1CVZA

Crystal structure analysis of papain with clik148(cathepsin l specific inhibitor)
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
212
structure length
212
Chain Sequence
IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNQYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNQGALLYSIANQPVSVVLQAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PAPAIN
publication title Inhibition mechanism of cathepsin L-specific inhibitors based on the crystal structure of papain-CLIK148 complex.
pubmed doi rcsb
molecule tags Hydrolase
total genus 68
structure length 212
sequence length 212
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 1999-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1cvzA00
3NHEA 3N3GA 2R9NA 1VSNA 3OISA 2FYEA 1AYVA 3LFYA 1CJLA 1AECA 2DJFB 3IEJA 4FK5A 3LXSA 1PPDA 1AU4A 2DZZA 2OULA 2Y5BA 3OVXA 4XUIA 1ZCMA 2DC8A 1MEGA 2HD5A 1YALA 1BQIA 3PBHA 4X6IA 1XKGA 2G8EA 1PADA 1CSBB 3H8CA 4QBBA 5A24A 1NQCA 3U8EA 3HWNA 5EGWA 1GECE 1THEA 6PADA 1STFE 2R9CA 1ITOA 3OF8A 1PE6A 3WXEA 4FIPA 2YJ8A 2O6XA 3I06A 1IWDA 2G6DA 4PP2E 3KWBX 3P5XA 1CVZA 4OEMA 1VJVA 1CB5A 1KHQA 4N4ZA 3MHHA 2DCDA 4Q8GA 3V6EA 1S4VA 7PCKA 1MIRA 4Q8HA 3F5VA 3IOQA 1YT7A 3KW9A 2ATOA 1AU0A 3N3KA 4YV8A 1KXRA 2DCAA 1SP4B 3MHSA 2JQGR 3GCBA 3IMAA 2XU3A 5JH3A 2P7UA 1F2AA 3K9MA 2ARYA 3KSEA 3OF9A 4OELA 3RVWA 3WXFA 4DMXA 2GHUA 3P5VA 4MZOA 2FQ9A 2BDLA 1PIPA 4CZWA 4X6JA 8PCHA 2E01A 1PCIA 3D6SA 1U9XA 2IPPB 2F7DA 1U9VA 4RY2A 2DCBA 1BY8A 1EWLA 1K3BB 5J94A 1FH0A 2VHFA 3O1GA 1BP4A 1PPNA 5F02A 1Y08A 2HH5A 3K8UA 1PBHA 4I04A 1AU3A 3HHAA 3BPFA 3IV2A 4G54A 2NQGA 3PW3A 1F29A 1ZIVA 4W5BA 1JQPA 2DC9A 2PBHA 1QXPA 2IBIA 1MEMA 2AUZA 4FJCA 3BWKA 1U5IA 3AI8A 4P6GA 3IHPA 1AIMA 1O0EA 2C0YA 1MS6A 1TLOA 2AVWA 2R9FA 2YJCA 1AYUA 3C9EA 2F1GA 3H8BA 3TNXA 2FT2A 2GFOA 2H7JA 3QJ3A 2OP3A 2CB5A 2B1MA 2PNSA 4I05A 2AU1A 4MZSA 2G7YA 1CS8A 1KFUL 3ZUAA 3HHIA 4N79A 5CVNB 1SNKA 1POPA 2AIMA 4W4UA 2VHSA 5FPWA 4PI3A 1ME4A 4BSQA 2PADA 2G8JA 2AS8A 3CBKA 1PPPA 3USVA 4AXMA 5PADA 1NLJA 5K16A 2JQFR 3PNRA 3RVVA 4ZUXU 2WBFX 4YYUA 4CDFB 1EWOA 1ME3A 4BQVA 2FRQA 1PXVA 1AU2A 2HHNA 1EF7A 4YVAA 2ACTA 1F2BA 1GCBA 1EWMA 2PREA 1KHPA 1TU6A 1YVBA 1TL9A 3E1ZB 4P6EA 2NQIA 1CQDA 1YK7A 4QRXA 3V6CA 1NL6A 1Q6KA 1A6RA 2YJ2A 4QH6A 2FTDA 3KFQA 3WXGA 1U9WA 3S3RA 2FRAA 3KKUA 3O0UA 2YJ9A 2P0RA 2R9OA 3ERVA 4K7CA 3QT4A 4KLBA 1AYWA 2DC7A 4YYSA 1Y4HA 4X6HA 4W5CA 3KWZA 2R9MA 4YYVA 4YYWA 1QMYA 1NB5A 2HXZA 3S3QA 2E00A 2DCCA 4PP1A 2Y6EA 3M99A 2XU5A 1QDQA 3CH2X 1GLOA 3K24A 2FO5A 3F75A 