU6A 3DF0A 5JA7A 1NL6A 3E1ZB 1QDQA 3QJ3A 2P0RA 5CHVA 1MEGA 5K16A 2BDZA 3KKUA 3HHIA 3OVXA 3IUTA 4CDDB 2XU1A 5PADA 1XKGA 3WXGA 2OZ2A 2DC8A 2G8JA 2DZYA 4FIPA 2FUDA 1POPA 1AYUA 8PCHA 3P5WA 1NB3A 3PNRA 1ZIVA 3RVXA 2NQDB 3GCBA 3WXFA 1PPNA 3CH2X 5CVMA 2AIMA 2CB5A 3PDFA 4RY2A 2E03A 9PAPA 2YJ8A 2NQGA 1VSNA 3IOQA 3HWNA 3MORA 3TNXA 1AECA 2HH5A 2FTDA 3KWZA 3N3GA 1X9YA 3IEJA 2DC6A 2OP3A 1CVZA 5FPWA 4QRXA 1PPPA 4N8WA 4YYQA 2P86A 1Y4HA 3MTNA 1GCBA 3OVZA 2DCAA 4BPVA 2YJ2A 2E00A 1PE6A 1TLOA 2FRAA 4XR7A 4Q8GA 2FYEA 2ARYA 4MZSA 3H6SA 4X6JA 4X6IA 1GMYA 3P5VA 1MIRA
chains in the Genus database with same CATH superfamily
4BS6A 2GFOA 2VHSA 1SNKA 2XU3A 3IFUA 2YJBA 2JRIA 3KSEA 1MEMA 2Y5BA 2G8EA 7PCKA 2DJGB 2HHNA 1CS8A 1CB5A 4XUIA 4IUMA 1S4VA 3P5XA 3K9MA 1SP4B 2H7JA 3O0UA 2IBIA 4KLBA 4BOUA 4PP2E 4PT5A 2P7UA 3P5UA 4X6HA 3BC3A 3PT2A 4P16A 4I05A 5CVOB 3ZUAA 1KHQA 4QBBA 3BWKA 2J7QA 2FQ9A 4BS5A 4MSXA 4OEMA 4QRGA 2CIOA 2J7QC 4G54A 3U8EA 3QT4A 1DEUA 3I3TA 1F2AA 2XU5A 1KFXL 1Q6KA 1PIPA 1BY8A 1F2BA 5EF4A 4XZXA 3S3QA 3ERVA 1AU4A 3F5VA 1KHPA 1ME4A 4CDFB 3OF9A 1YVBA 2XU4A 2AUXA 3B79A 2DCDA 3KX1A 2R9MA 1ME3A 2DJFB 4HWYA 2YJCA 3MTVA 3BCNA 3H8BA 1JQPA 3N4CA 1O0EA 2FO5A 1GLOA 1KFUL 4A5UA 4ZUXU 1U9XA 2PREA 2AYNA 2R6NA 3V6CA 3MHSA 4BOPA 2C0YA 1YALA 3CBKA 2G7YA 2PBHA 4YYVA 1THEA 2JQFR 4RF1A 4YVAA 2HXZA 1PXVA 3F75A 2Y6EA 3M99A 2DZZA 1AU0A 2JTCA 3PRMA 2IPPB 2VHFA 3H8CA 4W5BA 2AUZA 4P6EA 1PVJA 4RNAA 1NQCA 3USVA 2GHUA 1F29A 2HD5A 3AI8A 2DCBA 5F02A 3O1GA 4OELA 3BPFA 4BOQA 3H7DA 1KXRA 5CVNB 4I04A 1PCIA 3I06A 1PADA 4N4ZA 1VJVA 1ICFA 2Z84A 1CV8A 5EZQA 3KWBX 2B1NA 4D8EA 4DMXA 4RKXA 2AS8A 3KW9A 3PHUA 4YYRA 2F7DA 3NHEA 1CJLA 1FH0A 1MDWA 1HUCB 3PW3A 1NB5A 2PADA 2DC9A 4OW0A 4YYSA 2NQAA 3IMAA 1EWMA 4BSQA 4ZTBA 1ATKA 1EWOA 1U9WA 2BTWA 4FJCA 1AIMA 3IHPA 1U9VA 1Y08A 4DMYA 2R9FA 2FE8A 4FK5A 4QH6A 3PBHA 2AVWA 3B21A 4CDCB 4I07A 5JH3A 2AYOA 3HD3A 3BBAA 3S3RA 2DOSA 1AYVA 5EZSA 4CDEB 1NPZA 1BP4A 2R9NA 3BPMA 1CQDA 4IP3A 3RVWA 1MS6A 3PHWA 1YK7A 2PNSA 3LFYA 2YJ9A 4OVZB 3RVVA 1QOLA 2NQIA 1QXPA 2BDLA 1EF7A 4PP1A 2E01A 1GECE 1DKIA 2JQGR 3K24A 3PSEA 5A24A 4BOSA 2WBFX 3D6SA 1A6RA 4AXLA 4WA6A 4HXDB 1ITOA 3O65A 1U5IA 3QSDA 1M6DA 3BOWA 4YYUA 2F1GA 1CSBB 1U9QX 