5FPWA

Procathepsin b s9 from trypanosoma congolense
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
306
structure length
292
Chain Sequence
APVLTKTFVDRINQLNGGMWKAVYNGKMQNITFAEAKRLTGAWIQKTSSLPPVRFTEEQLRTELPESFDSAEKWPNCPTIREIADQSACRASWAVSTASVISDRYCTVGGVQQLRISAAHLLSCCKQCGGGCKGGFPGFAWRYYVEYGIASSYCQPYPFPHCENFDTPKCQATCTDKSIPLVKYRGSATYLLLHGEEDYKRELYFNGPFVAVFYVYTDLFAYKSGVYRHVDGDFLGGTAVKVVGWGKLNGTPYWKVANTWDTDWGMDGYLLILRGNNECNIEHLGFAGTPET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2.1 Angstrom Crystal Structure of Pro Cathepsin B S9 from Trypanosoma Congolense
rcsb
source organism Trypanosoma congolense
molecule tags Hydrolase
molecule keywords PRO CATHEPSIN B S9
total genus 92
structure length 292
sequence length 306
chains with identical sequence B, C
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2015-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 5fpwA00
4QRGA 3N3KA 1SP4B 4Q8HA 4AXMA 2IBIA 1ATKA 3PDFA 2YJ2A 2YJ8A 4I07A 3TNXA 4FIPA 4K7CA 3V6CA 1QDQA 5F02A 3H6SA 4QRXA 2E01A 1VJVA 4QRVA 1S4VA 1GMYA 1PPOA 1FH0A 2AUXA 3BCNA 4ZUXU 4BPVA 3P5WA 5JA7A 3USVA 1AU4A 4YV8A 1NPZA 2XU5A 4G54A 2VHFA 1AU0A 2DCAA 1ZCMA 4QH6A 2YJ9A 1KFXL 4PI3A 3H8BA 1JQPA 3CBKA 1MIRA 1AU2A 4Q8GA 1AU3A 1ZIVA 3O0UA 4PP1A 2G6DA 2ATOA 3KWBX 3BOWA 1DF0A 3WXGA 1M6DA 2PBHA 4MZSA 1EWLA 1K3BB 4CDCB 3HHIA 2OZ2A 1ICFA 2FYEA 3OISA 5FPWA 5CHVA 3WXFA 2PNSA 3IV2A 1MEMA 3ZUAA 3CBJA 2AVWA 2PREA 3IHPA 1U5IA 2DZYA 1TU6A 4BQVA 3LFYA 3S3QA 1EWMA 2ACTA 3H8CA 4N8WA 4QBBA 2AYNA 2F7DA 4BSQA 2E02A 2OULA 5CHTA 1KHPA 2DC8A 3MORA 3BC3A 3WXEA 2DCCA 6PADA 1QOLA 2Y5BA 4MZOA 3KFQA 5CVMA 2JQGR 1PXVA 4W4UA 1PIPA 2CIOA 1AYUA 4I05A 1Y08A 4YVAA 2HXZA 2C0YA 4BS6A 1U9XA 1MHWA 4OEMA 4P6GA 1TL9A 1Q6KA 3I06A 1AIMA 3P5XA 5EF4A 1SNKA 3M99A 1YALA 1PCIA 2R9OA 1NLJA 1AYWA 5EGWA 4CDEB 4XUIA 1U9QX 5JH3A 2JQFR 4W5BA 5J94A 3CH2X 3RVWA 2E00A 2DJFB 2VHSA 1BP4A 2YJCA 2GHUA 2F1GA 4N4ZA 1CSBB 1AYVA 1MEGA 1U9VA 3KKUA 2R6NA 3PW3A 2NQAA 3P5UA 1PE6A 3KX1A 2DZZA 3V6EA 2FQ9A 1CV8A 2AS8A 1GLOA 3IEJA 3K24A 1U9WA 3OVZA 3KWZA 2DC9A 2FO5A 1QXPA 3I3TA 2G8EA 3IOQA 3BWKA 3OF9A 1ME4A 1PBHA 2R9NA 3MHHA 2R9CA 1NL6A 1CTEA 3MTNA 3QT4A 9PAPA 4MSXA 1VSNA 2NQGA 1F2CA 1CS8A 4KLBA 4RY2A 4X6HA 2AIMA 3F75A 1AECA 1EWOA 2OP3A 3RVXA 3IUTA 3PBHA 4N79A 3RVVA 3H89A 1YK8A 4PADA 3B79A 2R9FA 2PADA 1EF7A 3BPFA 3S3RA 1DEUA 2FRQA 4DMYA 2DC6A 1YVBA 1O0EA 2XU4A 1CQDA 1MS6A 3K8UA 1TLOA 4BS5A 3H7DA 1NB5A 1GECE 4FK5A 2E03A 1QMYA 2NQDB 3LXSA 4X6JA 2G8JA 2O6XA 4PP2E 2HHNA 2DC7A 3D6SA 3OVXA 1NQCA 3IMAA 2AUZA 