4QRVA 4BS5A 4CDDB 2CIOA 1NB3A 3H89A 5JA7A 1MHWA 3P5WA 1DEUA 3H7DA 3H6SA 2DZYA 2XU1A 1CTEA 2DC6A 1PPOA 1DF0A 1HUCB 3PDFA 2AYOA 1MDWA 2NQDB 3I3TA 4YYRA 2E02A 4N8WA 1M6DA 5CVMA 4AXLA 5EF4A 4HWYA 2AYNA 4QRGA 2OZ2A 3DF0A 2BDZA 4BS6A 3RVXA 2P86A 2YJBA 1F2CA 3BC3A 4CDCB 2XU4A 1EWPA 1NPZA 4CDEB 4BPVA 4YYQA 4XR7A 3CH3X 1ATKA 4WA6A 2DJGB 1BGOA 1KFXL 4MSXA 5CVOB 3N4CA 5CHVA 5CHTA 2B1NA 3KX1A 1CPJA 3B79A 2E03A 3P5UA 1U9QX 1X9YA 3CBJA 3MORA 2AUXA 1GMYA 3IUTA 1CV8A 3MTNA 1ICFA 9PAPA 2R6NA 1QOLA 2FUDA 2NQAA 3HD3A 1YK8A 4DMYA 3OVZA 3BPMA 3BOWA 3BCNA 4PADA 4I07A 3QSDA
chains in the Genus database with same CATH superfamily
3NHEA 3N3GA 2R9NA 1VSNA 4D8EA 5EZSA 3OISA 2FYEA 1AYVA 3LFYA 1CJLA 1AECA 2JRIA 2DJFB 3IEJA 4FK5A 3LXSA 1PPDA 1AU4A 3PSEA 2DZZA 4REZA 2OULA 2Y5BA 3OVXA 4XUIA 3B21A 1ZCMA 2DC8A 4IP3A 1MEGA 4BOQA 2HD5A 1YALA 1BQIA 5E6JA 3PBHA 4X6IA 1XKGA 2G8EA 1PADA 1CSBB 3TMPA 3H8CA 4QBBA 5A24A 1NQCA 3U8EA 3HWNA 1YZBA 5EGWA 1GECE 1THEA 2J7QA 6PADA 3PT2A 3O65A 1STFE 2R9CA 1ITOA 3OF8A 1PE6A 3WXEA 2Z84A 4FIPA 3PHXA 2YJ8A 2O6XA 3I06A 1IWDA 2G6DA 4PP2E 3KWBX 3P5XA 1CVZA 4OEMA 1VJVA 1CB5A 1KHQA 4N4ZA 1DKIA 3MHHA 2DCDA 4PT5A 2AGAA 3E9SA 4RNAA 4Q8GA 3MP2A 3V6EA 1S4VA 7PCKA 4A5UA 1MIRA 4Q8HA 3F5VA 3IOQA 1YT7A 3BY4A 3KW9A 2ATOA 1AU0A 3N3KA 4YV8A 1KXRA 2DCAA 3MHSA 1SP4B 2JQGR 3MJ5A 3GCBA 3IMAA 2XU3A 5JH3A 2P7UA 1F2AA 3K9MA 2ARYA 3KSEA 3PRMA 3OF9A 4OELA 3RVWA 3WXFA 4DMXA 2GHUA 3P5VA 4MZOA 2FQ9A 2BDLA 4RF1A 1PIPA 4CZWA 4X6JA 8PCHA 4D8BA 2E01A 4BOZA 4ZTBA 1PCIA 3D6SA 3W31A 1U9XA 2IPPB 2F7DA 1U9VA 4RY2A 3W30A 2DCBA 1BY8A 1EWLA 1K3BB 5J94A 1FH0A 2VHFA 4WURA 3O1GA 1BP4A 1PPNA 5F02A 1Y08A 2HH5A 3K8UA 4D8IA 1PBHA 4I04A 1AU3A 3HHAA 3BPFA 3IV2A 2BU3A 4G54A 2NQGA 3PW3A 1F29A 4RF0A 1ZIVA 4W5BA 1JQPA 5JZEA 2DC9A 2PBHA 5KO3A 1QXPA 2IBIA 1MEMA 5EZQA 2AUZA 4FJCA 3BWKA 1U5IA 3AI8A 4P6GA 3IHPA 4BOSA 1AIMA 1O0EA 2C0YA 1MS6A 3RNVA 1TLOA 2AVWA 2R9FA 2YJCA 1AYUA 3C9EA 2F1GA 3H8BA 3TNXA 2FT2A 2GFOA 2H7JA 3QJ3A 2OP3A 2CB5A 2B1MA 2PNSA 4I05A 2AU1A 4MZSA 2G7YA 1CS8A 1KFUL 3ZUAA 3HHIA 4N79A 5CVNB 1SNKA 3ZNHA 4GUAA 1POPA 2AIMA 4W4UA 2VHSA 5FPWA 4PI3A 1ME4A 4BSQA 2PADA 2G8JA 2AS8A 3CBKA 1PPPA 3USVA 4AXMA 5PADA 1NLJA 4R3DA 5K16A 2DOSA 2JQFR 3PNRA 3RVVA 4ZUXU 2WBFX 2JTCA 4YYUA 4CDFB 1EWOA 1ME3A 2FE8A 4BQVA 2FRQA 1PXVA 4MI7A 1AU2A 2HHNA 1EF7A 4YVAA 2ACTA 1F2BA 1GCBA 1EWMA 2PREA 1KHPA 1TU6A 1YVBA 3MTVA 1TL9A 3E1ZB 4P6EA 2NQIA 4P16A 1CQDA 1YK7A 4QRXA 3V6CA 1NL6A 1Q6KA 1A6RA 2YJ2A 3C0RA 4QH6A 2FTDA 3KFQA 3WXGA 1U9WA 3S3RA 2FRAA 3KKUA 3O0UA 