4W4UA 6PADA 1ZCMA 1CTEA 5EGWA 4MI7A 4YV8A 3IV2A 2OULA 4WURA 3K8UA 4PI3A 3OISA 1YK8A 1MHWA 1PBHA 3BB7A 1K3BB 4REZA 3OF8A 3CH3X 4Q8HA 1EWLA 2DC7A 4MZOA 2R9CA 1F2CA 1BGOA 4N79A 2ATOA 4CZWA 1QMYA 4P6GA 5E6JA 3W31A 2O6XA 5JZEA 1CPJA 1AU2A 2G6DA 4K7CA 4BQVA 3N3KA 1STFE 4PADA 5KO3A 1IWDA 1PPOA 4W5CA 1AU3A 3HHAA 3KFQA 2UZJA 4MM3B 3C9EA 2R9OA 1DF0A 3MP2A 4OVZA 3RNVA 5J94A 2DCCA 4QRVA 3PRPA 3V6EA 2FT2A 3LXSA 1BQIA 1PPDA 1NLJA 3CBJA 3W30A 1AYWA 2E02A 1YT7A 1TL9A 3ZNHA 3OQCA 4YYWA 3H89A 1EWPA 4AXMA 2FRQA 3MHHA 3WXEA 3E9SA 2ACTA 4R3DA 3MJ5A 2B1MA 2AU1A 5CHTA 1TU6A 3DF0A 5JA7A 1NL6A 3E1ZB 1QDQA 4BOZA 4M0WA 2HWKA 3QJ3A 2P0RA 5CHVA 1MEGA 5K16A 2BDZA 3KKUA 3HHIA 3OVXA 3IUTA 4CDDB 2XU1A 2AGAA 4D8IA 4GUAA 5PADA 1XKGA 3WXGA 2OZ2A 2BU3A 2DC8A 2G8JA 2DZYA 4FIPA 2FUDA 1POPA 1AYUA 8PCHA 3P5WA 1NB3A 3PNRA 1ZIVA 3RVXA 2NQDB 3GCBA 3WXFA 1PPNA 3CH2X 5CVMA 2AIMA 2CB5A 3PDFA 4RY2A 2E03A 9PAPA 2YJ8A 2NQGA 1VSNA 3IOQA 3HWNA 3MORA 3TNXA 1AECA 2HH5A 2FTDA 3KWZA 3N3GA 3TRKA 1X9YA 3IEJA 1YZBA 2DC6A 2OP3A 3PHXA 1UKFA 1CVZA 2BTWB 4RF0A 5FPWA 4QRXA 1PPPA 4D8BA 3C0RA 4N8WA 4YYQA 2P86A 3OVZA 1Y4HA 1GCBA 3MTNA 2DCAA 4BPVA 2YJ2A 2E00A 1PE6A 1TLOA 3TMPA 3BY4A 2FRAA 4XR7A 4Q8GA 2FYEA 2ARYA 4MZSA 3H6SA 4X6JA 4X6IA 1GMYA 3P5VA 1MIRA
chains in the Genus database with same CATH topology
4BS6A 2GFOA 2VHSA 1SNKA 2XU3A 1GX3A 2YJBA 3KSEA 1MEMA 2Y5BA 2G8EA 7PCKA 2DJGB 2HHNA 1CS8A 1CB5A 4XUIA 1S4VA 3P5XA 3K9MA 1SP4B 2H7JA 3O0UA 2IBIA 4KLBA 4PP2E 2P7UA 3P5UA 4X6HA 3BC3A 4B55A 4I05A 5CVOB 3ZUAA 1KHQA 4QBBA 3BWKA 2FQ9A 4BS5A 4MSXA 4OEMA 4QRGA 2CIOA 4G54A 3U8EA 3QT4A 1DEUA 3I3TA 1F2AA 2XU5A 1KFXL 1Q6KA 1PIPA 1BY8A 1F2BA 2VFBA 5EF4A 3S3QA 3ERVA 1AU4A 3F5VA 1KHPA 1ME4A 4CDFB 3OF9A 1YVBA 2XU4A 1W5RA 2AUXA 3B79A 2DCDA 3KX1A 2R9MA 1ME3A 2DJFB 4HWYA 2YJCA 3BCNA 3H8BA 1JQPA 3N4CA 1O0EA 2FO5A 1GLOA 1KFUL 1E2TA 4GUZA 4ZUXU 1U9XA 2PREA 2AYNA 2R6NA 3V6CA 3MHSA 2C0YA 1YALA 3CBKA 2G7YA 2PBHA 4YYVA 1THEA 2JQFR 4YVAA 2HXZA 1PXVA 3F75A 2Y6EA 3M99A 2DZZA 1AU0A 2IPPB 2VHFA 3H8CA 4W5BA 2AUZA 4P6EA 1NQCA 3USVA 2GHUA 1F29A 2HD5A 3AI8A 2DCBA 5F02A 3O1GA 4OELA 3BPFA 3H7DA 1KXRA 5CVNB 4I04A 1PCIA 3I06A 1PADA 4N4ZA 1VJVA 1ICFA 1CV8A 3KWBX 2B1NA 4DMXA 2AS8A 3KW9A 