5FPWA

Procathepsin b s9 from trypanosoma congolense
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
306
structure length
292
Chain Sequence
APVLTKTFVDRINQLNGGMWKAVYNGKMQNITFAEAKRLTGAWIQKTSSLPPVRFTEEQLRTELPESFDSAEKWPNCPTIREIADQSACRASWAVSTASVISDRYCTVGGVQQLRISAAHLLSCCKQCGGGCKGGFPGFAWRYYVEYGIASSYCQPYPFPHCENFDTPKCQATCTDKSIPLVKYRGSATYLLLHGEEDYKRELYFNGPFVAVFYVYTDLFAYKSGVYRHVDGDFLGGTAVKVVGWGKLNGTPYWKVANTWDTDWGMDGYLLILRGNNECNIEHLGFAGTPET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PRO CATHEPSIN B S9
publication title 2.1 Angstrom Crystal Structure of Pro Cathepsin B S9 from Trypanosoma Congolense
rcsb
source organism Trypanosoma congolense
total genus 92
structure length 292
sequence length 306
chains with identical sequence B, C
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2015-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 5fpwA00
1HUCB 1NQCA 3ZUAA 1TL9A 1U9VA 2FRQA 3CH2X 5EGWA 1YVBA 3IHPA 3IV2A 2AYOA 1BP4A 1PE6A 1JQPA 3RVWA 4DMXA 1GLOA 2HXZA 3K9MA 3OVZA 4BSQA 4BPVA 1AU4A 1AU2A 1EWPA 4PP2E 1GECE 3KWZA 3K24A 3USVA 5EF4A 3AI8A 2AVWA 1Y08A 2FRAA 3RVVA 2H7JA 2YJBA 2FTDA 1AYUA 4I04A 1KFXL 2IPPB 2P7UA 3IUTA 1DF0A 2G7YA 3ERVA 1VSNA 2GHUA 4KLBA 2WBFX 2IBIA 1MEGA 2DCCA 4PADA 1A6RA 2GFOA 5JH3A 4CDDB 4X6HA 3WXGA 3O1GA 5K16A 1ITOA 5CHVA 4CDEB 1BQIA 2ATOA 4MZSA 3BPFA 2R9MA 3KWBX 1ZIVA 2AIMA 2F1GA 4I07A 2O6XA 2XU4A 2HHNA 1KXRA 2PBHA 3MTNA 2G6DA 4YV8A 1AIMA 3GCBA 1X9YA 3N3GA 3RVXA 1AYVA 2DC8A 3N3KA 2OULA 3DF0A 3O0UA 3OVXA 5J94A 2PREA 1K3BB 1NB5A 1AYWA 2B1NA 3HHAA 4HWYA 1FH0A 3MHHA 1CSBB 4N79A 1EWMA 3LXSA 2NQGA 4W4UA 4P6GA 3P5UA 3CBKA 2NQDB 1AECA 3IMAA 4YYSA 4BS5A 2ACTA 3V6EA 2E03A 3MHSA 1CVZA 2G8EA 2NQAA 3BOWA 1AU0A 2E01A 3PNRA 4YYWA 1ZCMA 2DCAA 1EWOA 1O0EA 3P5WA 3I06A 2NQIA 3E1ZB 2XU1A 2FQ9A 3V6CA 2E00A 2JQGR 1DEUA 2XU5A 1PPDA 3BPMA 2CB5A 2E02A 3IOQA 3OISA 1CS8A 3WXFA 3F5VA 1POPA 1GCBA 4N4ZA 3QT4A 3BCNA 1TLOA 3KSEA 1AU3A 5CVMA 3LFYA 2P0RA 1BGOA 1SNKA 4I05A 4QRGA 1GMYA 3H8BA 4YYRA 3F75A 2R9OA 1ATKA 2FO5A 1YK7A 1THEA 1NPZA 3HWNA 3OF9A 3B79A 3KX1A 2P86A 3H6SA 1KHPA 2VHFA 2DZYA 4N8WA 1EF7A 1SP4B 3C9EA 3PBHA 1PBHA 4Q8HA 1MDWA 2XU3A 5F02A 3KFQA 4K7CA 3P5XA 3U8EA 3KKUA 6PADA 1F29A 4OELA 3N4CA 4YYQA 2BDLA 2BDZA 3MORA 2Y6EA 1M6DA 3K8UA 4X6IA 3H7DA 3QSDA 2FYEA 4AXLA 1CB5A 1QOLA 2AU1A 4ZUXU 3D6SA 1ME3A 3HHIA 1EWLA 1Y4HA 5CVNB 1U9WA 3H89A 3I3TA 4FIPA 4OEMA 4BS6A 3M99A 3HD3A 1PADA 2R9CA 1PPOA 3QJ3A 4QH6A 2OZ2A 3CH3X 4YYUA 2VHSA 4QBBA 2DZZA 5A24A 5CHTA 3H8CA 1NLJA 7PCKA 1CJLA 3BWKA 1PPNA 3PW3A 3KW9A 