2YJ9A 4XZXA 2P0RA 2R9OA 3ERVA 4K7CA 3QT4A 4KLBA 1AYWA 2DC7A 3PHUA 4YYSA 1Y4HA 4X6HA 4W5CA 4M0WA 3KWZA 2R9MA 4YYVA 4YYWA 1QMYA 1NB5A 2HXZA 4MM3B 2UZJA 3S3QA 2E00A 2DCCA 4PP1A 2Y6EA 3IFUA 3M99A 2XU5A 1QDQA 3CH2X 1GLOA 3K24A 2FO5A 3F75A 2J7QC 4QRVA 4BS5A 4CDDB 1PVJA 2CIOA 1NB3A 3H89A 5JA7A 1MHWA 3P5WA 1DEUA 3PHWA 3H7DA 3H6SA 2DZYA 4BOUA 3TRKA 2XU1A 1CTEA 2DC6A 1PPOA 1DF0A 1HUCB 3PDFA 2AYOA 1MDWA 2NQDB 4IUMA 3I3TA 4YYRA 2E02A 4N8WA 1M6DA 5CVMA 4AXLA 5EF4A 4HWYA 1UKFA 2AYNA 4QRGA 4OVZA 2OZ2A 3DF0A 4OVZB 2BDZA 4BS6A 3RVXA 2P86A 4RKXA 2YJBA 4OW0A 1F2CA 3BC3A 4CDCB 2XU4A 1EWPA 3BBAA 1NPZA 4CDEB 4BPVA 4YYQA 4XR7A 3CH3X 1ATKA 4WA6A 2DJGB 1BGOA 1KFXL 4MSXA 5CVOB 3N4CA 5CHVA 5CHTA 2B1NA 3KX1A 1CPJA 4HXDB 3B79A 2HWKA 2E03A 3P5UA 3BB7A 1U9QX 1X9YA 3CBJA 2BTWA 3MORA 2AUXA 2BTWB 1GMYA 3IUTA 1CV8A 3MTNA 1ICFA 3OQCA 9PAPA 2R6NA 1QOLA 4BOPA 2FUDA 2NQAA 3HD3A 1YK8A 3PRPA 4DMYA 3OVZA 3BPMA 3BOWA 3BCNA 4PADA 4I07A 3QSDA
chains in the Genus database with same CATH topology
3NHEA 3N3GA 2R9NA 1VSNA 3OISA 2FYEA 1AYVA 3LFYA 1CJLA 1AECA 2DJFB 3IEJA 4FK5A 3LXSA 1PPDA 1AU4A 2DZZA 2OULA 2Y5BA 3OVXA 4XUIA 2VFCA 1ZCMA 2DC8A 1MEGA 2HD5A 1YALA 1BQIA 3PBHA 4X6IA 1XKGA 2G8EA 1PADA 1CSBB 3H8CA 4QBBA 5A24A 1NQCA 3U8EA 2VFBA 3HWNA 5EGWA 1GECE 1THEA 6PADA 1STFE 2R9CA 1ITOA 3OF8A 1PE6A 3WXEA 4FIPA 2YJ8A 2O6XA 3I06A 1IWDA 2G6DA 4PP2E 3KWBX 3P5XA 1CVZA 4OEMA 1VJVA 1CB5A 1KHQA 4N4ZA 1W4TA 3MHHA 2DCDA 4C5PA 4Q8GA 3V6EA 1S4VA 7PCKA 1MIRA 4Q8HA 3F5VA 3IOQA 1YT7A 3KW9A 2ATOA 1AU0A 3N3KA 4YV8A 1KXRA 2DCAA 1SP4B 3MHSA 4BGFA 2JQGR 3GCBA 3IMAA 2XU3A 5JH3A 2P7UA 1F2AA 3K9MA 2ARYA 3KSEA 3OF9A 4OELA 3RVWA 3WXFA 4DMXA 2GHUA 3P5VA 4MZOA 2FQ9A 2BDLA 1PIPA 4CZWA 4X6JA 8PCHA 2E01A 1W6FA 1PCIA 3D6SA 1U9XA 2IPPB 2F7DA 1U9VA 4RY2A 2DCBA 1BY8A 1EWLA 1K3BB 5J94A 1FH0A 2VHFA 3O1GA 2BSZA 1BP4A 1PPNA 5F02A 1Y08A 2HH5A 3K8UA 1PBHA 4I04A 1AU3A 3HHAA 3BPFA 3IV2A 4G54A 2NQGA 3LTWA 3PW3A 1F29A 1ZIVA 4W5BA 1JQPA 2DC9A 2PBHA 1QXPA 2IBIA 1MEMA 2AUZA 4FJCA 3BWKA 1U5IA 3AI8A 4P6GA 3IHPA 1AIMA 1O0EA 2C0YA 1MS6A 1TLOA 2AVWA 2R9FA 2YJCA 1AYUA 3C9EA 2F1GA 3H8BA 3TNXA 2FT2A 2GFOA 2H7JA 3QJ3A 2OP3A 2CB5A 2B1MA 2PNSA 4I05A 2AU1A 4MZSA 2G7YA 4B55A 1CS8A 1KFUL 3ZUAA 3HHIA 4N79A 5CVNB 1SNKA 1POPA 2AIMA 4W4UA 2VHSA 5FPWA 4PI3A 1ME4A 4BSQA 2PADA 2G8JA 2AS8A 3CBKA 1PPPA 4NV8A 3USVA 4AXMA 5PADA 1NLJA 5K16A 2JQFR 3PNRA 3RVVA 4ZUXU 2WBFX 4YYUA 4CDFB 1GX3A 1EWOA 1ME3A 4BQVA 2FRQA 1PXVA 1AU2A 4NV7A 2HHNA 1EF7A 4YVAA 2ACTA 1F2BA 1GCBA 1EWMA 2PREA 1KHPA 1TU6A 1YVBA 1TL9A 