4YYRA 2F7DA 3NHEA 1CJLA 1FH0A 1MDWA 1HUCB 3PW3A 1NB5A 2PADA 2DC9A 4YYSA 2NQAA 3IMAA 1EWMA 4BSQA 1ATKA 1EWOA 1U9WA 4FJCA 1AIMA 3IHPA 1U9VA 1Y08A 4DMYA 2R9FA 4FK5A 4QH6A 3PBHA 2AVWA 4CDCB 4I07A 5JH3A 2AYOA 3HD3A 1W6FA 3S3RA 1AYVA 4CDEB 1NPZA 1BP4A 2R9NA 3BPMA 1CQDA 3RVWA 1MS6A 1YK7A 2PNSA 3LFYA 2YJ9A 3RVVA 1QOLA 2NQIA 1W4TA 1QXPA 2BDLA 1EF7A 4PP1A 2E01A 1GECE 2JQGR 3K24A 5A24A 2WBFX 3D6SA 1A6RA 4AXLA 4WA6A 1ITOA 1U5IA 3QSDA 1M6DA 3BOWA 4YYUA 2F1GA 1CSBB 1U9QX 4W4UA 6PADA 1ZCMA 1CTEA 5EGWA 4YV8A 3IV2A 2OULA 3K8UA 4PI3A 3OISA 1YK8A 1MHWA 1PBHA 1K3BB 3OF8A 3CH3X 4Q8HA 1EWLA 2DC7A 4MZOA 2R9CA 1F2CA 1BGOA 4N79A 2ATOA 4CZWA 1QMYA 4P6GA 2O6XA 1CPJA 1AU2A 2G6DA 4K7CA 4BQVA 3N3KA 1STFE 4PADA 1IWDA 1PPOA 4W5CA 1AU3A 2VFCA 3HHAA 3KFQA 4BGFA 3C9EA 2R9OA 1DF0A 5J94A 2DCCA 4QRVA 3V6EA 4NV8A 2FT2A 3LXSA 1BQIA 1PPDA 1NLJA 3CBJA 1AYWA 2E02A 1YT7A 1TL9A 4YYWA 3H89A 1EWPA 4AXMA 2FRQA 3MHHA 3WXEA 2ACTA 2B1MA 2AU1A 5CHTA 1TU6A 3DF0A 5JA7A 1NL6A 3E1ZB 1QDQA 3QJ3A 2P0RA 5CHVA 1MEGA 5K16A 2BDZA 3KKUA 3HHIA 3OVXA 3IUTA 4CDDB 2XU1A 5PADA 1XKGA 3WXGA 3LTWA 2OZ2A 2DC8A 2G8JA 2DZYA 4FIPA 2FUDA 1POPA 1AYUA 8PCHA 3P5WA 1NB3A 3PNRA 1ZIVA 3RVXA 2NQDB 3GCBA 3WXFA 1PPNA 3CH2X 5CVMA 2AIMA 2CB5A 3PDFA 4RY2A 2E03A 9PAPA 2YJ8A 2NQGA 1VSNA 3IOQA 3HWNA 3MORA 3TNXA 1AECA 2HH5A 2FTDA 3KWZA 3N3GA 1X9YA 3IEJA 2DC6A 2OP3A 1CVZA 5FPWA 4QRXA 1PPPA 4NV7A 4N8WA 4YYQA 4C5PA 2P86A 3OVZA 1Y4HA 1GCBA 3MTNA 2DCAA 4BPVA 2YJ2A 2E00A 1PE6A 1TLOA 3D9WA 2FRAA 4XR7A 4Q8GA 2FYEA 2ARYA 2BSZA 4MZSA 3H6SA 4X6JA 4X6IA 1GMYA 3P5VA 1MIRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BS6 A;  2GFO A;  2VHS A;  1SNK A;  2XU3 A;  2YJB A;  3KSE A;  1MEM A;  2Y5B A;  2G8E A;  7PCK A;  2DJG B;  2HHN A;  1CS8 A;  1CB5 A;  4XUI A;  1S4V A;  3P5X A;  3K9M A;  1SP4 B;  2H7J A;  3O0U A;  2IBI A;  4KLB A;  4PP2 E;  2P7U A;  3P5U A;  4X6H A;  3BC3 A;  4I05 A;  5CVO B;  3ZUA A;  1KHQ A;  4QBB A;  3BWK A;  2FQ9 A;  4BS5 A;  4MSX A;  4OEM A;  4QRG A;  2CIO A;  4G54 A;  3U8E A;  3QT4 A;  1DEU A;  3I3T A;  1F2A A;  2XU5 A;  1KFX L;  1Q6K A;  1PIP A;  1BY8 A;  1F2B A;  5EF4 A;  3S3Q A;  3ERV A;  1AU4 A;  3F5V A;  1KHP A;  1ME4 A;  4CDF B;  3OF9 A;  1YVB A;  