2DC7A 2YJ9A 4RY2A 2DCBA 3IEJA 1STFE 5FPWA 4MZOA 1CPJA 5CVOB 1MHWA 1VJVA 2JQFR 3OF8A 1QXPA 1CV8A 4X6JA 5PADA 4MSXA 2B1MA 3P5VA 1PIPA 1F2BA 3BC3A 3TNXA 4PI3A 4FJCA 2YJCA 3S3RA 1BY8A 1YT7A 2G8JA 2FUDA 1ICFA 2YJ8A 4G54A 2CIOA 4YYVA 2AS8A 4YVAA 1YALA 1U9XA 4CDCB 3NHEA 4BQVA 2DJFB 2HH5A 1CQDA 1PPPA 2DC9A 2PADA 2R6NA 1KFUL 1ME4A 2C0YA 3WXEA 2R9FA 2PNSA 4PP1A 1S4VA 4FK5A 1MS6A 1NB3A 2DC6A 4QRVA 1IWDA 1PCIA 3S3QA 4CDFB 4Q8GA 1PXVA 2DJGB 1QDQA 2AUXA 1YK8A 1TU6A 5JA7A 2Y5BA 3PDFA 4XUIA 1Q6KA 2AUZA 3CBJA 4AXMA 2ARYA 4WA6A 4DMYA 1F2CA 1QMYA 4XR7A 1U5IA 2OP3A 4P6EA 1MEMA 4QRXA 1XKGA 2R9NA 2AYNA 9PAPA 1CTEA 2F7DA 1KHQA 1MIRA 2YJ2A 1F2AA 4W5CA 1NL6A 4CZWA 1U9QX 2HD5A 4W5BA 2FT2A 8PCHA 2DCDA
chains in the Genus database with same CATH superfamily
1HUCB 1NQCA 3ZUAA 4RNAA 1TL9A 1U9VA 2FRQA 3CH2X 5EGWA 1YVBA 3IHPA 3IV2A 3PHWA 2AYOA 1BP4A 1PE6A 1JQPA 3RVWA 1UKFA 4DMXA 1GLOA 2HXZA 3K9MA 3OVZA 4RF1A 4BSQA 4BPVA 1AU4A 3PSEA 1AU2A 4RKXA 1EWPA 4PP2E 1GECE 3KWZA 3K24A 3USVA 5EF4A 3AI8A 2AVWA 1Y08A 2FRAA 3RVVA 2H7JA 2YJBA 2FTDA 4REZA 4WURA 1AYUA 4I04A 1KFXL 2IPPB 2P7UA 3IUTA 1DF0A 2G7YA 3ERVA 1VSNA 2GHUA 4KLBA 4PT5A 2WBFX 2IBIA 1MEGA 2DCCA 4PADA 1A6RA 2GFOA 5JH3A 4P16A 4CDDB 4X6HA 3WXGA 3O1GA 5K16A 1ITOA 5CHVA 4CDEB 4XZXA 1BQIA 2ATOA 4MZSA 5JZEA 3BPFA 2R9MA 3KWBX 1ZIVA 2AIMA 2F1GA 4I07A 2O6XA 2XU4A 2BTWA 2HHNA 4GUAA 1KXRA 2PBHA 3MTNA 2BU3A 2G6DA 4YV8A 1AIMA 3GCBA 1X9YA 3N3GA 3RVXA 1AYVA 2DC8A 3N3KA 2OULA 3DF0A 3O0UA 3OVXA 5J94A 2PREA 4BOZA 1K3BB 4D8BA 1NB5A 1AYWA 2B1NA 3HHAA 4HWYA 1FH0A 3MHHA 1CSBB 4N79A 1EWMA 4RF0A 3O65A 1PVJA 3LXSA 2NQGA 3BB7A 3BY4A 4W4UA 4P6GA 3P5UA 3CBKA 2NQDB 1AECA 3IMAA 4YYSA 4BS5A 2ACTA 3V6EA 3PT2A 2E03A 3MHSA 1CVZA 2BTWB 2G8EA 2NQAA 3BOWA 1AU0A 2E01A 3PNRA 4YYWA 1ZCMA 2DCAA 1EWOA 1O0EA 3P5WA 3I06A 3E1ZB 2NQIA 2XU1A 2FQ9A 3V6CA 4OVZA 2E00A 2JQGR 1DEUA 2XU5A 1PPDA 3BPMA 2CB5A 4ZTBA 2JRIA 2E02A 5EZQA 3C0RA 3IOQA 3OISA 1CS8A 3WXFA 3F5VA 4BOQA 1POPA 1GCBA 3MTVA 4N4ZA 3QT4A 3BCNA 1TLOA 3KSEA 1AU3A 3MJ5A 5CVMA 3LFYA 2P0RA 1BGOA 1SNKA 4I05A 4QRGA 1GMYA 3H8BA 4YYRA 3F75A 3W31A 2R9OA 1ATKA 2FO5A 1YK7A 1THEA 1NPZA 3W30A 3HWNA 3PRMA 3OF9A 3B79A 3KX1A 2P86A 4OVZB 3H6SA 1KHPA 2VHFA 4D8EA 5KO3A 2DZYA 4N8WA 1EF7A 1SP4B 3C9EA 3PBHA 1PBHA 4Q8HA 1MDWA 2XU3A 5F02A 3MP2A 3KFQA 4K7CA 3P5XA 3U8EA 3KKUA 6PADA 1F29A 4HXDB 4BOPA 4OELA 3N4CA 4YYQA 2BDLA 2BDZA 4A5UA 3MORA 2Y6EA 1M6DA 3K8UA 4X6IA 3H7DA 3QSDA 2FYEA 4AXLA 1CB5A 1QOLA 2AU1A 4ZUXU 3D6SA 4BOSA 1ME3A 3HHIA 1EWLA 1Y4HA 4MM3B 5CVNB 1U9WA 3H89A 3I3TA 4FIPA 4OEMA 4IUMA 