3E1ZB 4P6EA 2NQIA 1CQDA 1YK7A 4QRXA 3V6CA 1NL6A 1Q6KA 1A6RA 2YJ2A 4QH6A 2FTDA 3KFQA 3WXGA 1U9WA 3S3RA 2FRAA 3KKUA 3O0UA 2YJ9A 2P0RA 2R9OA 3ERVA 4K7CA 3QT4A 4KLBA 1AYWA 2DC7A 4YYSA 1Y4HA 4X6HA 4W5CA 3KWZA 2R9MA 4YYVA 4YYWA 1QMYA 3D9WA 1NB5A 2HXZA 3S3QA 2E00A 2DCCA 4PP1A 2Y6EA 3M99A 2XU5A 1QDQA 3CH2X 1GLOA 3K24A 2FO5A 3F75A 4QRVA 4BS5A 4CDDB 2CIOA 1NB3A 3H89A 5JA7A 1MHWA 3P5WA 1DEUA 3H7DA 3H6SA 2DZYA 2XU1A 1CTEA 2DC6A 1PPOA 1DF0A 1HUCB 3PDFA 2AYOA 1MDWA 2NQDB 3I3TA 4YYRA 2E02A 4N8WA 1M6DA 5CVMA 4AXLA 5EF4A 4HWYA 2AYNA 4QRGA 2OZ2A 3DF0A 4GUZA 2BDZA 4BS6A 3RVXA 2P86A 2YJBA 1F2CA 3BC3A 4CDCB 2XU4A 1EWPA 1NPZA 4CDEB 4BPVA 4YYQA 4XR7A 3CH3X 1ATKA 4WA6A 2DJGB 1BGOA 1KFXL 4MSXA 5CVOB 3N4CA 5CHVA 5CHTA 2B1NA 3KX1A 1CPJA 3B79A 2E03A 3P5UA 1U9QX 1X9YA 3CBJA 3MORA 2AUXA 1GMYA 3IUTA 1CV8A 3MTNA 1ICFA 1W5RA 9PAPA 1E2TA 2R6NA 1QOLA 2FUDA 2NQAA 3HD3A 1YK8A 4DMYA 3OVZA 3BPMA 3BOWA 3BCNA 4PADA 4I07A 3QSDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NHE A;  3N3G A;  2R9N A;  1VSN A;  3OIS A;  2FYE A;  1AYV A;  3LFY A;  1CJL A;  1AEC A;  2DJF B;  3IEJ A;  4FK5 A;  3LXS A;  1PPD A;  1AU4 A;  2DZZ A;  2OUL A;  2Y5B A;  3OVX A;  4XUI A;  1ZCM A;  2DC8 A;  1MEG A;  2HD5 A;  1YAL A;  1BQI A;  3PBH A;  4X6I A;  1XKG A;  2G8E A;  1PAD A;  1CSB B;  3H8C A;  4QBB A;  5A24 A;  1NQC A;  3U8E A;  3HWN A;  5EGW A;  1GEC E;  1THE A;  6PAD A;  1STF E;  2R9C A;  1ITO A;  3OF8 A;  1PE6 A;  3WXE A;  4FIP A;  2YJ8 A;  2O6X A;  3I06 A;  1IWD A;  2G6D A;  4PP2 E;  3KWB X;  3P5X A;  1CVZ A;  4OEM A;  1VJV A;  1CB5 A;  1KHQ A;  4N4Z A;  3MHH A;  2DCD A;  4Q8G A;  3V6E A;  1S4V A;  7PCK A;  1MIR A;  4Q8H A;  3F5V A;  3IOQ A;  1YT7 A;  3KW9 A;  2ATO A;  1AU0 A;  3N3K A;  4YV8 A;  1KXR A;  2DCA A;  1SP4 B;  3MHS A;  2JQG R;  3GCB A;  3IMA A;  2XU3 A;  5JH3 A;  2P7U A;  1F2A A;  3K9M A;  2ARY A;  3KSE A;  3OF9 A;  4OEL A;  3RVW A;  3WXF A;  4DMX A;  2GHU A;  3P5V A;  4MZO A;  2FQ9 A;  2BDL A;  1PIP A;  4CZW A;  4X6J A;  8PCH A;  2E01 A;  1PCI A;  3D6S A;  1U9X A;  2IPP B;  2F7D A;  1U9V A;  4RY2 A;  2DCB A;  1BY8 A;  1EWL A;  1K3B B;  5J94 A;  1FH0 A;  2VHF A;  3O1G A;  1BP4 A;  1PPN A;  5F02 A;  1Y08 A;  2HH5 A;  3K8U A;  1PBH A;  4I04 A;  1AU3 A;  3HHA A;  3BPF A;  3IV2 A;  4G54 A;  2NQG A;  3PW3 A;  1F29 A;  1ZIV A;  4W5B A;  1JQP A;  2DC9 A;  2PBH A;  1QXP A;  2IBI A;  1MEM A;  2AUZ A;  4FJC A;  3BWK A;  1U5I A;  3AI8 A;  4P6G A;  3IHP A;  1AIM A;  1O0E A;  2C0Y A;  1MS6 A;  1TLO A;  2AVW A;  2R9F A;  2YJC A;  1AYU