5FPWA

Procathepsin b s9 from trypanosoma congolense
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
306
structure length
292
Chain Sequence
b'APVLTKTFVDRINQLNGGMWKAVYNGKMQNITFAEAKRLTGAWIQKTSSLPPVRFTEEQLRTELPESFDSAEKWPNCPTIREIADQSACRASWAVSTASVISDRYCTVGGVQQLRISAAHLLSCCKQCGGGCKGGFPGFAWRYYVEYGIASSYCQPYPFPHCENFDTPKCQATCTDKSIPLVKYRGSATYLLLHGEEDYKRELYFNGPFVAVFYVYTDLFAYKSGVYRHVDGDFLGGTAVKVVGWGKLNGTPYWKVANTWDTDWGMDGYLLILRGNNECNIEHLGFAGTPET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PRO CATHEPSIN B S9
publication title 2.1 Angstrom Crystal Structure of Pro Cathepsin B S9 from Trypanosoma Congolense
rcsb
source organism Trypanosoma congolense
molecule tags Hydrolase
total genus 92
structure length 292
sequence length 306
chains with identical sequence B, C
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2015-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 5fpwA00
3CH2X 2Y6EA 2GFOA 2AYOA 3CBJA 3N3GA 4FJCA 1EWOA 6PADA 3MTNA 2P0RA 2AU1A 3NHEA 7PCKA 1ME4A 4YYWA 3OISA 4Q8HA 1EF7A 2R6NA 4QRGA 1VSNA 4W4UA 5A24A 3OF8A 5CHVA 4CDFB 2NQDB 2YJCA 5JA7A 3IHPA 3OF9A 2DJGB 4W5CA 4FK5A 1CV8A 5PADA 1TU6A 2XU4A 2FYEA 1ME3A 2G6DA 1KFXL 2R9NA 3IUTA 4HWYA 3V6EA 4BS6A 4W5BA 3K24A 2XU1A 4YVAA 2HXZA 2ARYA 1KXRA 3H8CA 1ZIVA 3QJ3A 3N4CA 1QDQA 1ITOA 1FH0A 1EWLA 1XKGA 1AECA 2NQAA 3QSDA 4QBBA 1EWPA 1M6DA 4WA6A 4PADA 1AU0A 4MZOA 3RVWA 3H89A 3HD3A 1PCIA 1AIMA 2BDLA 2FRAA 1AYVA 2OULA 2VHSA 3K8UA 1TL9A 3I06A 2IPPB 4DMXA 2FO5A 1SP4B 2HD5A 1PADA 2DCBA 4ZUXU 3H6SA 2YJ8A 1GCBA 1KHQA 3HHAA 2YJ9A 3TNXA 1K3BB 1MHWA 3OVZA 2FTDA 2G8EA 2AS8A 1BP4A 4RY2A 1U9QX 2R9CA 4KLBA 4CDDB 2OZ2A 3KSEA 9PAPA 1QXPA 3IMAA 2DZYA 2Y5BA 3KX1A 3C9EA 1POPA 2E00A 3HWNA 3ERVA 2NQGA 2YJBA 2IBIA 1KHPA 3V6CA 2AYNA 2XU5A 1MEGA 1AU3A 1AU2A 3RVVA 4K7CA 3ZUAA 2ATOA 1SNKA 2FUDA 1IWDA 2DC9A 2BDZA 1YK8A 2JQFR 1AYUA 2OP3A 3F5VA 1QOLA 1CB5A 4YYRA 3PBHA 3S3QA 3P5VA 1F29A 4XR7A 2DCDA 2DC7A 1JQPA 2DCCA 3S3RA 4YYSA 2P86A 4N4ZA 4BSQA 5J94A 2G7YA 4AXMA 1YVBA 2AVWA 3GCBA 4X6HA 3IOQA 2DJFB 4PI3A 1CJLA 4N8WA 4YYUA 1CQDA 3BC3A 1YK7A 2PBHA 2FT2A 4BS5A 3MORA 3F75A 4CDCB 4AXLA 4QRXA 3BCNA 1ATKA 4I07A 4P6GA 2FRQA 4MZSA 4YYVA 3K9MA 3O0UA 4X6JA 1VJVA 3CBKA 1NPZA 1GECE 1U9XA 2P7UA 4I04A 4PP2E 3RVXA 3M99A 3H7DA 1EWMA 5CVOB 1BGOA 3CH3X 5CVMA 1F2CA 1CS8A 1Y08A 3I3TA 3U8EA 2F1GA 2R9MA 2GHUA 1CTEA 5EF4A 1PPPA 3E1ZB 1BY8A 3HHIA 3KWBX 4G54A 4BQVA 3KW9A 3BPMA 1NB5A 4OEMA 2E03A 3OVXA 2PADA 3H8BA 1YALA 3MHSA 2HHNA 5FPWA 3BPFA 2FQ9A 2CIOA 1PIPA 4PP1A 2DCAA 4QH6A 2DZZA 4N79A 2WBFX 2B1NA 