1CVZA

Crystal structure analysis of papain with clik148(cathepsin l specific inhibitor)
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
212
structure length
212
Chain Sequence
IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNQYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNQGALLYSIANQPVSVVLQAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PAPAIN
publication title Inhibition mechanism of cathepsin L-specific inhibitors based on the crystal structure of papain-CLIK148 complex.
pubmed doi rcsb
total genus 68
structure length 212
sequence length 212
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 1999-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1cvzA00
4CDDB 4QRVA 1F29A 1PXVA 2R6NA 1YVBA 2NQIA 4X6IA 2P0RA 3D6SA 5CHVA 1M6DA 4BPVA 2AYOA 3H89A 3TNXA 1EF7A 1TU6A 4DMYA 4ZUXU 3WXEA 2R9NA 3NHEA 2AS8A 2AUXA 2CB5A 1AYVA 5JH3A 1U9QX 3CH3X 3CBKA 1K3BB 4MZOA 3P5UA 1U9VA 1QMYA 3K9MA 2AYNA 3HHAA 4YVAA 1QXPA 3PBHA 1O0EA 4PADA 3QSDA 4OEMA 1F2CA 1ITOA 1MS6A 1GLOA 3BWKA 2YJ2A 3K8UA 4G54A 2B1NA 1ZIVA 3HWNA 2ATOA 3KX1A 2XU4A 1ZCMA 1CS8A 2DC7A 4N4ZA 4KLBA 1MEMA 2G6DA 1KFUL 3HHIA 9PAPA 1AU2A 2YJ9A 3GCBA 4K7CA 4YYVA 3BOWA 3OF9A 3PNRA 1A6RA 4BS6A 1BY8A 2R9OA 3WXFA 1ATKA 2H7JA 3H8CA 2JQFR 3E1ZB 3KWBX 1JQPA 1EWPA 1SP4B 5EGWA 1YK7A 2E01A 3OVXA 1THEA 4YYSA 3BPMA 1MHWA 2DZYA 3OF8A 1U5IA 1MIRA 4YYRA 1GCBA 1CJLA 3ERVA 2IBIA 1KXRA 2IPPB 1NLJA 4W4UA 3RVXA 3P5VA 5CHTA 4BSQA 1BP4A 1SNKA 2FYEA 4N79A 1CSBB 3RVWA 5F02A 1PIPA 1PCIA 1PPOA 2OULA 3IEJA 1CTEA 1PADA 4Q8GA 4QRXA 2C0YA 2ACTA 4HWYA 5J94A 4X6HA 4I07A 4YYWA 1IWDA 2DC9A 1ME4A 3U8EA 3N3KA 2AUZA 3P5WA 1KHPA 2PREA 3MTNA 4OELA 3KSEA 2VHFA 2XU5A 1BGOA 3BPFA 2DCCA 2FRQA 3K24A 3WXGA 3QJ3A 1PPNA 4I04A 3MHHA 4P6EA 1FH0A 3LFYA 2P86A 1PPDA 2YJBA 1YALA 2FUDA 3M99A 1PBHA 1KFXL 3IMAA 8PCHA 1ICFA 2PADA 2FTDA 3BC3A 2YJ8A 1QDQA 5CVOB 2R9CA 3V6CA 3QT4A 3BCNA 4FJCA 1NQCA 2PBHA 