4BS6A 3M99A 4R3DA 3HD3A 1PADA 2R9CA 1PPOA 3QJ3A 4QH6A 2OZ2A 3CH3X 4YYUA 3BBAA 2VHSA 2JTCA 4QBBA 3E9SA 2DZZA 5A24A 5CHTA 3H8CA 1NLJA 7PCKA 1CJLA 3BWKA 1PPNA 2DOSA 3PW3A 3KW9A 2DC7A 2YJ9A 4RY2A 2DCBA 3IEJA 1STFE 5FPWA 2AGAA 4MZOA 1CPJA 4M0WA 5CVOB 1YZBA 1MHWA 1VJVA 2JQFR 3OF8A 1QXPA 1CV8A 4X6JA 5PADA 4IP3A 4MSXA 3B21A 2B1MA 3P5VA 3TRKA 1PIPA 1F2BA 3BC3A 3TNXA 4PI3A 4MI7A 4FJCA 2YJCA 3S3RA 1BY8A 1YT7A 2G8JA 3PRPA 2FUDA 1ICFA 2YJ8A 4G54A 3PHXA 2CIOA 3PHUA 4YYVA 2AS8A 4YVAA 1YALA 1U9XA 2J7QA 4CDCB 3NHEA 4BQVA 2Z84A 2DJFB 2HH5A 2UZJA 1CQDA 1PPPA 3TMPA 1DKIA 2DC9A 3OQCA 2PADA 3RNVA 2R6NA 1KFUL 1ME4A 2C0YA 3WXEA 2R9FA 2PNSA 4PP1A 5EZSA 1S4VA 4FK5A 1MS6A 1NB3A 2DC6A 4QRVA 1IWDA 2FE8A 1PCIA 3S3QA 4CDFB 4Q8GA 1PXVA 2DJGB 1QDQA 2AUXA 3IFUA 5E6JA 1YK8A 1TU6A 5JA7A 2Y5BA 3PDFA 4XUIA 1Q6KA 2AUZA 3CBJA 4AXMA 2ARYA 4WA6A 4DMYA 1F2CA 2HWKA 1QMYA 4XR7A 1U5IA 4BOUA 2OP3A 4P6EA 1MEMA 4QRXA 4OW0A 1XKGA 2R9NA 2AYNA 9PAPA 1CTEA 2F7DA 1KHQA 1MIRA 2YJ2A 1F2AA 4W5CA 1NL6A 4CZWA 1U9QX 2HD5A 4D8IA 4W5BA 2FT2A 2J7QC 8PCHA 3ZNHA 2DCDA
chains in the Genus database with same CATH topology
1HUCB 1NQCA 3ZUAA 1TL9A 1U9VA 2FRQA 3CH2X 5EGWA 1YVBA 3IHPA 3IV2A 2AYOA 1BP4A 1PE6A 1JQPA 3RVWA 4DMXA 1GLOA 2HXZA 3K9MA 3OVZA 4BSQA 4BPVA 1AU4A 1AU2A 1EWPA 4PP2E 2BSZA 1GECE 3KWZA 3K24A 3USVA 5EF4A 3AI8A 2AVWA 4B55A 1Y08A 2FRAA 3RVVA 2H7JA 2YJBA 2FTDA 1AYUA 4I04A 1KFXL 2IPPB 2P7UA 3IUTA 1DF0A 2G7YA 3ERVA 1VSNA 1W4TA 2GHUA 4KLBA 2WBFX 2IBIA 1MEGA 2DCCA 4PADA 1A6RA 2GFOA 5JH3A 2VFBA 4CDDB 4X6HA 3WXGA 3O1GA 5K16A 1ITOA 5CHVA 4CDEB 1BQIA 2ATOA 4MZSA 3BPFA 2R9MA 3KWBX 1ZIVA 2AIMA 2F1GA 4I07A 2O6XA 2XU4A 2HHNA 1KXRA 2PBHA 3MTNA 2G6DA 4YV8A 1AIMA 3GCBA 1X9YA 3N3GA 3RVXA 1AYVA 2DC8A 3N3KA 2OULA 3DF0A 3O0UA 3OVXA 5J94A 2PREA 1K3BB 1NB5A 1AYWA 2B1NA 3HHAA 4HWYA 1FH0A 3MHHA 1CSBB 4N79A 1EWMA 3LXSA 1W6FA 2NQGA 4W4UA 4P6GA 3P5UA 3CBKA 2NQDB 1AECA 3IMAA 4YYSA 4BS5A 2ACTA 3V6EA 2E03A 3MHSA 1CVZA 2G8EA 2NQAA 3BOWA 1AU0A 2E01A 3PNRA 4YYWA 1E2TA 1ZCMA 2DCAA 1EWOA 1O0EA 3P5WA 3I06A 2NQIA 3E1ZB 2XU1A 2FQ9A 3V6CA 2E00A 2JQGR 1DEUA 2XU5A 1PPDA 3BPMA 2CB5A 2E02A 3IOQA 3OISA 1CS8A 3WXFA 3F5VA 1POPA 1GCBA 4N4ZA 3QT4A 3BCNA 4GUZA 1TLOA 3KSEA 1AU3A 5CVMA 3LFYA 2P0RA 1BGOA 1SNKA 4I05A 4QRGA 4C5PA 1GMYA 3H8BA 4YYRA 3F75A 2R9OA 1ATKA 2FO5A 1YK7A 1THEA 1NPZA 3HWNA 3OF9A 3B79A 3KX1A 2P86A 3H6SA 1KHPA 2VHFA 3LTWA 2DZYA 4N8WA 1EF7A 1SP4B 3C9EA 3PBHA 1PBHA 4Q8HA 1MDWA 2XU3A 5F02A 3KFQA 4K7CA 3P5XA 4NV8A 3U8EA 3KKUA 6PADA 1F29A 4OELA 3N4CA 4YYQA 2BDLA 2BDZA 4NV7A 3MORA 2Y6EA 