2XU4 A;  2AUX A;  3B79 A;  2DCD A;  3KX1 A;  2R9M A;  1ME3 A;  2DJF B;  4HWY A;  2YJC A;  3BCN A;  3H8B A;  1JQP A;  3N4C A;  1O0E A;  2FO5 A;  1GLO A;  1KFU L;  4ZUX U;  1U9X A;  2PRE A;  2AYN A;  2R6N A;  3V6C A;  3MHS A;  2C0Y A;  1YAL A;  3CBK A;  2G7Y A;  2PBH A;  4YYV A;  1THE A;  2JQF R;  4YVA A;  2HXZ A;  1PXV A;  3F75 A;  2Y6E A;  3M99 A;  2DZZ A;  1AU0 A;  2IPP B;  2VHF A;  3H8C A;  4W5B A;  2AUZ A;  4P6E A;  1NQC A;  3USV A;  2GHU A;  1F29 A;  2HD5 A;  3AI8 A;  2DCB A;  5F02 A;  3O1G A;  4OEL A;  3BPF A;  3H7D A;  1KXR A;  5CVN B;  4I04 A;  1PCI A;  3I06 A;  1PAD A;  4N4Z A;  1VJV A;  1ICF A;  1CV8 A;  3KWB X;  2B1N A;  4DMX A;  2AS8 A;  3KW9 A;  4YYR A;  2F7D A;  3NHE A;  1CJL A;  1FH0 A;  1MDW A;  1HUC B;  3PW3 A;  1NB5 A;  2PAD A;  2DC9 A;  4YYS A;  2NQA A;  3IMA A;  1EWM A;  4BSQ A;  1ATK A;  1EWO A;  1U9W A;  4FJC A;  1AIM A;  3IHP A;  1U9V A;  1Y08 A;  4DMY A;  2R9F A;  4FK5 A;  4QH6 A;  3PBH A;  2AVW A;  4CDC B;  4I07 A;  5JH3 A;  2AYO A;  3HD3 A;  3S3R A;  1AYV A;  4CDE B;  1NPZ A;  1BP4 A;  2R9N A;  3BPM A;  1CQD A;  3RVW A;  1MS6 A;  1YK7 A;  2PNS A;  3LFY A;  2YJ9 A;  3RVV A;  1QOL A;  2NQI A;  1QXP A;  2BDL A;  1EF7 A;  4PP1 A;  2E01 A;  1GEC E;  2JQG R;  3K24 A;  5A24 A;  2WBF X;  3D6S A;  1A6R A;  4AXL A;  4WA6 A;  1ITO A;  1U5I A;  3QSD A;  1M6D A;  3BOW A;  4YYU A;  2F1G A;  1CSB B;  1U9Q X;  4W4U A;  6PAD A;  1ZCM A;  1CTE A;  5EGW A;  4YV8 A;  3IV2 A;  2OUL A;  3K8U A;  4PI3 A;  3OIS A;  1YK8 A;  1MHW A;  1PBH A;  1K3B B;  3OF8 A;  3CH3 X;  4Q8H A;  1EWL A;  2DC7 A;  4MZO A;  2R9C A;  1F2C A;  1BGO A;  4N79 A;  2ATO A;  4CZW A;  1QMY A;  4P6G A;  2O6X A;  1CPJ A;  1AU2 A;  2G6D A;  4K7C A;  4BQV A;  3N3K A;  1STF E;  4PAD A;  1IWD A;  1PPO A;  4W5C A;  1AU3 A;  3HHA A;  3KFQ A;  3C9E A;  2R9O A;  1DF0 A;  5J94 A;  2DCC A;  4QRV A;  3V6E A;  2FT2 A;  3LXS A;  1BQI A;  1PPD A;  1NLJ A;  3CBJ A;  1AYW A;  2E02 A;  1YT7 A;  1TL9 A;  4YYW A;  3H89 A;  1EWP A;  4AXM A;  2FRQ A;  3MHH A;  3WXE A;  2ACT A;  2B1M A;  2AU1 A;  5CHT A;  1TU6 A;  3DF0 A;  5JA7 A;  1NL6 A;  3E1Z B;  1QDQ A;  3QJ3 A;  2P0R A;  5CHV A;  1MEG A;  5K16 A;  2BDZ A;  3KKU A;  3HHI A;  3OVX