2R9FA 2AIMA 4YYQA 2B1MA 3F75A 2DC6A 1Y08A 2DCDA 3MORA 2ARYA 2YJCA 3P5XA 5FPWA 1DF0A 1Y4HA 4AXMA 2GHUA 2R9MA 2AU1A 2CIOA 7PCKA 1NB3A 6PADA 1AU3A 1AYWA 2OZ2A 3V6EA 2G8JA 2AVWA 4BQVA 4AXLA 1AU4A 2JQGR 2VHSA 3USVA 1AIMA 1PE6A 1MDWA 2E03A 4MZSA 3CH2X 1F2BA 3IHPA 4DMXA 4QRGA 1NPZA 3I06A 2NQGA 1TLOA 1TL9A 1VJVA 2G7YA 3HD3A 4N8WA 1CV8A 4PP2E 1S4VA 4RY2A 2F1GA 4W5CA 1GMYA 2BDZA 2XU3A 3KW9A 3OVZA 3N4CA 4CDFB 3AI8A 4W5BA 5CVNB 4QH6A 3H7DA 1U9WA 2NQDB 1CPJA 4PI3A 1VSNA 2OP3A 1POPA 1STFE 5PADA 1PPPA 3N3GA 3H6SA 4YYUA 1AU0A 2HXZA 4PP1A 4CDCB 3MHSA 1YT7A 4XUIA 3KWZA 3O0UA 3PW3A 3C9EA 2DZZA 1CVZA 3KKUA 1AECA 3B79A 2BDLA 3ZUAA 5CVMA 4I05A 4Q8HA 2FQ9A 2NQAA 5A24A 2GFOA 2WBFX 1ME3A 1Q6KA 3PDFA 2Y5BA 3KFQA 4FK5A 2DJFB 2P7UA 2DCAA 3CBJA 4QBBA 1BQIA 2Y6EA 1U9XA 1NB5A 1X9YA 1QOLA 5JA7A 2HH5A 4WA6A 2HD5A 2PNSA 4P6GA 1EWMA 3IUTA 2FRAA 3O1GA 1CB5A 1F2AA 2DJGB 3IV2A 3RVVA 5EF4A 2G8EA 1CQDA 3LXSA 4YV8A 1EWLA 2DCBA 2E00A 3F5VA 1AYUA 1HUCB 1YK8A 2F7DA 5K16A 4CDEB 3S3RA 3IOQA 1EWOA 3OISA 2FO5A 1MEGA 4MSXA 2E02A 1KHQA 4CZWA 3H8BA 1NL6A 1XKGA 2FT2A 2HHNA 4FIPA 3DF0A 1DEUA 1GECE 2DC8A 4BS5A 4X6JA 3I3TA 4XR7A 2O6XA 2XU1A 3S3QA
chains in the Genus database with same CATH superfamily
4CDDB 4QRVA 1F29A 1PXVA 2R6NA 1YVBA 2NQIA 4X6IA 2P0RA 3D6SA 5CHVA 1M6DA 4BPVA 2AYOA 3E9SA 3H89A 1EF7A 3TNXA 1TU6A 4DMYA 3RNVA 3MP2A 5KO3A 4ZUXU 3WXEA 2R9NA 3NHEA 2AS8A 4RNAA 2AUXA 2CB5A 1UKFA 1AYVA 5JH3A 1U9QX 3CH3X 3CBKA 1K3BB 4MZOA 3P5UA 1U9VA 3B21A 4A5UA 1QMYA 3K9MA 2AYNA 3O65A 3HHAA 4YVAA 1QXPA 2BTWB 3PBHA 1O0EA 2Z84A 4PADA 3QSDA 4OEMA 4MI7A 1F2CA 1ITOA 1MS6A 1GLOA 3BWKA 2YJ2A 3K8UA 4G54A 2B1NA 1ZIVA 3HWNA 4HXDB 2ATOA 3KX1A 2XU4A 1ZCMA 3PHXA 1CS8A 2DC7A 4N4ZA 4KLBA 1MEMA 2G6DA 1KFUL 3HHIA 2BTWA 9PAPA 3BB7A 1AU2A 2YJ9A 3GCBA 5EZSA 3TRKA 3PHUA 4K7CA 4YYVA 3BOWA 3OF9A 3PNRA 1A6RA 4BS6A 1BY8A 2R9OA 1YZBA 3WXFA 4OVZB 1ATKA 2H7JA 3H8CA 2JQFR 3E1ZB 3KWBX 1JQPA 1EWPA 1SP4B 