A;  3C9E A;  2F1G A;  3H8B A;  3TNX A;  2FT2 A;  2GFO A;  2H7J A;  3QJ3 A;  2OP3 A;  2CB5 A;  2B1M A;  2PNS A;  4I05 A;  2AU1 A;  4MZS A;  2G7Y A;  1CS8 A;  1KFU L;  3ZUA A;  3HHI A;  4N79 A;  5CVN B;  1SNK A;  1POP A;  2AIM A;  4W4U A;  2VHS A;  5FPW A;  4PI3 A;  1ME4 A;  4BSQ A;  2PAD A;  2G8J A;  2AS8 A;  3CBK A;  1PPP A;  3USV A;  4AXM A;  5PAD A;  1NLJ A;  5K16 A;  2JQF R;  3PNR A;  3RVV A;  4ZUX U;  2WBF X;  4YYU A;  4CDF B;  1EWO A;  1ME3 A;  4BQV A;  2FRQ A;  1PXV A;  1AU2 A;  2HHN A;  1EF7 A;  4YVA A;  2ACT A;  1F2B A;  1GCB A;  1EWM A;  2PRE A;  1KHP A;  1TU6 A;  1YVB A;  1TL9 A;  3E1Z B;  4P6E A;  2NQI A;  1CQD A;  1YK7 A;  4QRX A;  3V6C A;  1NL6 A;  1Q6K A;  1A6R A;  2YJ2 A;  4QH6 A;  2FTD A;  3KFQ A;  3WXG A;  1U9W A;  3S3R A;  2FRA A;  3KKU A;  3O0U A;  2YJ9 A;  2P0R A;  2R9O A;  3ERV A;  4K7C A;  3QT4 A;  4KLB A;  1AYW A;  2DC7 A;  4YYS A;  1Y4H A;  4X6H A;  4W5C A;  3KWZ A;  2R9M A;  4YYV A;  4YYW A;  1QMY A;  1NB5 A;  2HXZ A;  3S3Q A;  2E00 A;  2DCC A;  4PP1 A;  2Y6E A;  3M99 A;  2XU5 A;  1QDQ A;  3CH2 X;  1GLO A;  3K24 A;  2FO5 A;  3F75 A;  4QRV A;  4BS5 A;  4CDD B;  2CIO A;  1NB3 A;  3H89 A;  5JA7 A;  1MHW A;  3P5W A;  1DEU A;  3H7D A;  3H6S A;  2DZY A;  2XU1 A;  1CTE A;  2DC6 A;  1PPO A;  1DF0 A;  1HUC B;  3PDF A;  2AYO A;  1MDW A;  2NQD B;  3I3T A;  4YYR A;  2E02 A;  4N8W A;  1M6D A;  5CVM A;  4AXL A;  5EF4 A;  4HWY A;  2AYN A;  4QRG A;  2OZ2 A;  3DF0 A;  2BDZ A;  4BS6 A;  3RVX A;  2P86 A;  2YJB A;  1F2C A;  3BC3 A;  4CDC B;  2XU4 A;  1EWP A;  1NPZ A;  4CDE B;  4BPV A;  4YYQ A;  4XR7 A;  3CH3 X;  1ATK A;  4WA6 A;  2DJG B;  1BGO A;  1KFX L;  4MSX A;  5CVO B;  3N4C A;  5CHV A;  5CHT A;  2B1N A;  3KX1 A;  1CPJ A;  3B79 A;  2E03 A;  3P5U A;  1U9Q X;  1X9Y A;  3CBJ A;  3MOR A;  2AUX A;  1GMY A;  3IUT A;  1CV8 A;  3MTN A;  1ICF A;  9PAP A;  2R6N A;  1QOL A;  2FUD A;  2NQA A;  3HD3 A;  1YK8 A;  4DMY A;  3OVZ A;  3BPM A;  3BOW A;  3BCN A;  4PAD A;  4I07 A;  3QSD A; 
#chains in the Genus database with same CATH topology
 3NHE A;  3N3G A;  2R9N A;  1VSN A;  4D8E A;  5EZS A;  3OIS A;  2FYE A;  1AYV A;  3LFY A;  1CJL A;  1AEC A;  2JRI A;  2DJF B;  3IEJ A;  4FK5 A;  3LXS A;  1PPD A;  1AU4 A;  3PSE A;  2DZZ A;  4REZ A;  2OUL A;  2Y5B A;  3OVX A;  4XUI A;  3B21 A;  1ZCM A;  2DC8 A;  4IP3 A;  1MEG A;  4BOQ A;  2HD5 A;  1YAL A;  1BQI A;  5E6J A;  3PBH A;  4X6I A;  1XKG A;  2G8E A;  1PAD A;  1CSB B;  3TMP A;  3H8C A;  4QBB A;  5A24 A;  1NQC A;  3U8E A;  3HWN A;  1YZB A;  