3HWNA 4YYRA 5CVOB 2XU3A 1CJLA 1KFUL 1THEA 4XR7A 3KW9A 3DF0A 2DCBA 1X9YA 3N3GA 2GFOA 2FTDA 3KSEA 3MHSA 1HUCB 2B1MA 4YYUA 1MDWA 4DMXA 2YJBA 4I04A 3CH3X 5CVNB 2HD5A 5A24A 1PPDA 2BDLA 1F29A 1Y4HA 3OF8A 4W5CA 2DCDA 1CPJA 1PADA 2FUDA 2FRAA 2DJGB 1STFE 1IWDA 1PPNA 4X6IA 2WBFX 3GCBA 1CB5A 3C9EA 2G7YA 2XU1A 4AXLA 3NHEA 1XKGA 3K9MA 3P5VA 1YK7A 3BPMA 1YT7A 4FJCA 4CDFB 3N4CA 1KXRA 4WA6A 2ARYA 2CB5A 1A6RA 4CZWA 4P6EA 4YYSA 2IPPB 2Y6EA 3U8EA 1EWPA 3HD3A 3E1ZB 1NB3A 3F5VA 3AI8A 2AYOA 2AU1A 2P0RA 1BY8A 4YYWA 2FT2A 4YYQA 1KHQA 1ME3A 2HH5A 3ERVA 1ITOA 2H7JA 1BQIA 2P7UA 3PNRA 1F2BA 3QSDA 5K16A 5PADA 1F2AA 2R9MA 3HHAA 4HWYA 2P86A 1BGOA 4YYVA 4CDDB 4OELA 2BDZA 3O1GA 2B1NA 2NQIA 1GCBA 1PPPA 1CVZA 3QJ3A 8PCHA 1POPA 7PCKA
chains in the Genus database with same CATH superfamily
4QRGA 3N3KA 1SP4B 4BOPA 4D8EA 4Q8HA 4AXMA 2IBIA 1ATKA 3PDFA 2YJ2A 2YJ8A 3PHUA 4I07A 3TNXA 4OVZA 4FIPA 4K7CA 3PRMA 1QDQA 3V6CA 5F02A 3H6SA 4QRXA 2E01A 1VJVA 4QRVA 1S4VA 1GMYA 1PPOA 1FH0A 2AUXA 3BCNA 4ZUXU 4BPVA 3P5WA 5JA7A 3USVA 4D8BA 1AU4A 4YV8A 1NPZA 2BU3A 2XU5A 4REZA 4G54A 2VHFA 2JTCA 1AU0A 3MTVA 2DCAA 1ZCMA 4QH6A 2YJ9A 1KFXL 4PI3A 3H8BA 1JQPA 3CBKA 1MIRA 1AU2A 3PSEA 4Q8GA 4XZXA 1AU3A 1ZIVA 1DKIA 3O0UA 4PP1A 2G6DA 3TRKA 2ATOA 3KWBX 3BOWA 1DF0A 3WXGA 1M6DA 2PBHA 4MZSA 1EWLA 1K3BB 4CDCB 3HHIA 3OQCA 2OZ2A 1ICFA 2FYEA 3OISA 3PRPA 5FPWA 4WURA 5CHVA 4OVZB 3WXFA 2PNSA 3IV2A 1MEMA 4BOZA 3ZUAA 3CBJA 2AVWA 2PREA 3IHPA 1U5IA 2DZYA 1TU6A 4BQVA 3LFYA 3S3QA 1EWMA 2ACTA 3H8CA 4N8WA 4QBBA 3TMPA 2AYNA 2F7DA 4BSQA 2E02A 2OULA 4HXDB 5CHTA 1KHPA 2DC8A 2HWKA 3MORA 3BC3A 3ZNHA 4IUMA 3WXEA 2DCCA 4A5UA 6PADA 1QOLA 2Y5BA 4MZOA 3KFQA 5CVMA 2JQGR 1PXVA 1YZBA 4W4UA 1PIPA 2CIOA 1AYUA 4I05A 1Y08A 3E9SA 4YVAA 2HXZA 2C0YA 4BS6A 1U9XA 1MHWA 4OEMA 4P6GA 1TL9A 1Q6KA 3I06A 4P16A 2BTWA 1AIMA 3P5XA 5EF4A 1SNKA 3M99A 3MJ5A 1YALA 1PCIA 2R9OA 1NLJA 1AYWA 5EGWA 4CDEB 4XUIA 1U9QX 4M0WA 5JH3A 2JQFR 4W5BA 1PVJA 5J94A 4RF1A 2Z84A 3CH2X 3RVWA 2E00A 2DJFB 2VHSA 1BP4A 2YJCA 2GHUA 2F1GA 3B21A 4N4ZA 1CSBB 1AYVA 1MEGA 1U9VA 3KKUA 2R6NA 3PW3A 4BOQA 2NQAA 3P5UA 1PE6A 3KX1A 2DZZA 3V6EA 4MI7A 2FQ9A 1CV8A 2AS8A 1GLOA 3IEJA 3K24A 1U9WA 3OVZA 3KWZA 2DC9A 4ZTBA 2FO5A 1QXPA 3I3TA 2G8EA 3IOQA 3BWKA 3OF9A 3BBAA 1ME4A 1PBHA 2R9NA 3MHHA 2J7QA 2R9CA 1NL6A 1CTEA 3MTNA 3QT4A 4D8IA 9PAPA 4MSXA 1VSNA 2NQGA 1F2CA 1CS8A 4KLBA 4BOSA 4RY2A 4R3DA 3PT2A 4X6HA 2AIMA 3F75A 1AECA 1EWOA 2OP3A 3RVXA 3IUTA 3PBHA 4N79A 3RVVA 3H89A 1YK8A 4PADA 5EZQA 3B79A 2R9FA 2PADA 1EF7A 3BPFA 3S3RA 1DEUA 2FRQA 4DMYA 2DC6A 1YVBA 1O0EA 2XU4A 1CQDA 