1ZCMA 1F2AA 3PW3A 5K16A 1TLOA 3WXEA 4YYQA 2YJ2A 4BPVA 1QMYA 2B1MA 3D6SA 2AIMA 2HH5A 3PNRA 1U5IA 2G8JA 2F7DA 1MEMA 4CDEB 1DF0A 1STFE 4FIPA 2CB5A 3P5XA 2H7JA 3O1GA 3B79A 2DC6A 1PPOA 1U9WA 4QRVA 2E02A 4DMYA 1THEA 4YV8A 1MDWA 1BQIA 1X9YA 1PBHA 1MS6A 4MSXA 1A6RA 4X6IA 1CSBB 2PREA 1NLJA 4P6EA 1PPDA 2E01A 3WXFA 4Q8GA 8PCHA 1HUCB 3KKUA 4CZWA 3IV2A 1F2BA 1MIRA 4I05A 1PXVA 2JQGR 1ICFA 2AUZA 2ACTA 1NL6A 3DF0A 3BOWA 5JH3A 1GLOA 3LXSA 3IEJA 3P5WA 2DC8A 3PDFA 3N3KA 5EGWA 1NQCA 1S4VA 1O0EA 2NQIA 2PNSA 3USVA 5CHTA 1GMYA 2O6XA 3WXGA 2R9FA 1AU4A 1YT7A 1DEUA 3P5UA 1CPJA 2VHFA 1Y4HA 5F02A 3QT4A 1NB3A 1KFUL 1PE6A 4OELA 4XUIA 1CVZA 1Q6KA 3AI8A 1U9VA 2R9OA 3LFYA 1AYWA 2XU3A 3MHHA 2C0YA 5CVNB 3KWZA 3BWKA 2AUXA 1PPNA 3KFQA
chains in the Genus database with same CATH superfamily
3CH2X 2Y6EA 2GFOA 2AYOA 3CBJA 3N3GA 4FJCA 1EWOA 6PADA 3MTNA 2P0RA 4M0WA 2AU1A 3NHEA 4BOUA 7PCKA 1ME4A 5JZEA 4YYWA 2J7QA 3OISA 4Q8HA 1EF7A 2R6NA 4QRGA 1VSNA 4W4UA 4D8IA 5A24A 2HWKA 3TMPA 3OF8A 4OVZA 5CHVA 4CDFB 2NQDB 2YJCA 5JA7A 3IHPA 3OF9A 2DJGB 4W5CA 4RNAA 4FK5A 1CV8A 4RF0A 5PADA 1TU6A 4D8EA 2XU4A 2FYEA 1ME3A 2G6DA 1KFXL 2R9NA 3IUTA 4HWYA 3V6EA 4BS6A 4W5BA 2BTWB 4HXDB 3K24A 2XU1A 2AGAA 4YVAA 2HXZA 2ARYA 3W30A 1KXRA 3H8CA 1ZIVA 3QJ3A 2BU3A 3N4CA 4D8BA 1QDQA 2FE8A 1ITOA 1FH0A 3OQCA 4MM3B 1EWLA 1XKGA 1AECA 2NQAA 3QSDA 4QBBA 1EWPA 1M6DA 4WA6A 4PADA 5KO3A 2Z84A 1AU0A 4MZOA 3RVWA 3H89A 3HD3A 1PCIA 1AIMA 4RF1A 2JRIA 2J7QC 2BDLA 2FRAA 4PT5A 1AYVA 2OULA 2VHSA 3K8UA 1TL9A 3I06A 2IPPB 4DMXA 1DKIA 2FO5A 1SP4B 2HD5A 1PADA 2DCBA 4ZUXU 3H6SA 2YJ8A 1GCBA 3E9SA 1KHQA 3HHAA 2YJ9A 4IP3A 3TNXA 1K3BB 1MHWA 3OVZA 2FTDA 2G8EA 2AS8A 5EZSA 1BP4A 4RY2A 1U9QX 2R9CA 4KLBA 4CDDB 2OZ2A 3KSEA 9PAPA 1QXPA 3PHUA 3IMAA 2DZYA 2Y5BA 3KX1A 5EZQA 3C9EA 1POPA 2E00A 1YZBA 3HWNA 3ERVA 2NQGA 2YJBA 2IBIA 4ZTBA 1KHPA 2DOSA 3V6CA 2AYNA 2XU5A 1MEGA 1AU3A 1AU2A 4GUAA 3RVVA 4K7CA 3ZUAA 2ATOA 1SNKA 2FUDA 1IWDA 2DC9A 2BDZA 4BOPA 1YK8A 2JQFR 1AYUA 3O65A 2OP3A 3F5VA 1QOLA 1CB5A 4YYRA 3PBHA 3S3QA 3P5VA 1F29A 4XR7A 2DCDA 2DC7A 1JQPA 2DCCA 3S3RA 4YYSA 2P86A 3BB7A 4N4ZA 4BSQA 5J94A 2G7YA 3MJ5A 3IFUA 3PSEA 4AXMA 1YVBA 2AVWA 3PHXA 3GCBA 4X6HA 3IOQA 4OVZB 2DJFB 4PI3A 1CJLA 4N8WA 4YYUA 1CQDA 3BC3A 1YK7A 4BOQA 2PBHA 2FT2A 4BS5A 3MORA 3F75A 4CDCB 3MP2A 4AXLA 4QRXA 3BCNA 1ATKA 4I07A 1UKFA 4P6GA 2FRQA 5E6JA 4MZSA 4YYVA 3K9MA 3O0UA 4X6JA 3BBAA 1VJVA 3CBKA 1NPZA 1GECE 1U9XA 2P7UA 4I04A 4PP2E 3RVXA 3M99A 3H7DA 1EWMA 5CVOB 1BGOA 3CH3X 5CVMA 4WURA 1F2CA 1CS8A 1Y08A 3I3TA 2UZJA 3U8EA 2F1GA 2R9MA 2GHUA 1CTEA 5EF4A 1PPPA 