1M6DA 3K8UA 4X6IA 3H7DA 1GX3A 2FYEA 3QSDA 4AXLA 1CB5A 1QOLA 2AU1A 4ZUXU 3D6SA 1ME3A 3HHIA 1EWLA 1Y4HA 5CVNB 1U9WA 3H89A 3I3TA 4FIPA 4OEMA 4BS6A 3M99A 3HD3A 1PADA 2R9CA 1PPOA 3QJ3A 4QH6A 2OZ2A 3CH3X 4YYUA 2VHSA 4QBBA 2DZZA 5A24A 5CHTA 3H8CA 1NLJA 7PCKA 1CJLA 3BWKA 1PPNA 3PW3A 3KW9A 2DC7A 2YJ9A 4RY2A 2DCBA 3IEJA 1STFE 5FPWA 4MZOA 1CPJA 5CVOB 1MHWA 1VJVA 2JQFR 3OF8A 1QXPA 1CV8A 4X6JA 5PADA 4MSXA 2B1MA 3P5VA 1PIPA 1F2BA 3BC3A 3TNXA 4PI3A 4FJCA 2YJCA 3S3RA 1BY8A 1YT7A 2G8JA 2FUDA 1ICFA 2YJ8A 4G54A 2CIOA 4YYVA 1W5RA 2AS8A 4YVAA 1YALA 1U9XA 4CDCB 3NHEA 4BQVA 2DJFB 2HH5A 1CQDA 1PPPA 2DC9A 2PADA 2R6NA 1KFUL 1ME4A 2C0YA 3WXEA 2R9FA 2PNSA 4PP1A 1S4VA 4FK5A 1MS6A 1NB3A 2DC6A 4QRVA 1IWDA 1PCIA 3S3QA 4CDFB 4Q8GA 1PXVA 3D9WA 2DJGB 1QDQA 2AUXA 1YK8A 1TU6A 5JA7A 2Y5BA 3PDFA 4XUIA 1Q6KA 2AUZA 3CBJA 4AXMA 2ARYA 4WA6A 4DMYA 1F2CA 1QMYA 4XR7A 1U5IA 2OP3A 4P6EA 1MEMA 4QRXA 1XKGA 2R9NA 4BGFA 2AYNA 9PAPA 1CTEA 2F7DA 1KHQA 1MIRA 2YJ2A 1F2AA 4W5CA 1NL6A 4CZWA 1U9QX 2HD5A 4W5BA 2FT2A 2VFCA 8PCHA 2DCDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HUC B;  1NQC A;  3ZUA A;  1TL9 A;  1U9V A;  2FRQ A;  3CH2 X;  5EGW A;  1YVB A;  3IHP A;  3IV2 A;  2AYO A;  1BP4 A;  1PE6 A;  1JQP A;  3RVW A;  4DMX A;  1GLO A;  2HXZ A;  3K9M A;  3OVZ A;  4BSQ A;  4BPV A;  1AU4 A;  1AU2 A;  1EWP A;  4PP2 E;  1GEC E;  3KWZ A;  3K24 A;  3USV A;  5EF4 A;  3AI8 A;  2AVW A;  1Y08 A;  2FRA A;  3RVV A;  2H7J A;  2YJB A;  2FTD A;  1AYU A;  4I04 A;  1KFX L;  2IPP B;  2P7U A;  3IUT A;  1DF0 A;  2G7Y A;  3ERV A;  1VSN A;  2GHU A;  4KLB A;  2WBF X;  2IBI A;  1MEG A;  2DCC A;  4PAD A;  1A6R A;  2GFO A;  5JH3 A;  4CDD B;  4X6H A;  3WXG A;  3O1G A;  5K16 A;  1ITO A;  5CHV A;  4CDE B;  1BQI A;  2ATO A;  4MZS A;  3BPF A;  2R9M A;  3KWB X;  1ZIV A;  2AIM A;  2F1G A;  4I07 A;  2O6X A;  2XU4 A;  2HHN A;  1KXR A;  2PBH A;  3MTN A;  2G6D A;  4YV8 A;  1AIM A;  3GCB A;  1X9Y A;  3N3G A;  3RVX A;  1AYV A;  2DC8 A;  3N3K A;  2OUL A;  3DF0 A;  3O0U A;  3OVX A;  5J94 A;  2PRE A;  1K3B B;  1NB5 A;  1AYW A;  2B1N A;  3HHA A;  4HWY A;  1FH0 A;  3MHH A;  1CSB B;  4N79 A;  1EWM A;  3LXS A;  2NQG A;  4W4U A;  4P6G A;  3P5U A;  3CBK A;  2NQD B;  1AEC A;  3IMA A;  4YYS A;  4BS5 A;  2ACT A;  3V6E A;  2E03 A;  3MHS A;  1CVZ A;  2G8E A;  2NQA A;  3BOW A;  1AU0 A;  2E01 A;  3PNR A;  4YYW A;  1ZCM A;  2DCA A;  1EWO A;  1O0E A;  3P5W A;  3I06 A;  2NQI A;  3E1Z B;  2XU1 A;  2FQ9 A;  3V6C A;  2E00 A;  2JQG R;  1DEU A;  2XU5 A;  1PPD A;  3BPM A;  2CB5 A;  2E02 A;  3IOQ A;  3OIS A;  1CS8 