5EGWA 2AGAA 1YK7A 3C0RA 2E01A 3OVXA 1THEA 4BOSA 4YYSA 3BPMA 1MHWA 2DZYA 3OF8A 1U5IA 1MIRA 2HWKA 4YYRA 1GCBA 1CJLA 3ERVA 4P16A 2IBIA 2DOSA 4OVZA 4BOUA 1KXRA 4IP3A 2IPPB 4RKXA 1NLJA 4W4UA 4ZTBA 3RVXA 3P5VA 5CHTA 4BSQA 1BP4A 1SNKA 2FYEA 4N79A 1CSBB 3RVWA 5F02A 1PIPA 1PCIA 1PPOA 2OULA 3IEJA 1CTEA 1PADA 4Q8GA 4QRXA 2C0YA 2ACTA 4HWYA 5J94A 4R3DA 4X6HA 4I07A 4YYWA 1IWDA 2DC9A 1ME4A 3U8EA 3N3KA 3PHWA 2BU3A 3BY4A 2AUZA 3P5WA 1KHPA 2PREA 3MTNA 4OELA 4M0WA 3KSEA 2VHFA 2XU5A 1PVJA 4OW0A 1BGOA 3BPFA 2J7QA 2DCCA 2J7QC 2FRQA 3K24A 3PT2A 3WXGA 3QJ3A 1PPNA 4I04A 3MHHA 4P6EA 1FH0A 3LFYA 2P86A 1PPDA 2YJBA 1YALA 2FUDA 3M99A 4MM3B 1PBHA 1KFXL 3IMAA 8PCHA 1ICFA 2PADA 2FTDA 3BC3A 3IFUA 2YJ8A 3BBAA 1QDQA 3W30A 5CVOB 4GUAA 2R9CA 3V6CA 3QT4A 3BCNA 4FJCA 1NQCA 2PBHA 3PRPA 2R9FA 2AIMA 4YYQA 4RF1A 2B1MA 3F75A 2DC6A 1Y08A 2DCDA 3MORA 2ARYA 2YJCA 3P5XA 5FPWA 3W31A 1DF0A 1Y4HA 4AXMA 2GHUA 2R9MA 2AU1A 2CIOA 3PSEA 7PCKA 1NB3A 4BOQA 6PADA 1AU3A 1AYWA 2OZ2A 3V6EA 2G8JA 3MTVA 4BOPA 2AVWA 4BQVA 4AXLA 1AU4A 2JQGR 2VHSA 5E6JA 3USVA 1AIMA 1PE6A 1MDWA 2FE8A 2E03A 4MZSA 3CH2X 4IUMA 1F2BA 3IHPA 4DMXA 4QRGA 1NPZA 3I06A 2NQGA 1TLOA 1TL9A 4RF0A 1VJVA 2G7YA 3HD3A 4N8WA 1CV8A 4PP2E 1S4VA 4RY2A 2F1GA 4W5CA 1GMYA 2BDZA 2XU3A 3KW9A 2JTCA 3OVZA 4D8EA 2UZJA 3N4CA 4CDFB 3AI8A 4W5BA 5CVNB 4QH6A 3H7DA 1U9WA 2NQDB 1CPJA 4PI3A 1VSNA 2OP3A 1POPA 1STFE 5PADA 1PPPA 3N3GA 4D8IA 3H6SA 4YYUA 1AU0A 2HXZA 4PP1A 4CDCB 3MHSA 1YT7A 4XUIA 3KWZA 4WURA 3O0UA 3PW3A 3C9EA 3MJ5A 2DZZA 1CVZA 3KKUA 1AECA 3B79A 2BDLA 3ZUAA 5CVMA 4I05A 4Q8HA 2FQ9A 2NQAA 3PRMA 5A24A 2GFOA 2WBFX 1ME3A 1Q6KA 3PDFA 2Y5BA 3KFQA 4FK5A 2DJFB 4PT5A 2P7UA 2DCAA 3CBJA 4QBBA 1BQIA 2Y6EA 1U9XA 1NB5A 1X9YA 1QOLA 3TMPA 5JA7A 2HH5A 4WA6A 2HD5A 2PNSA 4P6GA 2JRIA 1EWMA 3IUTA 3OQCA 2FRAA 3O1GA 1CB5A 1F2AA 2DJGB 3IV2A 4REZA 3RVVA 5EF4A 1DKIA 2G8EA 1CQDA 3LXSA 4YV8A 1EWLA 2DCBA 2E00A 3F5VA 3ZNHA 1AYUA 1HUCB 1YK8A 5EZQA 2F7DA 5K16A 4CDEB 5JZEA 3S3RA 3IOQA 1EWOA 3OISA 4XZXA 2FO5A 1MEGA 4MSXA 4BOZA 2E02A 1KHQA 4CZWA 3H8BA 1NL6A 1XKGA 2FT2A 2HHNA 4FIPA 3DF0A 1DEUA 1GECE 2DC8A 4BS5A 4X6JA 3I3TA 4XR7A 2O6XA 2XU1A 3S3QA 4D8BA