3E1ZB 1BY8A 3HHIA 3KWBX 4G54A 4A5UA 4BQVA 3KW9A 3BPMA 4XZXA 1NB5A 4OEMA 2E03A 3OVXA 2PADA 3H8BA 3B21A 1YALA 3MHSA 2HHNA 5FPWA 3BPFA 2FQ9A 2CIOA 1PIPA 4PP1A 2DCAA 4QH6A 2DZZA 4N79A 2WBFX 2B1NA 2BTWA 3MTVA 4REZA 1ZCMA 1F2AA 3PW3A 5K16A 1TLOA 3WXEA 4YYQA 2YJ2A 3PHWA 4BPVA 1QMYA 2B1MA 3D6SA 2AIMA 2HH5A 3PNRA 1U5IA 2G8JA 2F7DA 1MEMA 3W31A 4CDEB 1DF0A 1STFE 4FIPA 2CB5A 3P5XA 2H7JA 3O1GA 3B79A 3BY4A 2JTCA 2DC6A 1PPOA 1U9WA 4QRVA 2E02A 4DMYA 1THEA 4YV8A 1MDWA 1BQIA 1PVJA 1X9YA 1PBHA 1MS6A 4MSXA 1A6RA 4X6IA 1CSBB 3PRPA 2PREA 1NLJA 4P6EA 1PPDA 2E01A 3WXFA 4Q8GA 8PCHA 1HUCB 3KKUA 4CZWA 3IV2A 1F2BA 3PRMA 1MIRA 4I05A 1PXVA 2JQGR 4OW0A 1ICFA 3PT2A 2AUZA 2ACTA 1NL6A 3DF0A 4BOSA 3BOWA 4P16A 5JH3A 1GLOA 4RKXA 3LXSA 3IEJA 3P5WA 2DC8A 3PDFA 3N3KA 5EGWA 1NQCA 1S4VA 3ZNHA 1O0EA 2NQIA 2PNSA 3RNVA 3USVA 5CHTA 1GMYA 2O6XA 3WXGA 4MI7A 2R9FA 1AU4A 1YT7A 1DEUA 3P5UA 1CPJA 2VHFA 4BOZA 1Y4HA 5F02A 3QT4A 1NB3A 1KFUL 1PE6A 4OELA 4XUIA 1CVZA 1Q6KA 3AI8A 1U9VA 2R9OA 3C0RA 3LFYA 4R3DA 1AYWA 4IUMA 2XU3A 3TRKA 3MHHA 2C0YA 5CVNB 3KWZA 3BWKA 2AUXA 1PPNA 3KFQA
chains in the Genus database with same CATH topology
3CH2X 2Y6EA 2GFOA 2AYOA 3CBJA 3N3GA 4FJCA 1EWOA 2VFBA 6PADA 3MTNA 2P0RA 2AU1A 3NHEA 7PCKA 1ME4A 4YYWA 3OISA 4Q8HA 1EF7A 2R6NA 4QRGA 1VSNA 4W4UA 5A24A 3OF8A 5CHVA 4CDFB 2NQDB 2YJCA 5JA7A 1E2TA 3IHPA 3OF9A 2DJGB 4W5CA 4FK5A 1CV8A 5PADA 1TU6A 2XU4A 2FYEA 1ME3A 2G6DA 3LTWA 1KFXL 2R9NA 3IUTA 4HWYA 3V6EA 4BS6A 4W5BA 1W5RA 3K24A 2XU1A 4YVAA 2HXZA 2ARYA 1KXRA 3H8CA 1ZIVA 3QJ3A 3N4CA 1QDQA 1ITOA 1FH0A 1EWLA 1XKGA 1AECA 2NQAA 3QSDA 4QBBA 1EWPA 1M6DA 4WA6A 4PADA 1AU0A 4MZOA 3RVWA 3H89A 3HD3A 1PCIA 1AIMA 4C5PA 2BDLA 2FRAA 2VFCA 1AYVA 2OULA 2VHSA 3K8UA 1TL9A 3I06A 2IPPB 4DMXA 2FO5A 1SP4B 2HD5A 1PADA 2DCBA 4ZUXU 3H6SA 2YJ8A 1GCBA 1KHQA 3HHAA 2YJ9A 3TNXA 1K3BB 1MHWA 3OVZA 2FTDA 2G8EA 2AS8A 2BSZA 1BP4A 4RY2A 1U9QX 2R9CA 4KLBA 4CDDB 2OZ2A 3KSEA 9PAPA 1QXPA 3IMAA 2DZYA 2Y5BA 3KX1A 3C9EA 1POPA 2E00A 3HWNA 3ERVA 2NQGA 2YJBA 2IBIA 1KHPA 3V6CA 2AYNA 2XU5A 1MEGA 1AU3A 1AU2A 3RVVA 4K7CA 3ZUAA 2ATOA 4BGFA 1GX3A 1SNKA 2FUDA 1IWDA 2DC9A 2BDZA 1YK8A 2JQFR 1AYUA 2OP3A 3F5VA 1QOLA 1CB5A 4YYRA 3PBHA 3S3QA 3P5VA 1F29A 4XR7A 2DCDA 2DC7A 1JQPA 2DCCA 3S3RA 4YYSA 2P86A 4N4ZA 4BSQA 5J94A 2G7YA 4AXMA 1YVBA 2AVWA 3GCBA 4X6HA 3IOQA 2DJFB 4PI3A 1CJLA 4N8WA 4YYUA 1CQDA 3BC3A 1YK7A 2PBHA 4NV7A 2FT2A 4BS5A 3MORA 3F75A 4CDCB 4AXLA 4QRXA 3BCNA 1ATKA 4I07A 4P6GA 2FRQA 4MZSA 4YYVA 3K9MA 3O0UA 4X6JA 1VJVA 3CBKA 1NPZA 1GECE 1U9XA 2P7UA 4I04A 4PP2E 3RVXA 3M99A 3H7DA 1EWMA 5CVOB 