1MS6A 3BY4A 3K8UA 1TLOA 4BS5A 3H7DA 1NB5A 1GECE 4FK5A 3PHWA 4RF0A 2E03A 1QMYA 2NQDB 3LXSA 4X6JA 2G8JA 2O6XA 4PP2E 2HHNA 2DC7A 3D6SA 3OVXA 1NQCA 3IMAA 2AUZA 3HWNA 2JRIA 4YYRA 5CVOB 2XU3A 1CJLA 1KFUL 1THEA 5EZSA 4XR7A 3KW9A 3DF0A 2DCBA 1X9YA 3N3GA 2GFOA 2UZJA 2FTDA 3KSEA 3MHSA 1HUCB 2B1MA 4YYUA 1MDWA 4DMXA 2YJBA 4I04A 3CH3X 5CVNB 2HD5A 5A24A 1PPDA 2BDLA 3W30A 1F29A 1Y4HA 3O65A 3OF8A 2DCDA 4W5CA 3RNVA 3W31A 1CPJA 1PADA 3PHXA 4PT5A 3BB7A 2FUDA 2FRAA 2DJGB 1STFE 1IWDA 1PPNA 4X6IA 2WBFX 3C0RA 4GUAA 3GCBA 1CB5A 3IFUA 3C9EA 2G7YA 2XU1A 2AGAA 3MP2A 4AXLA 3NHEA 1XKGA 3K9MA 3P5VA 1YK7A 3BPMA 4RNAA 1YT7A 4FJCA 4CDFB 4IP3A 3N4CA 1KXRA 4WA6A 2ARYA 2CB5A 1A6RA 4CZWA 4P6EA 5KO3A 4YYSA 2IPPB 2Y6EA 3U8EA 1UKFA 1EWPA 3HD3A 4MM3B 2BTWB 3E1ZB 5JZEA 1NB3A 3F5VA 3AI8A 2AYOA 2AU1A 2P0RA 5E6JA 1BY8A 4YYWA 4OW0A 2FT2A 4YYQA 1KHQA 1ME3A 2HH5A 3ERVA 1ITOA 2H7JA 1BQIA 4BOUA 2FE8A 2P7UA 3PNRA 1F2BA 3QSDA 5K16A 5PADA 1F2AA 2R9MA 3HHAA 2J7QC 4HWYA 2P86A 1BGOA 4RKXA 4YYVA 4CDDB 4OELA 2BDZA 3O1GA 2B1NA 2NQIA 1GCBA 1PPPA 1CVZA 3QJ3A 8PCHA 2DOSA 1POPA 7PCKA
chains in the Genus database with same CATH topology
4QRGA 4BGFA 3N3KA 1SP4B 4Q8HA 4AXMA 2IBIA 1ATKA 3PDFA 2YJ2A 2YJ8A 4I07A 3TNXA 4FIPA 4K7CA 1QDQA 3V6CA 5F02A 3H6SA 4QRXA 2E01A 1VJVA 4QRVA 1S4VA 1GMYA 1PPOA 1FH0A 2AUXA 3BCNA 4ZUXU 4BPVA 3P5WA 5JA7A 3USVA 1AU4A 4YV8A 1NPZA 2XU5A 4G54A 2VHFA 1W5RA 1AU0A 2DCAA 1ZCMA 4QH6A 2YJ9A 1KFXL 4PI3A 3H8BA 1JQPA 3CBKA 1MIRA 1AU2A 4Q8GA 1AU3A 1ZIVA 3O0UA 4PP1A 2G6DA 2ATOA 3KWBX 3BOWA 1DF0A 3WXGA 1M6DA 2PBHA 4MZSA 1EWLA 1K3BB 4CDCB 3HHIA 2OZ2A 1ICFA 1W6FA 1GX3A 2FYEA 3OISA 5FPWA 5CHVA 3WXFA 2PNSA 3IV2A 1MEMA 3ZUAA 3CBJA 2AVWA 2PREA 3IHPA 1U5IA 2DZYA 3LTWA 1TU6A 4BQVA 3LFYA 3S3QA 1EWMA 2ACTA 3H8CA 4N8WA 4QBBA 2AYNA 2F7DA 4BSQA 2E02A 2OULA 5CHTA 1KHPA 2DC8A 3MORA 3BC3A 3WXEA 2DCCA 6PADA 1QOLA 2Y5BA 4MZOA 3KFQA 5CVMA 2JQGR 1PXVA 2VFBA 4W4UA 1PIPA 2CIOA 1E2TA 1AYUA 4I05A 1Y08A 4YVAA 2HXZA 2C0YA 4BS6A 1U9XA 1MHWA 4OEMA 4P6GA 1TL9A 1Q6KA 3I06A 1AIMA 3P5XA 5EF4A 1SNKA 3M99A 1YALA 1PCIA 2R9OA 1NLJA 4NV7A 1AYWA 5EGWA 4CDEB 4XUIA 4GUZA 1U9QX 5JH3A 2JQFR 4W5BA 5J94A 3CH2X 3RVWA 2E00A 2DJFB 2VHSA 1BP4A 2YJCA 2GHUA 2F1GA 4N4ZA 1CSBB 1AYVA 1MEGA 1U9VA 3KKUA 2R6NA 3PW3A 2NQAA 3P5UA 1PE6A 3KX1A 2DZZA 3V6EA 2FQ9A 1CV8A 2AS8A 1GLOA 3IEJA 3K24A 1U9WA 3OVZA 3KWZA 2DC9A 2FO5A 1QXPA 3I3TA 2G8EA 3IOQA 3BWKA 3OF9A 1ME4A 1PBHA 2R9NA 3MHHA 2R9CA 1NL6A 1CTEA 3MTNA 3QT4A 9PAPA 4MSXA 1VSNA 2NQGA 1F2CA 1CS8A 1W4TA 4KLBA 4RY2A 4X6HA 2AIMA 3F75A 1AECA 1EWOA 2OP3A 3RVXA 3IUTA 