A;  3WXF A;  3F5V A;  1POP A;  1GCB A;  4N4Z A;  3QT4 A;  3BCN A;  1TLO A;  3KSE A;  1AU3 A;  5CVM A;  3LFY A;  2P0R A;  1BGO A;  1SNK A;  4I05 A;  4QRG A;  1GMY A;  3H8B A;  4YYR A;  3F75 A;  2R9O A;  1ATK A;  2FO5 A;  1YK7 A;  1THE A;  1NPZ A;  3HWN A;  3OF9 A;  3B79 A;  3KX1 A;  2P86 A;  3H6S A;  1KHP A;  2VHF A;  2DZY A;  4N8W A;  1EF7 A;  1SP4 B;  3C9E A;  3PBH A;  1PBH A;  4Q8H A;  1MDW A;  2XU3 A;  5F02 A;  3KFQ A;  4K7C A;  3P5X A;  3U8E A;  3KKU A;  6PAD A;  1F29 A;  4OEL A;  3N4C A;  4YYQ A;  2BDL A;  2BDZ A;  3MOR A;  2Y6E A;  1M6D A;  3K8U A;  4X6I A;  3H7D A;  3QSD A;  2FYE A;  4AXL A;  1CB5 A;  1QOL A;  2AU1 A;  4ZUX U;  3D6S A;  1ME3 A;  3HHI A;  1EWL A;  1Y4H A;  5CVN B;  1U9W A;  3H89 A;  3I3T A;  4FIP A;  4OEM A;  4BS6 A;  3M99 A;  3HD3 A;  1PAD A;  2R9C A;  1PPO A;  3QJ3 A;  4QH6 A;  2OZ2 A;  3CH3 X;  4YYU A;  2VHS A;  4QBB A;  2DZZ A;  5A24 A;  5CHT A;  3H8C A;  1NLJ A;  7PCK A;  1CJL A;  3BWK A;  1PPN A;  3PW3 A;  3KW9 A;  2DC7 A;  2YJ9 A;  4RY2 A;  2DCB A;  3IEJ A;  1STF E;  5FPW A;  4MZO A;  1CPJ A;  5CVO B;  1MHW A;  1VJV A;  2JQF R;  3OF8 A;  1QXP A;  1CV8 A;  4X6J A;  5PAD A;  4MSX A;  2B1M A;  3P5V A;  1PIP A;  1F2B A;  3BC3 A;  3TNX A;  4PI3 A;  4FJC A;  2YJC A;  3S3R A;  1BY8 A;  1YT7 A;  2G8J A;  2FUD A;  1ICF A;  2YJ8 A;  4G54 A;  2CIO A;  4YYV A;  2AS8 A;  4YVA A;  1YAL A;  1U9X A;  4CDC B;  3NHE A;  4BQV A;  2DJF B;  2HH5 A;  1CQD A;  1PPP A;  2DC9 A;  2PAD A;  2R6N A;  1KFU L;  1ME4 A;  2C0Y A;  3WXE A;  2R9F A;  2PNS A;  4PP1 A;  1S4V A;  4FK5 A;  1MS6 A;  1NB3 A;  2DC6 A;  4QRV A;  1IWD A;  1PCI A;  3S3Q A;  4CDF B;  4Q8G A;  1PXV A;  2DJG B;  1QDQ A;  2AUX A;  1YK8 A;  1TU6 A;  5JA7 A;  2Y5B A;  3PDF A;  4XUI A;  1Q6K A;  2AUZ A;  3CBJ A;  4AXM A;  2ARY A;  4WA6 A;  4DMY A;  1F2C A;  1QMY A;  4XR7 A;  1U5I A;  2OP3 A;  4P6E A;  1MEM A;  4QRX A;  1XKG A;  2R9N A;  2AYN A;  9PAP A;  1CTE A;  2F7D A;  1KHQ A;  1MIR A;  2YJ2 A;  1F2A A;  4W5C A;  1NL6 A;  4CZW A;  1U9Q X;  2HD5 A;  4W5B A;  2FT2 A;  8PCH A;  2DCD A; 
#chains in the Genus database with same CATH topology
 1HUC B;  1NQC A;  3ZUA A;  4RNA A;  1TL9 A;  1U9V A;  2FRQ A;  3CH2 X;  5EGW A;  1YVB A;  3IHP A;  3IV2 A;  3PHW A;  2AYO A;  1BP4 A;  1PE6 A;  1JQP A;  3RVW A;  1UKF A;  4DMX A;  1GLO A;  2HXZ A;  3K9M A;  3OVZ A;  4RF1 A;  4BSQ A;  4BPV A;  1AU4 A;  3PSE A;  1AU2 A;  4RKX A;  1EWP A;  4PP2 E;  1GEC E;  3KWZ A;  3K24 A;  3USV A;  5EF4 A;  3AI8 A;  2AVW A;  1Y08 A;  2FRA A;  3RVV A;  2H7J A;  