5EGW A;  1GEC E;  1THE A;  2J7Q A;  6PAD A;  3PT2 A;  3O65 A;  1STF E;  2R9C A;  1ITO A;  3OF8 A;  1PE6 A;  3WXE A;  2Z84 A;  4FIP A;  3PHX A;  2YJ8 A;  2O6X A;  3I06 A;  1IWD A;  2G6D A;  4PP2 E;  3KWB X;  3P5X A;  1CVZ A;  4OEM A;  1VJV A;  1CB5 A;  1KHQ A;  4N4Z A;  1DKI A;  3MHH A;  2DCD A;  4PT5 A;  2AGA A;  3E9S A;  4RNA A;  4Q8G A;  3MP2 A;  3V6E A;  1S4V A;  7PCK A;  4A5U A;  1MIR A;  4Q8H A;  3F5V A;  3IOQ A;  1YT7 A;  3BY4 A;  3KW9 A;  2ATO A;  1AU0 A;  3N3K A;  4YV8 A;  1KXR A;  2DCA A;  3MHS A;  1SP4 B;  2JQG R;  3MJ5 A;  3GCB A;  3IMA A;  2XU3 A;  5JH3 A;  2P7U A;  1F2A A;  3K9M A;  2ARY A;  3KSE A;  3PRM A;  3OF9 A;  4OEL A;  3RVW A;  3WXF A;  4DMX A;  2GHU A;  3P5V A;  4MZO A;  2FQ9 A;  2BDL A;  4RF1 A;  1PIP A;  4CZW A;  4X6J A;  8PCH A;  4D8B A;  2E01 A;  4BOZ A;  4ZTB A;  1PCI A;  3D6S A;  3W31 A;  1U9X A;  2IPP B;  2F7D A;  1U9V A;  4RY2 A;  3W30 A;  2DCB A;  1BY8 A;  1EWL A;  1K3B B;  5J94 A;  1FH0 A;  2VHF A;  4WUR A;  3O1G A;  1BP4 A;  1PPN A;  5F02 A;  1Y08 A;  2HH5 A;  3K8U A;  4D8I A;  1PBH A;  4I04 A;  1AU3 A;  3HHA A;  3BPF A;  3IV2 A;  2BU3 A;  4G54 A;  2NQG A;  3PW3 A;  1F29 A;  4RF0 A;  1ZIV A;  4W5B A;  1JQP A;  5JZE A;  2DC9 A;  2PBH A;  5KO3 A;  1QXP A;  2IBI A;  1MEM A;  5EZQ A;  2AUZ A;  4FJC A;  3BWK A;  1U5I A;  3AI8 A;  4P6G A;  3IHP A;  4BOS A;  1AIM A;  1O0E A;  2C0Y A;  1MS6 A;  3RNV A;  1TLO A;  2AVW A;  2R9F A;  2YJC A;  1AYU A;  3C9E A;  2F1G A;  3H8B A;  3TNX A;  2FT2 A;  2GFO A;  2H7J A;  3QJ3 A;  2OP3 A;  2CB5 A;  2B1M A;  2PNS A;  4I05 A;  2AU1 A;  4MZS A;  2G7Y A;  1CS8 A;  1KFU L;  3ZUA A;  3HHI A;  4N79 A;  5CVN B;  1SNK A;  3ZNH A;  4GUA A;  1POP A;  2AIM A;  4W4U A;  2VHS A;  5FPW A;  4PI3 A;  1ME4 A;  4BSQ A;  2PAD A;  2G8J A;  2AS8 A;  3CBK A;  1PPP A;  3USV A;  4AXM A;  5PAD A;  1NLJ A;  4R3D A;  5K16 A;  2DOS A;  2JQF R;  3PNR A;  3RVV A;  4ZUX U;  2WBF X;  2JTC A;  4YYU A;  4CDF B;  1EWO A;  1ME3 A;  2FE8 A;  4BQV A;  2FRQ A;  1PXV A;  4MI7 A;  1AU2 A;  2HHN A;  1EF7 A;  4YVA A;  2ACT A;  1F2B A;  1GCB A;  1EWM A;  2PRE A;  1KHP A;  1TU6 A;  1YVB A;  3MTV A;  1TL9 A;  3E1Z B;  4P6E A;  2NQI A;  4P16 A;  1CQD A;  1YK7 A;  4QRX A;  3V6C A;  1NL6 A;  1Q6K A;  1A6R A;  2YJ2 A;  3C0R A;  4QH6 A;  2FTD A;  3KFQ A;  3WXG A;  1U9W A;  3S3R A;  2FRA A;  3KKU A;  3O0U A;  2YJ9 A;  4XZX A;  2P0R A;  2R9O A;  3ERV A;  4K7C A;  3QT4 A;  4KLB A;  1AYW A;  2DC7 A;  3PHU A;  4YYS A;  1Y4H A;  4X6H A;  4W5C A;  4M0W A;  3KWZ A;  2R9M A;  