chains in the Genus database with same CATH topology
4CDDB 4QRVA 1F29A 1PXVA 2R6NA 1YVBA 2NQIA 4X6IA 2P0RA 3D6SA 5CHVA 1M6DA 4BPVA 2AYOA 3H89A 3TNXA 1EF7A 1TU6A 4DMYA 4ZUXU 3WXEA 2R9NA 3NHEA 2AS8A 2AUXA 2CB5A 1AYVA 5JH3A 1U9QX 3CH3X 3CBKA 1K3BB 4MZOA 3P5UA 1U9VA 1QMYA 3K9MA 2AYNA 3HHAA 4YVAA 1QXPA 3PBHA 1O0EA 1W6FA 4PADA 3QSDA 4OEMA 1F2CA 1ITOA 1MS6A 1GLOA 3BWKA 2YJ2A 3K8UA 4G54A 2B1NA 4B55A 1ZIVA 3HWNA 2ATOA 3KX1A 2XU4A 1ZCMA 4NV7A 1CS8A 2DC7A 4N4ZA 4KLBA 1MEMA 2G6DA 1KFUL 4NV8A 3HHIA 9PAPA 1AU2A 2YJ9A 3GCBA 4K7CA 4YYVA 3BOWA 3OF9A 3PNRA 1A6RA 4BS6A 4BGFA 1BY8A 2R9OA 3WXFA 1ATKA 2H7JA 3H8CA 2JQFR 3E1ZB 3KWBX 1JQPA 1EWPA 1SP4B 3D9WA 5EGWA 1YK7A 2E01A 3OVXA 1THEA 4YYSA 3BPMA 1MHWA 2DZYA 3OF8A 1U5IA 1MIRA 4YYRA 1GCBA 1CJLA 3ERVA 2IBIA 1KXRA 1W4TA 2IPPB 1NLJA 4W4UA 3RVXA 3P5VA 5CHTA 4BSQA 1BP4A 1SNKA 2FYEA 2VFBA 4N79A 1CSBB 3RVWA 5F02A 1PIPA 1PCIA 1PPOA 2OULA 3IEJA 1CTEA 1PADA 4Q8GA 4QRXA 2C0YA 2ACTA 4HWYA 5J94A 4X6HA 4I07A 4YYWA 1IWDA 2DC9A 1ME4A 3U8EA 3N3KA 2AUZA 3P5WA 1KHPA 2PREA 3MTNA 4OELA 3KSEA 2VHFA 2XU5A 1BGOA 3BPFA 2DCCA 2FRQA 3K24A 3WXGA 3QJ3A 1PPNA 4I04A 3MHHA 4P6EA 1FH0A 3LFYA 2P86A 1PPDA 2YJBA 1YALA 2FUDA 3M99A 1PBHA 1E2TA 1KFXL 3IMAA 8PCHA 1ICFA 2PADA 2FTDA 3BC3A 2YJ8A 1QDQA 1GX3A 5CVOB 2R9CA 3V6CA 3QT4A 3BCNA 4FJCA 1NQCA 2PBHA 2R9FA 2AIMA 4YYQA 2B1MA 3F75A 2DC6A 1Y08A 2DCDA 3MORA 2ARYA 2YJCA 3P5XA 5FPWA 1DF0A 1Y4HA 4AXMA 2GHUA 2R9MA 2AU1A 2CIOA 7PCKA 1NB3A 6PADA 1AU3A 1AYWA 2OZ2A 3V6EA 2G8JA 2AVWA 4BQVA 4AXLA 1AU4A 2JQGR 2VHSA 3USVA 1AIMA 1PE6A 1MDWA 2E03A 4MZSA 3CH2X 1F2BA 3IHPA 4DMXA 4QRGA 1NPZA 3I06A 2NQGA 1TLOA 1TL9A 1VJVA 2G7YA 3HD3A 4N8WA 1CV8A 4PP2E 1S4VA 4RY2A 2F1GA 4W5CA 1GMYA 2BDZA 2XU3A 3KW9A 3OVZA 3N4CA 4CDFB 3AI8A 4W5BA 5CVNB 4QH6A 3H7DA 1U9WA 2NQDB 1CPJA 4PI3A 1VSNA 2OP3A 1POPA 1STFE 5PADA 1PPPA 3N3GA 3H6SA 4YYUA 1AU0A 2HXZA 4PP1A 4CDCB 3MHSA 1YT7A 4XUIA 3KWZA 3O0UA 3PW3A 3C9EA 2DZZA 1CVZA 3KKUA 1AECA 3LTWA 3B79A 2BDLA 3ZUAA 5CVMA 4I05A 4Q8HA 2FQ9A 2NQAA 5A24A 2GFOA 2WBFX 1ME3A 4GUZA 1Q6KA 3PDFA 2Y5BA 3KFQA 4FK5A 2DJFB 4C5PA 2P7UA 2DCAA 3CBJA 4QBBA 1BQIA 2Y6EA 1U9XA 1NB5A 1X9YA 1QOLA 5JA7A 2HH5A 4WA6A 2HD5A 2PNSA 2BSZA 4P6GA 1EWMA 3IUTA 2FRAA 3O1GA 1CB5A 1F2AA 2DJGB 3IV2A 3RVVA 5EF4A 2G8EA 1CQDA 3LXSA 4YV8A 1EWLA 2DCBA 2E00A 3F5VA 1AYUA 1HUCB 1YK8A 2F7DA 5K16A 4CDEB 3S3RA 1W5RA 3IOQA 1EWOA 3OISA 2FO5A 2VFCA 1MEGA 4MSXA 2E02A 1KHQA 4CZWA 3H8BA 1NL6A 1XKGA 2FT2A 2HHNA 4FIPA 3DF0A 1DEUA 1GECE 2DC8A 4BS5A 4X6JA 3I3TA 4XR7A 2O6XA 2XU1A 3S3QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CDD B;  4QRV A;  1F29 A;  1PXV A;  2R6N A;  1YVB A;  2NQI A;  4X6I A;  2P0R A;  3D6S A;  5CHV A;  1M6D A;  4BPV A;  2AYO A;  3H89 A;  3TNX A;  1EF7 A;  1TU6 A;  4DMY A;  4ZUX U;  3WXE A;  2R9N A;  3NHE A;  2AS8 A;  2AUX A;  2CB5 A;  1AYV A;  5JH3 A;  1U9Q X;  3CH3 X;  3CBK A;  1K3B B;  4MZO A;  3P5U A;  1U9V A;  1QMY A;  3K9M A;  2AYN A;  3HHA A;  4YVA A;  1QXP A;  3PBH A;  1O0E A;  4PAD A;  3QSD A;  4OEM A;  1F2C A;  1ITO A;  1MS6 A;  1GLO A;  3BWK A;  2YJ2 A;  3K8U A;  4G54 A;  2B1N A;  1ZIV A;  3HWN A;  2ATO A;  3KX1 A;  2XU4 A;  1ZCM A;  1CS8 A;  2DC7 A;  4N4Z A;  4KLB A;  1MEM A;  2G6D A;  1KFU L;  3HHI A;  9PAP A;  1AU2 A;  2YJ9 A;  3GCB A;  4K7C A;  4YYV A;  3BOW A;  3OF9 A;  3PNR A;  1A6R A;  4BS6 A;  1BY8 A;  2R9O A;  3WXF A;  1ATK A;  2H7J A;  3H8C A;  2JQF R;  3E1Z B;  3KWB X;  1JQP A;  1EWP A;  1SP4 B;  5EGW A;  1YK7 A;  2E01 A;  3OVX A;  1THE A;  4YYS A;  3BPM A;  1MHW A;  2DZY A;  3OF8 A;  1U5I A;  1MIR A;  4YYR A;  1GCB A;  1CJL A;  3ERV A;  2IBI A;  1KXR A;  2IPP B;  1NLJ A;  4W4U A;  3RVX A;  3P5V