3PBHA 4N79A 3RVVA 3H89A 1YK8A 4PADA 3B79A 2R9FA 2PADA 1EF7A 3BPFA 3S3RA 1DEUA 2FRQA 4DMYA 2DC6A 1YVBA 1O0EA 2XU4A 1CQDA 1MS6A 3K8UA 1TLOA 4BS5A 4B55A 3H7DA 1NB5A 1GECE 4FK5A 2VFCA 2E03A 1QMYA 2NQDB 3LXSA 4X6JA 2G8JA 2O6XA 4PP2E 2HHNA 2DC7A 3D6SA 3OVXA 1NQCA 3IMAA 2AUZA 3HWNA 4YYRA 5CVOB 2XU3A 1CJLA 1KFUL 1THEA 4XR7A 3KW9A 3DF0A 2DCBA 1X9YA 3N3GA 2GFOA 2FTDA 3KSEA 3MHSA 1HUCB 2B1MA 4YYUA 1MDWA 4DMXA 2YJBA 4I04A 3CH3X 5CVNB 2HD5A 5A24A 1PPDA 2BDLA 1F29A 1Y4HA 2BSZA 3OF8A 4W5CA 2DCDA 4C5PA 1CPJA 1PADA 2FUDA 2FRAA 2DJGB 1STFE 1IWDA 1PPNA 4X6IA 2WBFX 3GCBA 1CB5A 3C9EA 2G7YA 2XU1A 4NV8A 4AXLA 3NHEA 1XKGA 3K9MA 3P5VA 1YK7A 3BPMA 1YT7A 4FJCA 4CDFB 3N4CA 1KXRA 4WA6A 2ARYA 2CB5A 1A6RA 4CZWA 4P6EA 4YYSA 2IPPB 2Y6EA 3U8EA 1EWPA 3HD3A 3E1ZB 1NB3A 3F5VA 3AI8A 2AYOA 2AU1A 2P0RA 1BY8A 4YYWA 2FT2A 4YYQA 1KHQA 1ME3A 2HH5A 3ERVA 1ITOA 2H7JA 1BQIA 2P7UA 3PNRA 1F2BA 3QSDA 5K16A 5PADA 1F2AA 2R9MA 3HHAA 4HWYA 2P86A 1BGOA 3D9WA 4YYVA 4CDDB 4OELA 2BDZA 3O1GA 2B1NA 2NQIA 1GCBA 1PPPA 1CVZA 3QJ3A 8PCHA 1POPA 7PCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QRG A;  3N3K A;  1SP4 B;  4Q8H A;  4AXM A;  2IBI A;  1ATK A;  3PDF A;  2YJ2 A;  2YJ8 A;  4I07 A;  3TNX A;  4FIP A;  4K7C A;  3V6C A;  1QDQ A;  5F02 A;  3H6S A;  4QRX A;  2E01 A;  1VJV A;  4QRV A;  1S4V A;  1GMY A;  1PPO A;  1FH0 A;  2AUX A;  3BCN A;  4ZUX U;  4BPV A;  3P5W A;  5JA7 A;  3USV A;  1AU4 A;  4YV8 A;  1NPZ A;  2XU5 A;  4G54 A;  2VHF A;  1AU0 A;  2DCA A;  1ZCM A;  4QH6 A;  2YJ9 A;  1KFX L;  4PI3 A;  3H8B A;  1JQP A;  3CBK A;  1MIR A;  1AU2 A;  4Q8G A;  1AU3 A;  1ZIV A;  3O0U A;  4PP1 A;  2G6D A;  2ATO A;  3KWB X;  3BOW A;  1DF0 A;  3WXG A;  1M6D A;  2PBH A;  4MZS A;  1EWL A;  1K3B B;  4CDC B;  3HHI A;  2OZ2 A;  1ICF A;  2FYE A;  3OIS A;  5FPW A;  5CHV A;  3WXF A;  2PNS A;  3IV2 A;  1MEM A;  3ZUA A;  3CBJ A;  2AVW A;  2PRE A;  3IHP A;  1U5I A;  2DZY A;  1TU6 A;  4BQV A;  3LFY A;  3S3Q A;  1EWM A;  2ACT A;  3H8C A;  4N8W A;  4QBB A;  2AYN A;  2F7D A;  4BSQ A;  2E02 A;  2OUL A;  5CHT A;  1KHP A;  2DC8 A;  3MOR A;  3BC3 A;  3WXE A;  2DCC A;  6PAD A;  1QOL A;  2Y5B A;  4MZO A;  3KFQ A;  5CVM A;  2JQG R;  1PXV A;  4W4U A;  1PIP A;  2CIO A;  1AYU A;  4I05 A;  1Y08 A;  4YVA A;  2HXZ A;  2C0Y A;  4BS6 A;  1U9X A;  1MHW A;  4OEM A;  4P6G A;  1TL9 A;  1Q6K A;  3I06 A;  1AIM A;  3P5X A;  5EF4 A;  1SNK A;  3M99 A;  1YAL A;  1PCI A;  2R9O A;  1NLJ A;  1AYW A;  5EGW A;  4CDE B;  4XUI A;  1U9Q X;  5JH3 A;  2JQF R;  4W5B A;  5J94 A;  3CH2 X;  3RVW A;  2E00 A;  2DJF B;  