1BGOA 3CH3X 5CVMA 1F2CA 1CS8A 1Y08A 3I3TA 3U8EA 2F1GA 2R9MA 2GHUA 1CTEA 5EF4A 1PPPA 3E1ZB 1BY8A 3HHIA 3KWBX 4G54A 4BQVA 3KW9A 3BPMA 1NB5A 4OEMA 2E03A 3OVXA 2PADA 3H8BA 1W4TA 1YALA 3MHSA 2HHNA 5FPWA 3BPFA 2FQ9A 2CIOA 1PIPA 4PP1A 2DCAA 4QH6A 2DZZA 4N79A 2WBFX 2B1NA 1ZCMA 1F2AA 3PW3A 5K16A 1TLOA 3WXEA 4YYQA 2YJ2A 4BPVA 1QMYA 2B1MA 3D6SA 2AIMA 2HH5A 3PNRA 1U5IA 2G8JA 2F7DA 1MEMA 4CDEB 1DF0A 1STFE 4FIPA 2CB5A 3P5XA 2H7JA 3O1GA 3B79A 2DC6A 1PPOA 1U9WA 4QRVA 4B55A 2E02A 4DMYA 1THEA 4YV8A 1MDWA 1BQIA 1X9YA 1PBHA 1MS6A 4MSXA 1A6RA 4X6IA 1CSBB 2PREA 1NLJA 4P6EA 1PPDA 2E01A 3D9WA 3WXFA 4Q8GA 8PCHA 1HUCB 3KKUA 4CZWA 3IV2A 1F2BA 1W6FA 1MIRA 4I05A 1PXVA 2JQGR 1ICFA 2AUZA 2ACTA 1NL6A 3DF0A 3BOWA 5JH3A 1GLOA 3LXSA 3IEJA 3P5WA 2DC8A 3PDFA 3N3KA 5EGWA 1NQCA 1S4VA 1O0EA 2NQIA 2PNSA 3USVA 5CHTA 1GMYA 2O6XA 3WXGA 2R9FA 1AU4A 1YT7A 1DEUA 3P5UA 1CPJA 2VHFA 1Y4HA 5F02A 3QT4A 1NB3A 1KFUL 1PE6A 4OELA 4XUIA 1CVZA 1Q6KA 3AI8A 1U9VA 4NV8A 2R9OA 3LFYA 4GUZA 1AYWA 2XU3A 3MHHA 2C0YA 5CVNB 3KWZA 3BWKA 2AUXA 1PPNA 3KFQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CH2 X;  2Y6E A;  2GFO A;  2AYO A;  3CBJ A;  3N3G A;  4FJC A;  1EWO A;  6PAD A;  3MTN A;  2P0R A;  2AU1 A;  3NHE A;  7PCK A;  1ME4 A;  4YYW A;  3OIS A;  4Q8H A;  1EF7 A;  2R6N A;  4QRG A;  1VSN A;  4W4U A;  5A24 A;  3OF8 A;  5CHV A;  4CDF B;  2NQD B;  2YJC A;  5JA7 A;  3IHP A;  3OF9 A;  2DJG B;  4W5C A;  4FK5 A;  1CV8 A;  5PAD A;  1TU6 A;  2XU4 A;  2FYE A;  1ME3 A;  2G6D A;  1KFX L;  2R9N A;  3IUT A;  4HWY A;  3V6E A;  4BS6 A;  4W5B A;  3K24 A;  2XU1 A;  4YVA A;  2HXZ A;  2ARY A;  1KXR A;  3H8C A;  1ZIV A;  3QJ3 A;  3N4C A;  1QDQ A;  1ITO A;  1FH0 A;  1EWL A;  1XKG A;  1AEC A;  2NQA A;  3QSD A;  4QBB A;  1EWP A;  1M6D A;  4WA6 A;  4PAD A;  1AU0 A;  4MZO A;  3RVW A;  3H89 A;  3HD3 A;  1PCI A;  1AIM A;  2BDL A;  2FRA A;  1AYV A;  2OUL A;  2VHS A;  3K8U A;  1TL9 A;  3I06 A;  2IPP B;  4DMX A;  2FO5 A;  1SP4 B;  2HD5 A;  1PAD A;  2DCB A;  4ZUX U;  3H6S A;  2YJ8 A;  1GCB A;  1KHQ A;  3HHA A;  2YJ9 A;  3TNX A;  1K3B B;  1MHW A;  3OVZ A;  2FTD A;  2G8E A;  2AS8 A;  1BP4 A;  4RY2 A;  1U9Q X;  2R9C A;  4KLB A;  4CDD B;  2OZ2 A;  3KSE A;  9PAP A;  1QXP A;  3IMA A;  2DZY A;  2Y5B A;  3KX1 A;  3C9E A;  1POP A;  2E00 A;  3HWN A;  3ERV A;  2NQG A;  2YJB A;  2IBI A;  1KHP A;  3V6C A;  2AYN A;  2XU5 A;  1MEG A;  1AU3 A;  1AU2 A;  3RVV A;  4K7C A;  3ZUA A;  2ATO A;  1SNK A;  2FUD A;  1IWD A;  2DC9 A;  2BDZ A;  1YK8 A;  2JQF R;  1AYU A;  2OP3 A;  3F5V A;  1QOL A;  1CB5 A;  4YYR A;  