A;  5CHT A;  4BSQ A;  1BP4 A;  1SNK A;  2FYE A;  4N79 A;  1CSB B;  3RVW A;  5F02 A;  1PIP A;  1PCI A;  1PPO A;  2OUL A;  3IEJ A;  1CTE A;  1PAD A;  4Q8G A;  4QRX A;  2C0Y A;  2ACT A;  4HWY A;  5J94 A;  4X6H A;  4I07 A;  4YYW A;  1IWD A;  2DC9 A;  1ME4 A;  3U8E A;  3N3K A;  2AUZ A;  3P5W A;  1KHP A;  2PRE A;  3MTN A;  4OEL A;  3KSE A;  2VHF A;  2XU5 A;  1BGO A;  3BPF A;  2DCC A;  2FRQ A;  3K24 A;  3WXG A;  3QJ3 A;  1PPN A;  4I04 A;  3MHH A;  4P6E A;  1FH0 A;  3LFY A;  2P86 A;  1PPD A;  2YJB A;  1YAL A;  2FUD A;  3M99 A;  1PBH A;  1KFX L;  3IMA A;  8PCH A;  1ICF A;  2PAD A;  2FTD A;  3BC3 A;  2YJ8 A;  1QDQ A;  5CVO B;  2R9C A;  3V6C A;  3QT4 A;  3BCN A;  4FJC A;  1NQC A;  2PBH A;  2R9F A;  2AIM A;  4YYQ A;  2B1M A;  3F75 A;  2DC6 A;  1Y08 A;  2DCD A;  3MOR A;  2ARY A;  2YJC A;  3P5X A;  5FPW A;  1DF0 A;  1Y4H A;  4AXM A;  2GHU A;  2R9M A;  2AU1 A;  2CIO A;  7PCK A;  1NB3 A;  6PAD A;  1AU3 A;  1AYW A;  2OZ2 A;  3V6E A;  2G8J A;  2AVW A;  4BQV A;  4AXL A;  1AU4 A;  2JQG R;  2VHS A;  3USV A;  1AIM A;  1PE6 A;  1MDW A;  2E03 A;  4MZS A;  3CH2 X;  1F2B A;  3IHP A;  4DMX A;  4QRG A;  1NPZ A;  3I06 A;  2NQG A;  1TLO A;  1TL9 A;  1VJV A;  2G7Y A;  3HD3 A;  4N8W A;  1CV8 A;  4PP2 E;  1S4V A;  4RY2 A;  2F1G A;  4W5C A;  1GMY A;  2BDZ A;  2XU3 A;  3KW9 A;  3OVZ A;  3N4C A;  4CDF B;  3AI8 A;  4W5B A;  5CVN B;  4QH6 A;  3H7D A;  1U9W A;  2NQD B;  1CPJ A;  4PI3 A;  1VSN A;  2OP3 A;  1POP A;  1STF E;  5PAD A;  1PPP A;  3N3G A;  3H6S A;  4YYU A;  1AU0 A;  2HXZ A;  4PP1 A;  4CDC B;  3MHS A;  1YT7 A;  4XUI A;  3KWZ A;  3O0U A;  3PW3 A;  3C9E A;  2DZZ A;  1CVZ A;  3KKU A;  1AEC A;  3B79 A;  2BDL A;  3ZUA A;  5CVM A;  4I05 A;  4Q8H A;  2FQ9 A;  2NQA A;  5A24 A;  2GFO A;  2WBF X;  1ME3 A;  1Q6K A;  3PDF A;  2Y5B A;  3KFQ A;  4FK5 A;  2DJF B;  2P7U A;  2DCA A;  3CBJ A;  4QBB A;  1BQI A;  2Y6E A;  1U9X A;  1NB5 A;  1X9Y A;  1QOL A;  5JA7 