2YJB A;  2FTD A;  4REZ A;  4WUR A;  1AYU A;  4I04 A;  1KFX L;  2IPP B;  2P7U A;  3IUT A;  1DF0 A;  2G7Y A;  3ERV A;  1VSN A;  2GHU A;  4KLB A;  4PT5 A;  2WBF X;  2IBI A;  1MEG A;  2DCC A;  4PAD A;  1A6R A;  2GFO A;  5JH3 A;  4P16 A;  4CDD B;  4X6H A;  3WXG A;  3O1G A;  5K16 A;  1ITO A;  5CHV A;  4CDE B;  4XZX A;  1BQI A;  2ATO A;  4MZS A;  5JZE A;  3BPF A;  2R9M A;  3KWB X;  1ZIV A;  2AIM A;  2F1G A;  4I07 A;  2O6X A;  2XU4 A;  2BTW A;  2HHN A;  4GUA A;  1KXR A;  2PBH A;  3MTN A;  2BU3 A;  2G6D A;  4YV8 A;  1AIM A;  3GCB A;  1X9Y A;  3N3G A;  3RVX A;  1AYV A;  2DC8 A;  3N3K A;  2OUL A;  3DF0 A;  3O0U A;  3OVX A;  5J94 A;  2PRE A;  4BOZ A;  1K3B B;  4D8B A;  1NB5 A;  1AYW A;  2B1N A;  3HHA A;  4HWY A;  1FH0 A;  3MHH A;  1CSB B;  4N79 A;  1EWM A;  4RF0 A;  3O65 A;  1PVJ A;  3LXS A;  2NQG A;  3BB7 A;  3BY4 A;  4W4U A;  4P6G A;  3P5U A;  3CBK A;  2NQD B;  1AEC A;  3IMA A;  4YYS A;  4BS5 A;  2ACT A;  3V6E A;  3PT2 A;  2E03 A;  3MHS A;  1CVZ A;  2BTW B;  2G8E A;  2NQA A;  3BOW A;  1AU0 A;  2E01 A;  3PNR A;  4YYW A;  1ZCM A;  2DCA A;  1EWO A;  1O0E A;  3P5W A;  3I06 A;  3E1Z B;  2NQI A;  2XU1 A;  2FQ9 A;  3V6C A;  4OVZ A;  2E00 A;  2JQG R;  1DEU A;  2XU5 A;  1PPD A;  3BPM A;  2CB5 A;  4ZTB A;  2JRI A;  2E02 A;  5EZQ A;  3C0R A;  3IOQ A;  3OIS A;  1CS8 A;  3WXF A;  3F5V A;  4BOQ A;  1POP A;  1GCB A;  3MTV A;  4N4Z A;  3QT4 A;  3BCN A;  1TLO A;  3KSE A;  1AU3 A;  3MJ5 A;  5CVM A;  3LFY A;  2P0R A;  1BGO A;  1SNK A;  4I05 A;  4QRG A;  1GMY A;  3H8B A;  4YYR A;  3F75 A;  3W31 A;  2R9O A;  1ATK A;  2FO5 A;  1YK7 A;  1THE A;  1NPZ A;  3W30 A;  3HWN A;  3PRM A;  3OF9 A;  3B79 A;  3KX1 A;  2P86 A;  4OVZ B;  3H6S A;  1KHP A;  2VHF A;  4D8E A;  5KO3 A;  2DZY A;  4N8W A;  1EF7 A;  1SP4 B;  3C9E A;  3PBH A;  1PBH A;  4Q8H A;  1MDW A;  2XU3 A;  5F02 A;  3MP2 A;  3KFQ A;  4K7C A;  3P5X A;  3U8E A;  3KKU A;  6PAD A;  1F29 A;  4HXD B;  4BOP A;  4OEL A;  3N4C A;  4YYQ A;  2BDL A;  2BDZ A;  4A5U A;  3MOR A;  2Y6E A;  1M6D A;  3K8U A;  4X6I A;  3H7D A;  3QSD A;  2FYE A;  4AXL A;  1CB5 A;  1QOL A;  2AU1 A;  4ZUX U;  3D6S A;  4BOS A;  1ME3 A;  3HHI A;  1EWL A;  1Y4H A;  4MM3 B;  5CVN B;  1U9W A;  3H89 A;  3I3T A;  4FIP A;  4OEM A;  4IUM A;  4BS6 A;  3M99 A;  4R3D A;  3HD3 A;  1PAD A;  2R9C A;  1PPO A;  3QJ3 A;  4QH6 A;  2OZ2 A;  3CH3 X;  4YYU A;  3BBA A;  2VHS A;  2JTC A;  4QBB A;  3E9S A;  2DZZ A;  5A24 A;  5CHT A;  3H8C A;  1NLJ A;  7PCK A;  1CJL A;  3BWK A;  1PPN A;  2DOS A;  3PW3 A;  3KW9 A;  2DC7 A;  2YJ9 A;  4RY2 A;  