3PBH A;  3S3Q A;  3P5V A;  1F29 A;  4XR7 A;  2DCD A;  2DC7 A;  1JQP A;  2DCC A;  3S3R A;  4YYS A;  2P86 A;  4N4Z A;  4BSQ A;  5J94 A;  2G7Y A;  4AXM A;  1YVB A;  2AVW A;  3GCB A;  4X6H A;  3IOQ A;  2DJF B;  4PI3 A;  1CJL A;  4N8W A;  4YYU A;  1CQD A;  3BC3 A;  1YK7 A;  2PBH A;  2FT2 A;  4BS5 A;  3MOR A;  3F75 A;  4CDC B;  4AXL A;  4QRX A;  3BCN A;  1ATK A;  4I07 A;  4P6G A;  2FRQ A;  4MZS A;  4YYV A;  3K9M A;  3O0U A;  4X6J A;  1VJV A;  3CBK A;  1NPZ A;  1GEC E;  1U9X A;  2P7U A;  4I04 A;  4PP2 E;  3RVX A;  3M99 A;  3H7D A;  1EWM A;  5CVO B;  1BGO A;  3CH3 X;  5CVM A;  1F2C A;  1CS8 A;  1Y08 A;  3I3T A;  3U8E A;  2F1G A;  2R9M A;  2GHU A;  1CTE A;  5EF4 A;  1PPP A;  3E1Z B;  1BY8 A;  3HHI A;  3KWB X;  4G54 A;  4BQV A;  3KW9 A;  3BPM A;  1NB5 A;  4OEM A;  2E03 A;  3OVX A;  2PAD A;  3H8B A;  1YAL A;  3MHS A;  2HHN A;  5FPW A;  3BPF A;  2FQ9 A;  2CIO A;  1PIP A;  4PP1 A;  2DCA A;  4QH6 A;  2DZZ A;  4N79 A;  2WBF X;  2B1N A;  1ZCM A;  1F2A A;  3PW3 A;  5K16 A;  1TLO A;  3WXE A;  4YYQ A;  2YJ2 A;  4BPV A;  1QMY A;  2B1M A;  3D6S A;  2AIM A;  2HH5 A;  3PNR A;  1U5I A;  2G8J A;  2F7D A;  1MEM A;  4CDE B;  1DF0 A;  1STF E;  4FIP A;  2CB5 A;  3P5X A;  2H7J A;  3O1G A;  3B79 A;  2DC6 A;  1PPO A;  1U9W A;  4QRV A;  2E02 A;  4DMY A;  1THE A;  4YV8 A;  1MDW A;  1BQI A;  1X9Y A;  1PBH A;  1MS6 A;  4MSX A;  1A6R A;  4X6I A;  1CSB B;  2PRE A;  1NLJ A;  4P6E A;  1PPD A;  2E01 A;  3WXF A;  4Q8G A;  8PCH A;  1HUC B;  3KKU A;  4CZW A;  3IV2 A;  1F2B A;  1MIR A;  4I05 A;  1PXV A;  2JQG R;  1ICF A;  2AUZ A;  2ACT A;  1NL6 A;  3DF0 A;  3BOW A;  5JH3 A;  1GLO A;  3LXS A;  3IEJ A;  3P5W A;  2DC8 A;  3PDF A;  3N3K A;  5EGW A;  1NQC A;  1S4V A;  1O0E A;  2NQI A;  2PNS A;  3USV A;  5CHT A;  1GMY A;  2O6X A;  3WXG A;  2R9F A;  1AU4 A;  1YT7 A;  1DEU A;  3P5U A;  1CPJ A;  2VHF A;  1Y4H A;  5F02 A;  3QT4 A;  1NB3 A;  1KFU L;  1PE6 A;  4OEL A;  4XUI A;  1CVZ A;  1Q6K A;  3AI8 A;  1U9V A;  2R9O A;  3LFY A;  1AYW A;  2XU3 A;  3MHH A;  2C0Y A;  5CVN B;  3KWZ A;  3BWK A;  2AUX A;  1PPN A;  3KFQ A; 
#chains in the Genus database with same CATH topology
 3CH2 X;  2Y6E A;  2GFO A;  2AYO A;  3CBJ A;  3N3G A;  4FJC A;  1EWO A;  6PAD A;  3MTN A;  2P0R A;  4M0W A;  2AU1 A;  3NHE A;  4BOU A;  7PCK A;  1ME4 A;  5JZE A;  4YYW A;  2J7Q A;  3OIS A;  4Q8H A;  1EF7 A;  2R6N A;  4QRG A;  1VSN A;  4W4U A;  4D8I A;  5A24 A;  2HWK A;  3TMP A;  3OF8 A;  4OVZ A;  5CHV A;  4CDF B;  2NQD B;  2YJC A;  5JA7 A;  3IHP A;  3OF9 A;  2DJG B;  4W5C A;  4RNA A;  