4YYV A;  4YYW A;  1QMY A;  1NB5 A;  2HXZ A;  4MM3 B;  2UZJ A;  3S3Q A;  2E00 A;  2DCC A;  4PP1 A;  2Y6E A;  3IFU A;  3M99 A;  2XU5 A;  1QDQ A;  3CH2 X;  1GLO A;  3K24 A;  2FO5 A;  3F75 A;  2J7Q C;  4QRV A;  4BS5 A;  4CDD B;  1PVJ A;  2CIO A;  1NB3 A;  3H89 A;  5JA7 A;  1MHW A;  3P5W A;  1DEU A;  3PHW A;  3H7D A;  3H6S A;  2DZY A;  4BOU A;  3TRK A;  2XU1 A;  1CTE A;  2DC6 A;  1PPO A;  1DF0 A;  1HUC B;  3PDF A;  2AYO A;  1MDW A;  2NQD B;  4IUM A;  3I3T A;  4YYR A;  2E02 A;  4N8W A;  1M6D A;  5CVM A;  4AXL A;  5EF4 A;  4HWY A;  1UKF A;  2AYN A;  4QRG A;  4OVZ A;  2OZ2 A;  3DF0 A;  4OVZ B;  2BDZ A;  4BS6 A;  3RVX A;  2P86 A;  4RKX A;  2YJB A;  4OW0 A;  1F2C A;  3BC3 A;  4CDC B;  2XU4 A;  1EWP A;  3BBA A;  1NPZ A;  4CDE B;  4BPV A;  4YYQ A;  4XR7 A;  3CH3 X;  1ATK A;  4WA6 A;  2DJG B;  1BGO A;  1KFX L;  4MSX A;  5CVO B;  3N4C A;  5CHV A;  5CHT A;  2B1N A;  3KX1 A;  1CPJ A;  4HXD B;  3B79 A;  2HWK A;  2E03 A;  3P5U A;  3BB7 A;  1U9Q X;  1X9Y A;  3CBJ A;  2BTW A;  3MOR A;  2AUX A;  2BTW B;  1GMY A;  3IUT A;  1CV8 A;  3MTN A;  1ICF A;  3OQC A;  9PAP A;  2R6N A;  1QOL A;  4BOP A;  2FUD A;  2NQA A;  3HD3 A;  1YK8 A;  3PRP A;  4DMY A;  3OVZ A;  3BPM A;  3BOW A;  3BCN A;  4PAD A;  4I07 A;  3QSD A; 
#chains in the Genus database with same CATH homology
 3NHE A;  3N3G A;  2R9N A;  1VSN A;  3OIS A;  2FYE A;  1AYV A;  3LFY A;  1CJL A;  1AEC A;  2DJF B;  3IEJ A;  4FK5 A;  3LXS A;  1PPD A;  1AU4 A;  2DZZ A;  2OUL A;  2Y5B A;  3OVX A;  4XUI A;  2VFC A;  1ZCM A;  2DC8 A;  1MEG A;  2HD5 A;  1YAL A;  1BQI A;  3PBH A;  4X6I A;  1XKG A;  2G8E A;  1PAD A;  1CSB B;  3H8C A;  4QBB A;  5A24 A;  1NQC A;  3U8E A;  2VFB A;  3HWN A;  5EGW A;  1GEC E;  1THE A;  6PAD A;  1STF E;  2R9C A;  1ITO A;  3OF8 A;  1PE6 A;  3WXE A;  4FIP A;  2YJ8 A;  2O6X A;  3I06 A;  1IWD A;  2G6D A;  4PP2 E;  3KWB X;  3P5X A;  1CVZ A;  4OEM A;  1VJV A;  1CB5 A;  1KHQ A;  4N4Z A;  1W4T A;  3MHH A;  2DCD A;  4C5P A;  4Q8G A;  3V6E A;  1S4V A;  7PCK A;  1MIR A;  4Q8H A;  3F5V A;  3IOQ A;  1YT7 A;  3KW9 A;  2ATO A;  1AU0 A;  3N3K A;  4YV8 A;  1KXR A;  2DCA A;  1SP4 B;  3MHS A;  4BGF A;  2JQG R;  3GCB A;  3IMA A;  2XU3 A;  5JH3 A;  2P7U A;  1F2A A;  3K9M A;  2ARY A;  3KSE A;  3OF9 A;  4OEL A;  3RVW A;  3WXF A;  4DMX A;  2GHU A;  3P5V A;  4MZO A;  2FQ9 A;  2BDL A;  1PIP A;  4CZW A;  4X6J A;  8PCH A;  2E01 A;  1W6F A;  1PCI A;  3D6S A;  1U9X A;  2IPP B;  2F7D A;  1U9V A;  4RY2 A;  2DCB A;  1BY8 A;  1EWL A;  1K3B B;  5J94 A;  1FH0 A;  2VHF A;  