2VHS A;  1BP4 A;  2YJC A;  2GHU A;  2F1G A;  4N4Z A;  1CSB B;  1AYV A;  1MEG A;  1U9V A;  3KKU A;  2R6N A;  3PW3 A;  2NQA A;  3P5U A;  1PE6 A;  3KX1 A;  2DZZ A;  3V6E A;  2FQ9 A;  1CV8 A;  2AS8 A;  1GLO A;  3IEJ A;  3K24 A;  1U9W A;  3OVZ A;  3KWZ A;  2DC9 A;  2FO5 A;  1QXP A;  3I3T A;  2G8E A;  3IOQ A;  3BWK A;  3OF9 A;  1ME4 A;  1PBH A;  2R9N A;  3MHH A;  2R9C A;  1NL6 A;  1CTE A;  3MTN A;  3QT4 A;  9PAP A;  4MSX A;  1VSN A;  2NQG A;  1F2C A;  1CS8 A;  4KLB A;  4RY2 A;  4X6H A;  2AIM A;  3F75 A;  1AEC A;  1EWO A;  2OP3 A;  3RVX A;  3IUT A;  3PBH A;  4N79 A;  3RVV A;  3H89 A;  1YK8 A;  4PAD A;  3B79 A;  2R9F A;  2PAD A;  1EF7 A;  3BPF A;  3S3R A;  1DEU A;  2FRQ A;  4DMY A;  2DC6 A;  1YVB A;  1O0E A;  2XU4 A;  1CQD A;  1MS6 A;  3K8U A;  1TLO A;  4BS5 A;  3H7D A;  1NB5 A;  1GEC E;  4FK5 A;  2E03 A;  1QMY A;  2NQD B;  3LXS A;  4X6J A;  2G8J A;  2O6X A;  4PP2 E;  2HHN A;  2DC7 A;  3D6S A;  3OVX A;  1NQC A;  3IMA A;  2AUZ A;  3HWN A;  4YYR A;  5CVO B;  2XU3 A;  1CJL A;  1KFU L;  1THE A;  4XR7 A;  3KW9 A;  3DF0 A;  2DCB A;  1X9Y A;  3N3G A;  2GFO A;  2FTD A;  3KSE A;  3MHS A;  1HUC B;  2B1M A;  4YYU A;  1MDW A;  4DMX A;  2YJB A;  4I04 A;  3CH3 X;  5CVN B;  2HD5 A;  5A24 A;  1PPD A;  2BDL A;  1F29 A;  1Y4H A;  3OF8 A;  4W5C A;  2DCD A;  1CPJ A;  1PAD A;  2FUD A;  2FRA A;  2DJG B;  1STF E;  1IWD A;  1PPN A;  4X6I A;  2WBF X;  3GCB A;  1CB5 A;  3C9E A;  2G7Y A;  2XU1 A;  4AXL A;  3NHE A;  1XKG A;  3K9M A;  3P5V A;  1YK7 A;  3BPM A;  1YT7 A;  4FJC A;  4CDF B;  3N4C A;  1KXR A;  4WA6 A;  2ARY A;  2CB5 A;  1A6R A;  4CZW A;  4P6E A;  4YYS A;  2IPP B;  2Y6E A;  3U8E A;  1EWP A;  3HD3 A;  3E1Z B;  1NB3 A;  3F5V A;  3AI8 A;  2AYO A;  2AU1 A;  2P0R A;  1BY8 A;  4YYW A;  2FT2 A;  4YYQ A;  1KHQ A;  1ME3 A;  2HH5 A;  3ERV A;  1ITO A;  2H7J A;  1BQI A;  2P7U A;  3PNR A;  1F2B A;  3QSD A;  5K16 A;  5PAD A;  1F2A A;  2R9M A;  3HHA A;  4HWY A;  2P86 A;  1BGO A;  4YYV A;  4CDD B;  4OEL A;  2BDZ A;  3O1G A;  2B1N A;  2NQI A;  1GCB A;  1PPP A;  1CVZ A;  3QJ3 A;  8PCH A;  1POP A;  7PCK A; 
#chains in the Genus database with same CATH topology
 4QRG A;  3N3K A;  1SP4 B;  4BOP A;  4D8E A;  4Q8H A;  4AXM A;  2IBI A;  1ATK A;  3PDF A;  2YJ2 A;  2YJ8 A;  3PHU A;  4I07 A;  3TNX A;  4OVZ A;  4FIP A;  4K7C A;  3PRM A;  1QDQ A;  3V6C A;  5F02 A;  3H6S A;  4QRX A;  2E01 A;  1VJV A;  4QRV A;  1S4V A;  1GMY A;  1PPO A;  1FH0 A;  2AUX A;  3BCN A;  4ZUX U;  4BPV A;  3P5W A;  5JA7 A;  3USV A;  4D8B A;  1AU4 A;  4YV8 A;  1NPZ A;  2BU3 A;  