4FK5 A;  1CV8 A;  4RF0 A;  5PAD A;  1TU6 A;  4D8E A;  2XU4 A;  2FYE A;  1ME3 A;  2G6D A;  1KFX L;  2R9N A;  3IUT A;  4HWY A;  3V6E A;  4BS6 A;  4W5B A;  2BTW B;  4HXD B;  3K24 A;  2XU1 A;  2AGA A;  4YVA A;  2HXZ A;  2ARY A;  3W30 A;  1KXR A;  3H8C A;  1ZIV A;  3QJ3 A;  2BU3 A;  3N4C A;  4D8B A;  1QDQ A;  2FE8 A;  1ITO A;  1FH0 A;  3OQC A;  4MM3 B;  1EWL A;  1XKG A;  1AEC A;  2NQA A;  3QSD A;  4QBB A;  1EWP A;  1M6D A;  4WA6 A;  4PAD A;  5KO3 A;  2Z84 A;  1AU0 A;  4MZO A;  3RVW A;  3H89 A;  3HD3 A;  1PCI A;  1AIM A;  4RF1 A;  2JRI A;  2J7Q C;  2BDL A;  2FRA A;  4PT5 A;  1AYV A;  2OUL A;  2VHS A;  3K8U A;  1TL9 A;  3I06 A;  2IPP B;  4DMX A;  1DKI A;  2FO5 A;  1SP4 B;  2HD5 A;  1PAD A;  2DCB A;  4ZUX U;  3H6S A;  2YJ8 A;  1GCB A;  3E9S A;  1KHQ A;  3HHA A;  2YJ9 A;  4IP3 A;  3TNX A;  1K3B B;  1MHW A;  3OVZ A;  2FTD A;  2G8E A;  2AS8 A;  5EZS A;  1BP4 A;  4RY2 A;  1U9Q X;  2R9C A;  4KLB A;  4CDD B;  2OZ2 A;  3KSE A;  9PAP A;  1QXP A;  3PHU A;  3IMA A;  2DZY A;  2Y5B A;  3KX1 A;  5EZQ A;  3C9E A;  1POP A;  2E00 A;  1YZB A;  3HWN A;  3ERV A;  2NQG A;  2YJB A;  2IBI A;  4ZTB A;  1KHP A;  2DOS A;  3V6C A;  2AYN A;  2XU5 A;  1MEG A;  1AU3 A;  1AU2 A;  4GUA A;  3RVV A;  4K7C A;  3ZUA A;  2ATO A;  1SNK A;  2FUD A;  1IWD A;  2DC9 A;  2BDZ A;  4BOP A;  1YK8 A;  2JQF R;  1AYU A;  3O65 A;  2OP3 A;  3F5V A;  1QOL A;  1CB5 A;  4YYR A;  3PBH A;  3S3Q A;  3P5V A;  1F29 A;  4XR7 A;  2DCD A;  2DC7 A;  1JQP A;  2DCC A;  3S3R A;  4YYS A;  2P86 A;  3BB7 A;  4N4Z A;  4BSQ A;  5J94 A;  2G7Y A;  3MJ5 A;  3IFU A;  3PSE A;  4AXM A;  1YVB A;  2AVW A;  3PHX A;  3GCB A;  4X6H A;  3IOQ A;  4OVZ B;  2DJF B;  4PI3 A;  1CJL A;  4N8W A;  4YYU A;  1CQD A;  3BC3 A;  1YK7 A;  4BOQ A;  2PBH A;  2FT2 A;  4BS5 A;  3MOR A;  3F75 A;  4CDC B;  3MP2 A;  4AXL A;  4QRX A;  3BCN A;  1ATK A;  4I07 A;  1UKF A;  4P6G A;  2FRQ A;  5E6J A;  4MZS A;  4YYV A;  3K9M A;  3O0U A;  4X6J A;  3BBA A;  1VJV A;  3CBK A;  1NPZ A;  1GEC E;  1U9X A;  2P7U A;  4I04 A;  4PP2 E;  3RVX A;  3M99 A;  3H7D A;  1EWM A;  5CVO B;  1BGO A;  3CH3 X;  5CVM A;  4WUR A;  1F2C A;  1CS8 A;  1Y08 A;  3I3T A;  2UZJ A;  3U8E A;  2F1G A;  2R9M A;  2GHU A;  1CTE A;  5EF4 A;  1PPP A;  3E1Z B;  1BY8 A;  3HHI A;  3KWB X;  4G54 A;  4A5U A;  4BQV A;  3KW9 A;  3BPM A;  4XZX A;  1NB5 A;  4OEM A;  2E03 A;  3OVX A;  2PAD A;  3H8B A;  3B21 A;  1YAL A;  3MHS A;  2HHN A;  5FPW A;  3BPF A;  2FQ9 A;  2CIO A;  1PIP A;  4PP1 A;  2DCA A;  4QH6 A;  2DZZ A;  4N79 A;  2WBF X;  2B1N A;  2BTW A;  3MTV A;  4REZ A;  1ZCM A;  1F2A A;  3PW3 A;  5K16 A;  1TLO A;  3WXE A;  4YYQ A;  2YJ2 A;  3PHW A;  4BPV A;  1QMY A;  2B1M A;  3D6S A;  2AIM A;  2HH5 A;  3PNR A;  1U5I A;  2G8J A;  2F7D A;  1MEM A;  3W31 A;  4CDE B;  1DF0 A;  1STF E;  4FIP A;  2CB5 A;  3P5X A;  2H7J A;  3O1G A;  3B79 A;  3BY4 A;  2JTC A;  2DC6 A;  1PPO A;  1U9W A;  4QRV A;  2E02 A;  4DMY A;  1THE A;  4YV8 A;  1MDW A;  1BQI A;  1PVJ A;  1X9Y A;  1PBH A;  1MS6 A;  4MSX A;  1A6R A;  4X6I A;  1CSB B;  3PRP A;  2PRE A;  1NLJ A;  4P6E A;  1PPD A;  2E01 A;  3WXF A;  4Q8G A;  8PCH A;  1HUC B;  3KKU A;  4CZW A;  3IV2 A;  1F2B A;  3PRM A;  1MIR A;  4I05 A;  1PXV A;  2JQG R;  4OW0 A;  1ICF A;  3PT2 A;  2AUZ A;  2ACT A;  1NL6 A;  3DF0 A;  4BOS A;  3BOW A;  4P16 A;  5JH3 A;  1GLO A;  4RKX A;  3LXS A;  3IEJ A;  3P5W A;  2DC8 A;  3PDF A;  3N3K A;  5EGW A;  1NQC A;  1S4V A;  3ZNH A;  1O0E A;  2NQI A;  2PNS A;  3RNV A;  3USV A;  5CHT A;  1GMY A;  2O6X A;  3WXG A;  4MI7 A;  2R9F A;  1AU4 A;  1YT7 A;  1DEU A;  3P5U A;  1CPJ A;  2VHF A;  4BOZ A;  1Y4H A;  5F02 A;  3QT4 A;  1NB3 A;  1KFU L;  1PE6 A;  4OEL A;  4XUI A;  1CVZ A;  1Q6K A;  3AI8 A;  1U9V A;  2R9O A;  3C0R A;  3LFY A;  4R3D A;  1AYW A;  4IUM A;  2XU3 A;  3TRK A;  3MHH A;  2C0Y A;  5CVN B;  3KWZ A;  3BWK A;  2AUX A;  1PPN A;  3KFQ A; 
#chains in the Genus database with same CATH homology
 3CH2 X;  2Y6E A;  2GFO A;  2AYO A;  3CBJ A;  3N3G A;  4FJC A;  1EWO A;  2VFB A;  6PAD A;  3MTN A;  2P0R A;  2AU1 A;  3NHE A;  7PCK A;  1ME4 A;  4YYW A;  3OIS A;  4Q8H A;  1EF7 A;  2R6N A;  4QRG A;  1VSN A;  4W4U A;  5A24 A;  3OF8 A;  5CHV A;  4CDF B;  2NQD B;  2YJC A;  5JA7 A;  1E2T A;  3IHP A;  3OF9 A;  2DJG B;  4W5C A;  4FK5 A;  1CV8 A;  5PAD A;  1TU6 A;  2XU4 A;  2FYE A;  1ME3 A;  2G6D A;  3LTW A;  1KFX L;  2R9N A;  3IUT A;  4HWY A;  3V6E A;  4BS6 A;  4W5B A;  1W5R A;  3K24 A;  2XU1 A;  4YVA A;  2HXZ A;  2ARY A;  1KXR A;  3H8C A;  1ZIV A;  3QJ3 A;  3N4C A;  1QDQ A;  1ITO A;  1FH0 A;  1EWL A;  1XKG A;  1AEC A;  2NQA A;  3QSD A;  4QBB A;  1EWP A;  1M6D A;  4WA6 A;  4PAD A;  1AU0 A;  4MZO A;  3RVW A;  3H89 A;  3HD3 A;  1PCI A;  1AIM A;  4C5P A;  2BDL A;  2FRA A;  2VFC A;  1AYV A;  2OUL A;  2VHS A;  3K8U A;  1TL9 A;  3I06 A;  2IPP B;  4DMX A;  2FO5 A;  1SP4 B;  2HD5 A;  1PAD A;  2DCB A;  4ZUX U;  3H6S A;  2YJ8 A;  1GCB A;  1KHQ A;  3HHA A;  2YJ9 A;  3TNX A;  1K3B B;  1MHW A;  3OVZ A;  2FTD A;  2G8E A;  2AS8 A;  2BSZ A;  1BP4 A;  4RY2 A;  1U9Q X;  2R9C A;  4KLB A;  4CDD B;  2OZ2 A;  3KSE A;  9PAP A;  1QXP A;  3IMA A;  2DZY