A;  3IUT A;  4CDD B;  2XU1 A;  5PAD A;  1XKG A;  3WXG A;  2OZ2 A;  2DC8 A;  2G8J A;  2DZY A;  4FIP A;  2FUD A;  1POP A;  1AYU A;  8PCH A;  3P5W A;  1NB3 A;  3PNR A;  1ZIV A;  3RVX A;  2NQD B;  3GCB A;  3WXF A;  1PPN A;  3CH2 X;  5CVM A;  2AIM A;  2CB5 A;  3PDF A;  4RY2 A;  2E03 A;  9PAP A;  2YJ8 A;  2NQG A;  1VSN A;  3IOQ A;  3HWN A;  3MOR A;  3TNX A;  1AEC A;  2HH5 A;  2FTD A;  3KWZ A;  3N3G A;  1X9Y A;  3IEJ A;  2DC6 A;  2OP3 A;  1CVZ A;  5FPW A;  4QRX A;  1PPP A;  4N8W A;  4YYQ A;  2P86 A;  1Y4H A;  3MTN A;  1GCB A;  3OVZ A;  2DCA A;  4BPV A;  2YJ2 A;  2E00 A;  1PE6 A;  1TLO A;  2FRA A;  4XR7 A;  4Q8G A;  2FYE A;  2ARY A;  4MZS A;  3H6S A;  4X6J A;  4X6I A;  1GMY A;  3P5V A;  1MIR A; 
#chains in the Genus database with same CATH topology
 4BS6 A;  2GFO A;  2VHS A;  1SNK A;  2XU3 A;  3IFU A;  2YJB A;  2JRI A;  3KSE A;  1MEM A;  2Y5B A;  2G8E A;  7PCK A;  2DJG B;  2HHN A;  1CS8 A;  1CB5 A;  4XUI A;  4IUM A;  1S4V A;  3P5X A;  3K9M A;  1SP4 B;  2H7J A;  3O0U A;  2IBI A;  4KLB A;  4BOU A;  4PP2 E;  4PT5 A;  2P7U A;  3P5U A;  4X6H A;  3BC3 A;  3PT2 A;  4P16 A;  4I05 A;  5CVO B;  3ZUA A;  1KHQ A;  4QBB A;  3BWK A;  2J7Q A;  2FQ9 A;  4BS5 A;  4MSX A;  4OEM A;  4QRG A;  2CIO A;  2J7Q C;  4G54 A;  3U8E A;  3QT4 A;  1DEU A;  3I3T A;  1F2A A;  2XU5 A;  1KFX L;  1Q6K A;  1PIP A;  1BY8 A;  1F2B A;  5EF4 A;  4XZX A;  3S3Q A;  3ERV A;  1AU4 A;  3F5V A;  1KHP A;  1ME4 A;  4CDF B;  3OF9 A;  1YVB A;  2XU4 A;  2AUX A;  3B79 A;  2DCD A;  3KX1 A;  2R9M A;  1ME3 A;  2DJF B;  4HWY A;  2YJC A;  3MTV A;  3BCN A;  3H8B A;  1JQP A;  3N4C A;  1O0E A;  2FO5 A;  1GLO A;  1KFU L;  4A5U A;  4ZUX U;  1U9X A;  2PRE A;  2AYN A;  2R6N A;  3V6C A;  3MHS A;  4BOP A;  2C0Y A;  1YAL A;  3CBK A;  2G7Y A;  2PBH A;  4YYV A;  1THE A;  2JQF R;  4RF1 A;  4YVA A;  2HXZ A;  1PXV A;  3F75 A;  2Y6E A;  3M99 A;  2DZZ A;  1AU0 A;  2JTC A;  3PRM A;  2IPP B;  2VHF A;  3H8C A;  4W5B A;  2AUZ A;  4P6E A;  1PVJ A;  4RNA A;  1NQC A;  3USV A;  2GHU A;  1F29 A;  2HD5 A;  3AI8 A;  2DCB A;  5F02 A;  3O1G A;  4OEL A;  3BPF A;  4BOQ A;  3H7D A;  1KXR A;  5CVN B;  4I04 A;  1PCI A;  3I06 A;  1PAD A;  4N4Z A;  1VJV A;  1ICF A;  2Z84 A;  1CV8 