2XU5 A;  4REZ A;  4G54 A;  2VHF A;  2JTC A;  1AU0 A;  3MTV A;  2DCA A;  1ZCM A;  4QH6 A;  2YJ9 A;  1KFX L;  4PI3 A;  3H8B A;  1JQP A;  3CBK A;  1MIR A;  1AU2 A;  3PSE A;  4Q8G A;  4XZX A;  1AU3 A;  1ZIV A;  1DKI A;  3O0U A;  4PP1 A;  2G6D A;  3TRK A;  2ATO A;  3KWB X;  3BOW A;  1DF0 A;  3WXG A;  1M6D A;  2PBH A;  4MZS A;  1EWL A;  1K3B B;  4CDC B;  3HHI A;  3OQC A;  2OZ2 A;  1ICF A;  2FYE A;  3OIS A;  3PRP A;  5FPW A;  4WUR A;  5CHV A;  4OVZ B;  3WXF A;  2PNS A;  3IV2 A;  1MEM A;  4BOZ A;  3ZUA A;  3CBJ A;  2AVW A;  2PRE A;  3IHP A;  1U5I A;  2DZY A;  1TU6 A;  4BQV A;  3LFY A;  3S3Q A;  1EWM A;  2ACT A;  3H8C A;  4N8W A;  4QBB A;  3TMP A;  2AYN A;  2F7D A;  4BSQ A;  2E02 A;  2OUL A;  4HXD B;  5CHT A;  1KHP A;  2DC8 A;  2HWK A;  3MOR A;  3BC3 A;  3ZNH A;  4IUM A;  3WXE A;  2DCC A;  4A5U A;  6PAD A;  1QOL A;  2Y5B A;  4MZO A;  3KFQ A;  5CVM A;  2JQG R;  1PXV A;  1YZB A;  4W4U A;  1PIP A;  2CIO A;  1AYU A;  4I05 A;  1Y08 A;  3E9S A;  4YVA A;  2HXZ A;  2C0Y A;  4BS6 A;  1U9X A;  1MHW A;  4OEM A;  4P6G A;  1TL9 A;  1Q6K A;  3I06 A;  4P16 A;  2BTW A;  1AIM A;  3P5X A;  5EF4 A;  1SNK A;  3M99 A;  3MJ5 A;  1YAL A;  1PCI A;  2R9O A;  1NLJ A;  1AYW A;  5EGW A;  4CDE B;  4XUI A;  1U9Q X;  4M0W A;  5JH3 A;  2JQF R;  4W5B A;  1PVJ A;  5J94 A;  4RF1 A;  2Z84 A;  3CH2 X;  3RVW A;  2E00 A;  2DJF B;  2VHS A;  1BP4 A;  2YJC A;  2GHU A;  2F1G A;  3B21 A;  4N4Z A;  1CSB B;  1AYV A;  1MEG A;  1U9V A;  3KKU A;  2R6N A;  3PW3 A;  4BOQ A;  2NQA A;  3P5U A;  1PE6 A;  3KX1 A;  2DZZ A;  3V6E A;  4MI7 A;  2FQ9 A;  1CV8 A;  2AS8 A;  1GLO A;  3IEJ A;  3K24 A;  1U9W A;  3OVZ A;  3KWZ A;  2DC9 A;  4ZTB A;  2FO5 A;  1QXP A;  3I3T A;  2G8E A;  3IOQ A;  3BWK A;  3OF9 A;  3BBA A;  1ME4 A;  1PBH A;  2R9N A;  3MHH A;  2J7Q A;  2R9C A;  1NL6 A;  1CTE A;  3MTN A;  3QT4 A;  4D8I A;  9PAP A;  4MSX A;  1VSN A;  2NQG A;  1F2C A;  1CS8 A;  4KLB A;  4BOS A;  4RY2 A;  4R3D A;  3PT2 A;  4X6H A;  2AIM A;  3F75 A;  1AEC A;  1EWO A;  2OP3 A;  3RVX A;  3IUT A;  3PBH A;  4N79 A;  3RVV A;  3H89 A;  1YK8 A;  4PAD A;  5EZQ A;  3B79 A;  2R9F A;  2PAD A;  1EF7 A;  3BPF A;  3S3R A;  1DEU A;  2FRQ A;  4DMY A;  2DC6 A;  1YVB A;  1O0E A;  2XU4 A;  1CQD A;  1MS6 A;  3BY4 A;  3K8U A;  1TLO A;  4BS5 A;  3H7D A;  1NB5 A;  1GEC E;  4FK5 A;  3PHW A;  4RF0 A;  2E03 A;  1QMY A;  2NQD B;  3LXS A;  4X6J A;  2G8J A;  2O6X A;  4PP2 E;  2HHN A;  2DC7 A;  3D6S A;  3OVX A;  1NQC A;  3IMA A;  2AUZ A;  3HWN A;  2JRI A;  4YYR A;  5CVO B;  2XU3 A;  1CJL A;  1KFU L;  1THE A;  5EZS