2DCB A;  3IEJ A;  1STF E;  5FPW A;  2AGA A;  4MZO A;  1CPJ A;  4M0W A;  5CVO B;  1YZB A;  1MHW A;  1VJV A;  2JQF R;  3OF8 A;  1QXP A;  1CV8 A;  4X6J A;  5PAD A;  4IP3 A;  4MSX A;  3B21 A;  2B1M A;  3P5V A;  3TRK A;  1PIP A;  1F2B A;  3BC3 A;  3TNX A;  4PI3 A;  4MI7 A;  4FJC A;  2YJC A;  3S3R A;  1BY8 A;  1YT7 A;  2G8J A;  3PRP A;  2FUD A;  1ICF A;  2YJ8 A;  4G54 A;  3PHX A;  2CIO A;  3PHU A;  4YYV A;  2AS8 A;  4YVA A;  1YAL A;  1U9X A;  2J7Q A;  4CDC B;  3NHE A;  4BQV A;  2Z84 A;  2DJF B;  2HH5 A;  2UZJ A;  1CQD A;  1PPP A;  3TMP A;  1DKI A;  2DC9 A;  3OQC A;  2PAD A;  3RNV A;  2R6N A;  1KFU L;  1ME4 A;  2C0Y A;  3WXE A;  2R9F A;  2PNS A;  4PP1 A;  5EZS A;  1S4V A;  4FK5 A;  1MS6 A;  1NB3 A;  2DC6 A;  4QRV A;  1IWD A;  2FE8 A;  1PCI A;  3S3Q A;  4CDF B;  4Q8G A;  1PXV A;  2DJG B;  1QDQ A;  2AUX A;  3IFU A;  5E6J A;  1YK8 A;  1TU6 A;  5JA7 A;  2Y5B A;  3PDF A;  4XUI A;  1Q6K A;  2AUZ A;  3CBJ A;  4AXM A;  2ARY A;  4WA6 A;  4DMY A;  1F2C A;  2HWK A;  1QMY A;  4XR7 A;  1U5I A;  4BOU A;  2OP3 A;  4P6E A;  1MEM A;  4QRX A;  4OW0 A;  1XKG A;  2R9N A;  2AYN A;  9PAP A;  1CTE A;  2F7D A;  1KHQ A;  1MIR A;  2YJ2 A;  1F2A A;  4W5C A;  1NL6 A;  4CZW A;  1U9Q X;  2HD5 A;  4D8I A;  4W5B A;  2FT2 A;  2J7Q C;  8PCH A;  3ZNH A;  2DCD A; 
#chains in the Genus database with same CATH homology
 1HUC B;  1NQC A;  3ZUA A;  1TL9 A;  1U9V A;  2FRQ A;  3CH2 X;  5EGW A;  1YVB A;  3IHP A;  3IV2 A;  2AYO A;  1BP4 A;  1PE6 A;  1JQP A;  3RVW A;  4DMX A;  1GLO A;  2HXZ A;  3K9M A;  3OVZ A;  4BSQ A;  4BPV A;  1AU4 A;  1AU2 A;  1EWP A;  4PP2 E;  2BSZ A;  1GEC E;  3KWZ A;  3K24 A;  3USV A;  5EF4 A;  3AI8 A;  2AVW A;  4B55 A;  1Y08 A;  2FRA A;  3RVV A;  2H7J A;  2YJB A;  2FTD A;  1AYU A;  4I04 A;  1KFX L;  2IPP B;  2P7U A;  3IUT A;  1DF0 A;  2G7Y A;  3ERV A;  1VSN A;  1W4T A;  2GHU A;  4KLB A;  2WBF X;  2IBI A;  1MEG A;  2DCC A;  4PAD A;  1A6R A;  2GFO A;  5JH3 A;  2VFB A;  4CDD B;  4X6H A;  3WXG A;  3O1G A;  5K16 A;  1ITO A;  5CHV A;  4CDE B;  1BQI A;  2ATO A;  4MZS A;  3BPF A;  2R9M A;  3KWB X;  1ZIV A;  2AIM A;  2F1G A;  4I07 A;  2O6X A;  2XU4 A;  2HHN A;  1KXR A;  2PBH A;  3MTN A;  2G6D A;  4YV8 A;  1AIM A;  3GCB A;  1X9Y A;  3N3G A;  3RVX A;  1AYV A;  2DC8 A;  3N3K A;  2OUL A;  3DF0 A;  3O0U A;  3OVX A;  5J94 A;  2PRE A;  1K3B B;  1NB5 A;  1AYW A;  2B1N A;  3HHA A;  4HWY A;  1FH0 A;  3MHH A;  1CSB B;  4N79 A;  1EWM A;  3LXS A;  1W6F A;  2NQG A;  4W4U A;  4P6G A;  3P5U A;  3CBK A;  2NQD B;  1AEC A;  3IMA A;  4YYS A;  4BS5 A;  