A;  2Y5B A;  3KX1 A;  3C9E A;  1POP A;  2E00 A;  3HWN A;  3ERV A;  2NQG A;  2YJB A;  2IBI A;  1KHP A;  3V6C A;  2AYN A;  2XU5 A;  1MEG A;  1AU3 A;  1AU2 A;  3RVV A;  4K7C A;  3ZUA A;  2ATO A;  4BGF A;  1GX3 A;  1SNK A;  2FUD A;  1IWD A;  2DC9 A;  2BDZ A;  1YK8 A;  2JQF R;  1AYU A;  2OP3 A;  3F5V A;  1QOL A;  1CB5 A;  4YYR A;  3PBH A;  3S3Q A;  3P5V A;  1F29 A;  4XR7 A;  2DCD A;  2DC7 A;  1JQP A;  2DCC A;  3S3R A;  4YYS A;  2P86 A;  4N4Z A;  4BSQ A;  5J94 A;  2G7Y A;  4AXM A;  1YVB A;  2AVW A;  3GCB A;  4X6H A;  3IOQ A;  2DJF B;  4PI3 A;  1CJL A;  4N8W A;  4YYU A;  1CQD A;  3BC3 A;  1YK7 A;  2PBH A;  4NV7 A;  2FT2 A;  4BS5 A;  3MOR A;  3F75 A;  4CDC B;  4AXL A;  4QRX A;  3BCN A;  1ATK A;  4I07 A;  4P6G A;  2FRQ A;  4MZS A;  4YYV A;  3K9M A;  3O0U A;  4X6J A;  1VJV A;  3CBK A;  1NPZ A;  1GEC E;  1U9X A;  2P7U A;  4I04 A;  4PP2 E;  3RVX A;  3M99 A;  3H7D A;  1EWM A;  5CVO B;  1BGO A;  3CH3 X;  5CVM A;  1F2C A;  1CS8 A;  1Y08 A;  3I3T A;  3U8E A;  2F1G A;  2R9M A;  2GHU A;  1CTE A;  5EF4 A;  1PPP A;  3E1Z B;  1BY8 A;  3HHI A;  3KWB X;  4G54 A;  4BQV A;  3KW9 A;  3BPM A;  1NB5 A;  4OEM A;  2E03 A;  3OVX A;  2PAD A;  3H8B A;  1W4T A;  1YAL A;  3MHS A;  2HHN A;  5FPW A;  3BPF A;  2FQ9 A;  2CIO A;  1PIP A;  4PP1 A;  2DCA A;  4QH6 A;  2DZZ A;  4N79 A;  2WBF X;  2B1N A;  1ZCM A;  1F2A A;  3PW3 A;  5K16 A;  1TLO A;  3WXE A;  4YYQ A;  2YJ2 A;  4BPV A;  1QMY A;  2B1M A;  3D6S A;  2AIM A;  2HH5 A;  3PNR A;  1U5I A;  2G8J A;  2F7D A;  1MEM A;  4CDE B;  1DF0 A;  1STF E;  4FIP A;  2CB5 A;  3P5X A;  2H7J A;  3O1G A;  3B79 A;  2DC6 A;  1PPO A;  1U9W A;  4QRV A;  4B55 A;  2E02 A;  4DMY A;  1THE A;  4YV8 A;  1MDW A;  1BQI A;  1X9Y A;  1PBH A;  1MS6 A;  4MSX A;  1A6R A;  4X6I A;  1CSB B;  2PRE A;  1NLJ A;  4P6E A;  1PPD A;  2E01 A;  3D9W A;  3WXF A;  4Q8G A;  8PCH A;  1HUC B;  3KKU A;  4CZW A;  3IV2 A;  1F2B A;  1W6F A;  1MIR A;  4I05 A;  1PXV A;  2JQG R;  1ICF A;  2AUZ A;  2ACT A;  1NL6 A;  3DF0 A;  3BOW A;  5JH3 A;  1GLO A;  3LXS A;  3IEJ A;  3P5W A;  2DC8 A;  3PDF A;  3N3K A;  5EGW A;  1NQC A;  1S4V A;  1O0E A;  2NQI A;  2PNS A;  3USV A;  5CHT A;  1GMY A;  2O6X A;  3WXG A;  2R9F A;  1AU4 A;  1YT7 A;  1DEU A;  3P5U A;  1CPJ A;  2VHF A;  1Y4H A;  5F02 A;  3QT4 A;  1NB3 A;  1KFU L;  1PE6 A;  4OEL A;  4XUI A;  1CVZ A;  1Q6K A;  3AI8 A;  1U9V A;  4NV8 A;  2R9O A;  3LFY A;  4GUZ A;  1AYW A;  2XU3 A;  3MHH A;  2C0Y A;  5CVN B;  3KWZ A;  3BWK A;  2AUX A;  1PPN A;  3KFQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...