A;  2HH5 A;  4WA6 A;  2HD5 A;  2PNS A;  4P6G A;  1EWM A;  3IUT A;  2FRA A;  3O1G A;  1CB5 A;  1F2A A;  2DJG B;  3IV2 A;  3RVV A;  5EF4 A;  2G8E A;  1CQD A;  3LXS A;  4YV8 A;  1EWL A;  2DCB A;  2E00 A;  3F5V A;  1AYU A;  1HUC B;  1YK8 A;  2F7D A;  5K16 A;  4CDE B;  3S3R A;  3IOQ A;  1EWO A;  3OIS A;  2FO5 A;  1MEG A;  4MSX A;  2E02 A;  1KHQ A;  4CZW A;  3H8B A;  1NL6 A;  1XKG A;  2FT2 A;  2HHN A;  4FIP A;  3DF0 A;  1DEU A;  1GEC E;  2DC8 A;  4BS5 A;  4X6J A;  3I3T A;  4XR7 A;  2O6X A;  2XU1 A;  3S3Q A; 
#chains in the Genus database with same CATH topology
 4CDD B;  4QRV A;  1F29 A;  1PXV A;  2R6N A;  1YVB A;  2NQI A;  4X6I A;  2P0R A;  3D6S A;  5CHV A;  1M6D A;  4BPV A;  2AYO A;  3E9S A;  3H89 A;  1EF7 A;  3TNX A;  1TU6 A;  4DMY A;  3RNV A;  3MP2 A;  5KO3 A;  4ZUX U;  3WXE A;  2R9N A;  3NHE A;  2AS8 A;  4RNA A;  2AUX A;  2CB5 A;  1UKF A;  1AYV A;  5JH3 A;  1U9Q X;  3CH3 X;  3CBK A;  1K3B B;  4MZO A;  3P5U A;  1U9V A;  3B21 A;  4A5U A;  1QMY A;  3K9M A;  2AYN A;  3O65 A;  3HHA A;  4YVA A;  1QXP A;  2BTW B;  3PBH A;  1O0E A;  2Z84 A;  4PAD A;  3QSD A;  4OEM A;  4MI7 A;  1F2C A;  1ITO A;  1MS6 A;  1GLO A;  3BWK A;  2YJ2 A;  3K8U A;  4G54 A;  2B1N A;  1ZIV A;  3HWN A;  4HXD B;  2ATO A;  3KX1 A;  2XU4 A;  1ZCM A;  3PHX A;  1CS8 A;  2DC7 A;  4N4Z A;  4KLB A;  1MEM A;  2G6D A;  1KFU L;  3HHI A;  2BTW A;  9PAP A;  3BB7 A;  1AU2 A;  2YJ9 A;  3GCB A;  5EZS A;  3TRK A;  3PHU A;  4K7C A;  4YYV A;  3BOW A;  3OF9 A;  3PNR A;  1A6R A;  4BS6 A;  1BY8 A;  2R9O A;  1YZB A;  3WXF A;  4OVZ B;  1ATK A;  2H7J A;  3H8C A;  2JQF R;  3E1Z B;  3KWB X;  1JQP A;  1EWP A;  1SP4 B;  5EGW A;  2AGA A;  1YK7 A;  3C0R A;  2E01 A;  3OVX A;  1THE A;  4BOS A;  4YYS A;  3BPM A;  1MHW A;  2DZY A;  3OF8 A;  1U5I A;  1MIR A;  2HWK A;  4YYR A;  1GCB A;  1CJL A;  3ERV A;  4P16 A;  2IBI A;  2DOS A;  4OVZ A;  4BOU A;  1KXR A;  4IP3 A;  2IPP B;  4RKX A;  