A;  5EZQ A;  3KWB X;  2B1N A;  4D8E A;  4DMX A;  4RKX A;  2AS8 A;  3KW9 A;  3PHU A;  4YYR A;  2F7D A;  3NHE A;  1CJL A;  1FH0 A;  1MDW A;  1HUC B;  3PW3 A;  1NB5 A;  2PAD A;  2DC9 A;  4OW0 A;  4YYS A;  2NQA A;  3IMA A;  1EWM A;  4BSQ A;  4ZTB A;  1ATK A;  1EWO A;  1U9W A;  2BTW A;  4FJC A;  1AIM A;  3IHP A;  1U9V A;  1Y08 A;  4DMY A;  2R9F A;  2FE8 A;  4FK5 A;  4QH6 A;  3PBH A;  2AVW A;  3B21 A;  4CDC B;  4I07 A;  5JH3 A;  2AYO A;  3HD3 A;  3BBA A;  3S3R A;  2DOS A;  1AYV A;  5EZS A;  4CDE B;  1NPZ A;  1BP4 A;  2R9N A;  3BPM A;  1CQD A;  4IP3 A;  3RVW A;  1MS6 A;  3PHW A;  1YK7 A;  2PNS A;  3LFY A;  2YJ9 A;  4OVZ B;  3RVV A;  1QOL A;  2NQI A;  1QXP A;  2BDL A;  1EF7 A;  4PP1 A;  2E01 A;  1GEC E;  1DKI A;  2JQG R;  3K24 A;  3PSE A;  5A24 A;  4BOS A;  2WBF X;  3D6S A;  1A6R A;  4AXL A;  4WA6 A;  4HXD B;  1ITO A;  3O65 A;  1U5I A;  3QSD A;  1M6D A;  3BOW A;  4YYU A;  2F1G A;  1CSB B;  1U9Q X;  4W4U A;  6PAD A;  1ZCM A;  1CTE A;  5EGW A;  4MI7 A;  4YV8 A;  3IV2 A;  2OUL A;  4WUR A;  3K8U A;  4PI3 A;  3OIS A;  1YK8 A;  1MHW A;  1PBH A;  3BB7 A;  1K3B B;  4REZ A;  3OF8 A;  3CH3 X;  4Q8H A;  1EWL A;  2DC7 A;  4MZO A;  2R9C A;  1F2C A;  1BGO A;  4N79 A;  2ATO A;  4CZW A;  1QMY A;  4P6G A;  5E6J A;  3W31 A;  2O6X A;  5JZE A;  1CPJ A;  1AU2 A;  2G6D A;  4K7C A;  4BQV A;  3N3K A;  1STF E;  4PAD A;  5KO3 A;  1IWD A;  1PPO A;  4W5C A;  1AU3 A;  3HHA A;  3KFQ A;  2UZJ A;  4MM3 B;  3C9E A;  2R9O A;  1DF0 A;  3MP2 A;  4OVZ A;  3RNV A;  5J94 A;  2DCC A;  4QRV A;  3PRP A;  3V6E A;  2FT2 A;  3LXS A;  1BQI A;  1PPD A;  1NLJ A;  3CBJ A;  3W30 A;  1AYW A;  2E02 A;  1YT7 A;  1TL9 A;  3ZNH A;  3OQC A;  4YYW A;  3H89 A;  1EWP A;  4AXM A;  2FRQ A;  3MHH A;  3WXE A;  3E9S A;  2ACT A;  4R3D A;  3MJ5 A;  2B1M A;  2AU1 A;  5CHT A;  1TU6 A;  3DF0 A;  5JA7 A;  1NL6 A;  3E1Z B;  1QDQ A;  4BOZ A;  4M0W A;  2HWK A;  3QJ3 A;  2P0R A;  5CHV A;  1MEG A;  5K16 A;  2BDZ A;  3KKU A;  3HHI A;  3OVX A;  3IUT A;  4CDD B;  2XU1 A;  2AGA A;  4D8I A;  4GUA A;  5PAD A;  1XKG A;  3WXG A;  2OZ2 A;  2BU3 A;  2DC8 A;  2G8J A;  2DZY A;  4FIP A;  2FUD A;  1POP A;  1AYU A;  8PCH A;  3P5W A;  1NB3 A;  3PNR A;  1ZIV A;  3RVX A;  2NQD