A;  4XR7 A;  3KW9 A;  3DF0 A;  2DCB A;  1X9Y A;  3N3G A;  2GFO A;  2UZJ A;  2FTD A;  3KSE A;  3MHS A;  1HUC B;  2B1M A;  4YYU A;  1MDW A;  4DMX A;  2YJB A;  4I04 A;  3CH3 X;  5CVN B;  2HD5 A;  5A24 A;  1PPD A;  2BDL A;  3W30 A;  1F29 A;  1Y4H A;  3O65 A;  3OF8 A;  2DCD A;  4W5C A;  3RNV A;  3W31 A;  1CPJ A;  1PAD A;  3PHX A;  4PT5 A;  3BB7 A;  2FUD A;  2FRA A;  2DJG B;  1STF E;  1IWD A;  1PPN A;  4X6I A;  2WBF X;  3C0R A;  4GUA A;  3GCB A;  1CB5 A;  3IFU A;  3C9E A;  2G7Y A;  2XU1 A;  2AGA A;  3MP2 A;  4AXL A;  3NHE A;  1XKG A;  3K9M A;  3P5V A;  1YK7 A;  3BPM A;  4RNA A;  1YT7 A;  4FJC A;  4CDF B;  4IP3 A;  3N4C A;  1KXR A;  4WA6 A;  2ARY A;  2CB5 A;  1A6R A;  4CZW A;  4P6E A;  5KO3 A;  4YYS A;  2IPP B;  2Y6E A;  3U8E A;  1UKF A;  1EWP A;  3HD3 A;  4MM3 B;  2BTW B;  3E1Z B;  5JZE A;  1NB3 A;  3F5V A;  3AI8 A;  2AYO A;  2AU1 A;  2P0R A;  5E6J A;  1BY8 A;  4YYW A;  4OW0 A;  2FT2 A;  4YYQ A;  1KHQ A;  1ME3 A;  2HH5 A;  3ERV A;  1ITO A;  2H7J A;  1BQI A;  4BOU A;  2FE8 A;  2P7U A;  3PNR A;  1F2B A;  3QSD A;  5K16 A;  5PAD A;  1F2A A;  2R9M A;  3HHA A;  2J7Q C;  4HWY A;  2P86 A;  1BGO A;  4RKX A;  4YYV A;  4CDD B;  4OEL A;  2BDZ A;  3O1G A;  2B1N A;  2NQI A;  1GCB A;  1PPP A;  1CVZ A;  3QJ3 A;  8PCH A;  2DOS A;  1POP A;  7PCK A; 
#chains in the Genus database with same CATH homology
 4QRG A;  4BGF A;  3N3K A;  1SP4 B;  4Q8H A;  4AXM A;  2IBI A;  1ATK A;  3PDF A;  2YJ2 A;  2YJ8 A;  4I07 A;  3TNX A;  4FIP A;  4K7C A;  1QDQ A;  3V6C A;  5F02 A;  3H6S A;  4QRX A;  2E01 A;  1VJV A;  4QRV A;  1S4V A;  1GMY A;  1PPO A;  1FH0 A;  2AUX A;  3BCN A;  4ZUX U;  4BPV A;  3P5W A;  5JA7 A;  3USV A;  1AU4 A;  4YV8 A;  1NPZ A;  2XU5 A;  4G54 A;  2VHF A;  1W5R A;  1AU0 A;  2DCA A;  1ZCM A;  4QH6 A;  2YJ9 A;  1KFX L;  4PI3 A;  3H8B A;  1JQP A;  3CBK A;  1MIR A;  1AU2 A;  4Q8G A;  1AU3 A;  1ZIV A;  3O0U A;  4PP1 A;  2G6D A;  2ATO A;  3KWB X;  3BOW A;  1DF0 A;  3WXG A;  1M6D A;  2PBH A;  4MZS A;  1EWL A;  1K3B B;  4CDC B;  3HHI A;  2OZ2 A;  1ICF A;  1W6F A;  1GX3 A;  2FYE A;  3OIS A;  5FPW A;  5CHV A;  3WXF A;  2PNS A;  3IV2 A;  1MEM A;  3ZUA A;  3CBJ A;  2AVW A;  2PRE A;  3IHP A;  1U5I A;  2DZY A;  3LTW A;  1TU6 A;  4BQV A;  3LFY A;  3S3Q A;  1EWM A;  2ACT A;  3H8C A;  4N8W A;  4QBB A;  2AYN A;  2F7D A;  4BSQ A;  2E02 A;  2OUL A;  5CHT A;  1KHP A;  2DC8 A;  3MOR A;  3BC3 A;  3WXE A;  2DCC A;  6PAD A;  1QOL A;  2Y5B A;  4MZO A;  3KFQ A;  5CVM A;  2JQG R;  1PXV A;  2VFB A;  4W4U A;  1PIP A;  2CIO A;  1E2T A;  1AYU A;  4I05 