3O1G A;  2BSZ A;  1BP4 A;  1PPN A;  5F02 A;  1Y08 A;  2HH5 A;  3K8U A;  1PBH A;  4I04 A;  1AU3 A;  3HHA A;  3BPF A;  3IV2 A;  4G54 A;  2NQG A;  3LTW A;  3PW3 A;  1F29 A;  1ZIV A;  4W5B A;  1JQP A;  2DC9 A;  2PBH A;  1QXP A;  2IBI A;  1MEM A;  2AUZ A;  4FJC A;  3BWK A;  1U5I A;  3AI8 A;  4P6G A;  3IHP A;  1AIM A;  1O0E A;  2C0Y A;  1MS6 A;  1TLO A;  2AVW A;  2R9F A;  2YJC A;  1AYU A;  3C9E A;  2F1G A;  3H8B A;  3TNX A;  2FT2 A;  2GFO A;  2H7J A;  3QJ3 A;  2OP3 A;  2CB5 A;  2B1M A;  2PNS A;  4I05 A;  2AU1 A;  4MZS A;  2G7Y A;  4B55 A;  1CS8 A;  1KFU L;  3ZUA A;  3HHI A;  4N79 A;  5CVN B;  1SNK A;  1POP A;  2AIM A;  4W4U A;  2VHS A;  5FPW A;  4PI3 A;  1ME4 A;  4BSQ A;  2PAD A;  2G8J A;  2AS8 A;  3CBK A;  1PPP A;  4NV8 A;  3USV A;  4AXM A;  5PAD A;  1NLJ A;  5K16 A;  2JQF R;  3PNR A;  3RVV A;  4ZUX U;  2WBF X;  4YYU A;  4CDF B;  1GX3 A;  1EWO A;  1ME3 A;  4BQV A;  2FRQ A;  1PXV A;  1AU2 A;  4NV7 A;  2HHN A;  1EF7 A;  4YVA A;  2ACT A;  1F2B A;  1GCB A;  1EWM A;  2PRE A;  1KHP A;  1TU6 A;  1YVB A;  1TL9 A;  3E1Z B;  4P6E A;  2NQI A;  1CQD A;  1YK7 A;  4QRX A;  3V6C A;  1NL6 A;  1Q6K A;  1A6R A;  2YJ2 A;  4QH6 A;  2FTD A;  3KFQ A;  3WXG A;  1U9W A;  3S3R A;  2FRA A;  3KKU A;  3O0U A;  2YJ9 A;  2P0R A;  2R9O A;  3ERV A;  4K7C A;  3QT4 A;  4KLB A;  1AYW A;  2DC7 A;  4YYS A;  1Y4H A;  4X6H A;  4W5C A;  3KWZ A;  2R9M A;  4YYV A;  4YYW A;  1QMY A;  3D9W A;  1NB5 A;  2HXZ A;  3S3Q A;  2E00 A;  2DCC A;  4PP1 A;  2Y6E A;  3M99 A;  2XU5 A;  1QDQ A;  3CH2 X;  1GLO A;  3K24 A;  2FO5 A;  3F75 A;  4QRV A;  4BS5 A;  4CDD B;  2CIO A;  1NB3 A;  3H89 A;  5JA7 A;  1MHW A;  3P5W A;  1DEU A;  3H7D A;  3H6S A;  2DZY A;  2XU1 A;  1CTE A;  2DC6 A;  1PPO A;  1DF0 A;  1HUC B;  3PDF A;  2AYO A;  1MDW A;  2NQD B;  3I3T A;  4YYR A;  2E02 A;  4N8W A;  1M6D A;  5CVM A;  4AXL A;  5EF4 A;  4HWY A;  2AYN A;  4QRG A;  2OZ2 A;  3DF0 A;  4GUZ A;  2BDZ A;  4BS6 A;  3RVX A;  2P86 A;  2YJB A;  1F2C A;  3BC3 A;  4CDC B;  2XU4 A;  1EWP A;  1NPZ A;  4CDE B;  4BPV A;  4YYQ A;  4XR7 A;  3CH3 X;  1ATK A;  4WA6 A;  2DJG B;  1BGO A;  1KFX L;  4MSX A;  5CVO B;  3N4C A;  5CHV A;  5CHT A;  2B1N A;  3KX1 A;  1CPJ A;  3B79 A;  2E03 A;  3P5U A;  1U9Q X;  1X9Y A;  3CBJ A;  3MOR A;  2AUX A;  1GMY A;  3IUT A;  1CV8 A;  3MTN A;  1ICF A;  1W5R A;  9PAP A;  1E2T A;  2R6N A;  1QOL A;  2FUD A;  2NQA A;  3HD3 A;  1YK8 A;  4DMY A;  3OVZ A;  3BPM A;  3BOW A;  3BCN A;  4PAD A;  4I07 A;  3QSD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...