B;  3GCB A;  3WXF A;  1PPN A;  3CH2 X;  5CVM A;  2AIM A;  2CB5 A;  3PDF A;  4RY2 A;  2E03 A;  9PAP A;  2YJ8 A;  2NQG A;  1VSN A;  3IOQ A;  3HWN A;  3MOR A;  3TNX A;  1AEC A;  2HH5 A;  2FTD A;  3KWZ A;  3N3G A;  3TRK A;  1X9Y A;  3IEJ A;  1YZB A;  2DC6 A;  2OP3 A;  3PHX A;  1UKF A;  1CVZ A;  2BTW B;  4RF0 A;  5FPW A;  4QRX A;  1PPP A;  4D8B A;  3C0R A;  4N8W A;  4YYQ A;  2P86 A;  3OVZ A;  1Y4H A;  1GCB A;  3MTN A;  2DCA A;  4BPV A;  2YJ2 A;  2E00 A;  1PE6 A;  1TLO A;  3TMP A;  3BY4 A;  2FRA A;  4XR7 A;  4Q8G A;  2FYE A;  2ARY A;  4MZS A;  3H6S A;  4X6J A;  4X6I A;  1GMY A;  3P5V A;  1MIR A; 
#chains in the Genus database with same CATH homology
 4BS6 A;  2GFO A;  2VHS A;  1SNK A;  2XU3 A;  1GX3 A;  2YJB A;  3KSE A;  1MEM A;  2Y5B A;  2G8E A;  7PCK A;  2DJG B;  2HHN A;  1CS8 A;  1CB5 A;  4XUI A;  1S4V A;  3P5X A;  3K9M A;  1SP4 B;  2H7J A;  3O0U A;  2IBI A;  4KLB A;  4PP2 E;  2P7U A;  3P5U A;  4X6H A;  3BC3 A;  4B55 A;  4I05 A;  5CVO B;  3ZUA A;  1KHQ A;  4QBB A;  3BWK A;  2FQ9 A;  4BS5 A;  4MSX A;  4OEM A;  4QRG A;  2CIO A;  4G54 A;  3U8E A;  3QT4 A;  1DEU A;  3I3T A;  1F2A A;  2XU5 A;  1KFX L;  1Q6K A;  1PIP A;  1BY8 A;  1F2B A;  2VFB A;  5EF4 A;  3S3Q A;  3ERV A;  1AU4 A;  3F5V A;  1KHP A;  1ME4 A;  4CDF B;  3OF9 A;  1YVB A;  2XU4 A;  1W5R A;  2AUX A;  3B79 A;  2DCD A;  3KX1 A;  2R9M A;  1ME3 A;  2DJF B;  4HWY A;  2YJC A;  3BCN A;  3H8B A;  1JQP A;  3N4C A;  1O0E A;  2FO5 A;  1GLO A;  1KFU L;  1E2T A;  4GUZ A;  4ZUX U;  1U9X A;  2PRE A;  2AYN A;  2R6N A;  3V6C A;  3MHS A;  2C0Y A;  1YAL A;  3CBK A;  2G7Y A;  2PBH A;  4YYV A;  1THE A;  2JQF R;  4YVA A;  2HXZ A;  1PXV A;  3F75 A;  2Y6E A;  3M99 A;  2DZZ A;  1AU0 A;  2IPP B;  2VHF A;  3H8C A;  4W5B A;  2AUZ A;  4P6E A;  1NQC A;  3USV A;  2GHU A;  1F29 A;  2HD5 A;  3AI8 A;  2DCB A;  5F02 A;  3O1G A;  4OEL A;  3BPF A;  3H7D A;  1KXR A;  5CVN B;  4I04 A;  1PCI A;  3I06 A;  1PAD A;  4N4Z A;  1VJV A;  1ICF A;  1CV8 A;  3KWB X;  2B1N A;  4DMX A;  2AS8 A;  3KW9 A;  4YYR A;  2F7D A;  3NHE A;  1CJL A;  1FH0 A;  1MDW A;  1HUC B;  3PW3 A;  1NB5 A;  2PAD A;  2DC9 A;  4YYS A;  2NQA A;  3IMA A;  1EWM A;  4BSQ A;  1ATK A;  1EWO A;  1U9W A;  4FJC