A;  1Y08 A;  4YVA A;  2HXZ A;  2C0Y A;  4BS6 A;  1U9X A;  1MHW A;  4OEM A;  4P6G A;  1TL9 A;  1Q6K A;  3I06 A;  1AIM A;  3P5X A;  5EF4 A;  1SNK A;  3M99 A;  1YAL A;  1PCI A;  2R9O A;  1NLJ A;  4NV7 A;  1AYW A;  5EGW A;  4CDE B;  4XUI A;  4GUZ A;  1U9Q X;  5JH3 A;  2JQF R;  4W5B A;  5J94 A;  3CH2 X;  3RVW A;  2E00 A;  2DJF B;  2VHS A;  1BP4 A;  2YJC A;  2GHU A;  2F1G A;  4N4Z A;  1CSB B;  1AYV A;  1MEG A;  1U9V A;  3KKU A;  2R6N A;  3PW3 A;  2NQA A;  3P5U A;  1PE6 A;  3KX1 A;  2DZZ A;  3V6E A;  2FQ9 A;  1CV8 A;  2AS8 A;  1GLO A;  3IEJ A;  3K24 A;  1U9W A;  3OVZ A;  3KWZ A;  2DC9 A;  2FO5 A;  1QXP A;  3I3T A;  2G8E A;  3IOQ A;  3BWK A;  3OF9 A;  1ME4 A;  1PBH A;  2R9N A;  3MHH A;  2R9C A;  1NL6 A;  1CTE A;  3MTN A;  3QT4 A;  9PAP A;  4MSX A;  1VSN A;  2NQG A;  1F2C A;  1CS8 A;  1W4T A;  4KLB A;  4RY2 A;  4X6H A;  2AIM A;  3F75 A;  1AEC A;  1EWO A;  2OP3 A;  3RVX A;  3IUT A;  3PBH A;  4N79 A;  3RVV A;  3H89 A;  1YK8 A;  4PAD A;  3B79 A;  2R9F A;  2PAD A;  1EF7 A;  3BPF A;  3S3R A;  1DEU A;  2FRQ A;  4DMY A;  2DC6 A;  1YVB A;  1O0E A;  2XU4 A;  1CQD A;  1MS6 A;  3K8U A;  1TLO A;  4BS5 A;  4B55 A;  3H7D A;  1NB5 A;  1GEC E;  4FK5 A;  2VFC A;  2E03 A;  1QMY A;  2NQD B;  3LXS A;  4X6J A;  2G8J A;  2O6X A;  4PP2 E;  2HHN A;  2DC7 A;  3D6S A;  3OVX A;  1NQC A;  3IMA A;  2AUZ A;  3HWN A;  4YYR A;  5CVO B;  2XU3 A;  1CJL A;  1KFU L;  1THE A;  4XR7 A;  3KW9 A;  3DF0 A;  2DCB A;  1X9Y A;  3N3G A;  2GFO A;  2FTD A;  3KSE A;  3MHS A;  1HUC B;  2B1M A;  4YYU A;  1MDW A;  4DMX A;  2YJB A;  4I04 A;  3CH3 X;  5CVN B;  2HD5 A;  5A24 A;  1PPD A;  2BDL A;  1F29 A;  1Y4H A;  2BSZ A;  3OF8 A;  4W5C A;  2DCD A;  4C5P A;  1CPJ A;  1PAD A;  2FUD A;  2FRA A;  2DJG B;  1STF E;  1IWD A;  1PPN A;  4X6I A;  2WBF X;  3GCB A;  1CB5 A;  3C9E A;  2G7Y A;  2XU1 A;  4NV8 A;  4AXL A;  3NHE A;  1XKG A;  3K9M A;  3P5V A;  1YK7 A;  3BPM A;  1YT7 A;  4FJC A;  4CDF B;  3N4C A;  1KXR A;  4WA6 A;  2ARY A;  2CB5 A;  1A6R A;  4CZW A;  4P6E A;  4YYS A;  2IPP B;  2Y6E A;  3U8E A;  1EWP A;  3HD3 A;  3E1Z B;  1NB3 A;  3F5V A;  3AI8 A;  2AYO A;  2AU1 A;  2P0R A;  1BY8 A;  4YYW A;  2FT2 A;  4YYQ A;  1KHQ A;  1ME3 A;  2HH5 A;  3ERV A;  1ITO A;  2H7J A;  1BQI A;  2P7U A;  3PNR A;  1F2B A;  3QSD A;  5K16 A;  5PAD A;  1F2A A;  2R9M A;  3HHA A;  4HWY A;  2P86 A;  1BGO A;  3D9W A;  4YYV A;  4CDD B;  4OEL A;  2BDZ A;  3O1G A;  2B1N A;  2NQI A;  1GCB A;  1PPP A;  1CVZ A;  3QJ3 A;  8PCH A;  1POP A;  7PCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...