2ACT A;  3V6E A;  2E03 A;  3MHS A;  1CVZ A;  2G8E A;  2NQA A;  3BOW A;  1AU0 A;  2E01 A;  3PNR A;  4YYW A;  1E2T A;  1ZCM A;  2DCA A;  1EWO A;  1O0E A;  3P5W A;  3I06 A;  2NQI A;  3E1Z B;  2XU1 A;  2FQ9 A;  3V6C A;  2E00 A;  2JQG R;  1DEU A;  2XU5 A;  1PPD A;  3BPM A;  2CB5 A;  2E02 A;  3IOQ A;  3OIS A;  1CS8 A;  3WXF A;  3F5V A;  1POP A;  1GCB A;  4N4Z A;  3QT4 A;  3BCN A;  4GUZ A;  1TLO A;  3KSE A;  1AU3 A;  5CVM A;  3LFY A;  2P0R A;  1BGO A;  1SNK A;  4I05 A;  4QRG A;  4C5P A;  1GMY A;  3H8B A;  4YYR A;  3F75 A;  2R9O A;  1ATK A;  2FO5 A;  1YK7 A;  1THE A;  1NPZ A;  3HWN A;  3OF9 A;  3B79 A;  3KX1 A;  2P86 A;  3H6S A;  1KHP A;  2VHF A;  3LTW A;  2DZY A;  4N8W A;  1EF7 A;  1SP4 B;  3C9E A;  3PBH A;  1PBH A;  4Q8H A;  1MDW A;  2XU3 A;  5F02 A;  3KFQ A;  4K7C A;  3P5X A;  4NV8 A;  3U8E A;  3KKU A;  6PAD A;  1F29 A;  4OEL A;  3N4C A;  4YYQ A;  2BDL A;  2BDZ A;  4NV7 A;  3MOR A;  2Y6E A;  1M6D A;  3K8U A;  4X6I A;  3H7D A;  1GX3 A;  2FYE A;  3QSD A;  4AXL A;  1CB5 A;  1QOL A;  2AU1 A;  4ZUX U;  3D6S A;  1ME3 A;  3HHI A;  1EWL A;  1Y4H A;  5CVN B;  1U9W A;  3H89 A;  3I3T A;  4FIP A;  4OEM A;  4BS6 A;  3M99 A;  3HD3 A;  1PAD A;  2R9C A;  1PPO A;  3QJ3 A;  4QH6 A;  2OZ2 A;  3CH3 X;  4YYU A;  2VHS A;  4QBB A;  2DZZ A;  5A24 A;  5CHT A;  3H8C A;  1NLJ A;  7PCK A;  1CJL A;  3BWK A;  1PPN A;  3PW3 A;  3KW9 A;  2DC7 A;  2YJ9 A;  4RY2 A;  2DCB A;  3IEJ A;  1STF E;  5FPW A;  4MZO A;  1CPJ A;  5CVO B;  1MHW A;  1VJV A;  2JQF R;  3OF8 A;  1QXP A;  1CV8 A;  4X6J A;  5PAD A;  4MSX A;  2B1M A;  3P5V A;  1PIP A;  1F2B A;  3BC3 A;  3TNX A;  4PI3 A;  4FJC A;  2YJC A;  3S3R A;  1BY8 A;  1YT7 A;  2G8J A;  2FUD A;  1ICF A;  2YJ8 A;  4G54 A;  2CIO A;  4YYV A;  1W5R A;  2AS8 A;  4YVA A;  1YAL A;  1U9X A;  4CDC B;  3NHE A;  4BQV A;  2DJF B;  2HH5 A;  1CQD A;  1PPP A;  2DC9 A;  2PAD A;  2R6N A;  1KFU L;  1ME4 A;  2C0Y A;  3WXE A;  2R9F A;  2PNS A;  4PP1 A;  1S4V A;  4FK5 A;  1MS6 A;  1NB3 A;  2DC6 A;  4QRV A;  1IWD A;  1PCI A;  3S3Q A;  4CDF B;  4Q8G A;  1PXV A;  3D9W A;  2DJG B;  1QDQ A;  2AUX A;  1YK8 A;  1TU6 A;  5JA7 A;  2Y5B A;  3PDF A;  4XUI A;  1Q6K A;  2AUZ A;  3CBJ A;  4AXM A;  2ARY A;  4WA6 A;  4DMY A;  1F2C A;  1QMY A;  4XR7 A;  1U5I A;  2OP3 A;  4P6E A;  1MEM A;  4QRX A;  1XKG A;  2R9N A;  4BGF A;  2AYN A;  9PAP A;  1CTE A;  2F7D A;  1KHQ A;  1MIR A;  2YJ2 A;  1F2A A;  4W5C A;  1NL6 A;  4CZW A;  1U9Q X;  2HD5 A;  4W5B A;  2FT2 A;  2VFC A;  8PCH A;  2DCD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...