A;  1AIM A;  3IHP A;  1U9V A;  1Y08 A;  4DMY A;  2R9F A;  4FK5 A;  4QH6 A;  3PBH A;  2AVW A;  4CDC B;  4I07 A;  5JH3 A;  2AYO A;  3HD3 A;  1W6F A;  3S3R A;  1AYV A;  4CDE B;  1NPZ A;  1BP4 A;  2R9N A;  3BPM A;  1CQD A;  3RVW A;  1MS6 A;  1YK7 A;  2PNS A;  3LFY A;  2YJ9 A;  3RVV A;  1QOL A;  2NQI A;  1W4T A;  1QXP A;  2BDL A;  1EF7 A;  4PP1 A;  2E01 A;  1GEC E;  2JQG R;  3K24 A;  5A24 A;  2WBF X;  3D6S A;  1A6R A;  4AXL A;  4WA6 A;  1ITO A;  1U5I A;  3QSD A;  1M6D A;  3BOW A;  4YYU A;  2F1G A;  1CSB B;  1U9Q X;  4W4U A;  6PAD A;  1ZCM A;  1CTE A;  5EGW A;  4YV8 A;  3IV2 A;  2OUL A;  3K8U A;  4PI3 A;  3OIS A;  1YK8 A;  1MHW A;  1PBH A;  1K3B B;  3OF8 A;  3CH3 X;  4Q8H A;  1EWL A;  2DC7 A;  4MZO A;  2R9C A;  1F2C A;  1BGO A;  4N79 A;  2ATO A;  4CZW A;  1QMY A;  4P6G A;  2O6X A;  1CPJ A;  1AU2 A;  2G6D A;  4K7C A;  4BQV A;  3N3K A;  1STF E;  4PAD A;  1IWD A;  1PPO A;  4W5C A;  1AU3 A;  2VFC A;  3HHA A;  3KFQ A;  4BGF A;  3C9E A;  2R9O A;  1DF0 A;  5J94 A;  2DCC A;  4QRV A;  3V6E A;  4NV8 A;  2FT2 A;  3LXS A;  1BQI A;  1PPD A;  1NLJ A;  3CBJ A;  1AYW A;  2E02 A;  1YT7 A;  1TL9 A;  4YYW A;  3H89 A;  1EWP A;  4AXM A;  2FRQ A;  3MHH A;  3WXE A;  2ACT A;  2B1M A;  2AU1 A;  5CHT A;  1TU6 A;  3DF0 A;  5JA7 A;  1NL6 A;  3E1Z B;  1QDQ A;  3QJ3 A;  2P0R A;  5CHV A;  1MEG A;  5K16 A;  2BDZ A;  3KKU A;  3HHI A;  3OVX A;  3IUT A;  4CDD B;  2XU1 A;  5PAD A;  1XKG A;  3WXG A;  3LTW A;  2OZ2 A;  2DC8 A;  2G8J A;  2DZY A;  4FIP A;  2FUD A;  1POP A;  1AYU A;  8PCH A;  3P5W A;  1NB3 A;  3PNR A;  1ZIV A;  3RVX A;  2NQD B;  3GCB A;  3WXF A;  1PPN A;  3CH2 X;  5CVM A;  2AIM A;  2CB5 A;  3PDF A;  4RY2 A;  2E03 A;  9PAP A;  2YJ8 A;  2NQG A;  1VSN A;  3IOQ A;  3HWN A;  3MOR A;  3TNX A;  1AEC A;  2HH5 A;  2FTD A;  3KWZ A;  3N3G A;  1X9Y A;  3IEJ A;  2DC6 A;  2OP3 A;  1CVZ A;  5FPW A;  4QRX A;  1PPP A;  4NV7 A;  4N8W A;  4YYQ A;  4C5P A;  2P86 A;  3OVZ A;  1Y4H A;  1GCB A;  3MTN A;  2DCA A;  4BPV A;  2YJ2 A;  2E00 A;  1PE6 A;  1TLO A;  3D9W A;  2FRA A;  4XR7 A;  4Q8G A;  2FYE A;  2ARY A;  2BSZ A;  4MZS A;  3H6S A;  4X6J A;  4X6I A;  1GMY A;  3P5V A;  1MIR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...