1NLJ A;  4W4U A;  4ZTB A;  3RVX A;  3P5V A;  5CHT A;  4BSQ A;  1BP4 A;  1SNK A;  2FYE A;  4N79 A;  1CSB B;  3RVW A;  5F02 A;  1PIP A;  1PCI A;  1PPO A;  2OUL A;  3IEJ A;  1CTE A;  1PAD A;  4Q8G A;  4QRX A;  2C0Y A;  2ACT A;  4HWY A;  5J94 A;  4R3D A;  4X6H A;  4I07 A;  4YYW A;  1IWD A;  2DC9 A;  1ME4 A;  3U8E A;  3N3K A;  3PHW A;  2BU3 A;  3BY4 A;  2AUZ A;  3P5W A;  1KHP A;  2PRE A;  3MTN A;  4OEL A;  4M0W A;  3KSE A;  2VHF A;  2XU5 A;  1PVJ A;  4OW0 A;  1BGO A;  3BPF A;  2J7Q A;  2DCC A;  2J7Q C;  2FRQ A;  3K24 A;  3PT2 A;  3WXG A;  3QJ3 A;  1PPN A;  4I04 A;  3MHH A;  4P6E A;  1FH0 A;  3LFY A;  2P86 A;  1PPD A;  2YJB A;  1YAL A;  2FUD A;  3M99 A;  4MM3 B;  1PBH A;  1KFX L;  3IMA A;  8PCH A;  1ICF A;  2PAD A;  2FTD A;  3BC3 A;  3IFU A;  2YJ8 A;  3BBA A;  1QDQ A;  3W30 A;  5CVO B;  4GUA A;  2R9C A;  3V6C A;  3QT4 A;  3BCN A;  4FJC A;  1NQC A;  2PBH A;  3PRP A;  2R9F A;  2AIM A;  4YYQ A;  4RF1 A;  2B1M A;  3F75 A;  2DC6 A;  1Y08 A;  2DCD A;  3MOR A;  2ARY A;  2YJC A;  3P5X A;  5FPW A;  3W31 A;  1DF0 A;  1Y4H A;  4AXM A;  2GHU A;  2R9M A;  2AU1 A;  2CIO A;  3PSE A;  7PCK A;  1NB3 A;  4BOQ A;  6PAD A;  1AU3 A;  1AYW A;  2OZ2 A;  3V6E A;  2G8J A;  3MTV A;  4BOP A;  2AVW A;  4BQV A;  4AXL A;  1AU4 A;  2JQG R;  2VHS A;  5E6J A;  3USV A;  1AIM A;  1PE6 A;  1MDW A;  2FE8 A;  2E03 A;  4MZS A;  3CH2 X;  4IUM A;  1F2B A;  3IHP A;  4DMX A;  4QRG A;  1NPZ A;  3I06 A;  2NQG A;  1TLO A;  1TL9 A;  4RF0 A;  1VJV A;  2G7Y A;  3HD3 A;  4N8W A;  1CV8 A;  4PP2 E;  1S4V A;  4RY2 A;  2F1G A;  4W5C A;  1GMY A;  2BDZ A;  2XU3 A;  3KW9 A;  2JTC A;  3OVZ A;  4D8E A;  2UZJ A;  3N4C A;  4CDF B;  3AI8 A;  4W5B A;  5CVN B;  4QH6 A;  3H7D A;  1U9W A;  2NQD B;  1CPJ A;  4PI3 A;  1VSN A;  2OP3 A;  1POP A;  1STF E;  5PAD A;  1PPP A;  3N3G A;  4D8I A;  3H6S A;  4YYU A;  1AU0 A;  2HXZ A;  4PP1 A;  4CDC B;  3MHS A;  1YT7 A;  4XUI A;  3KWZ A;  4WUR A;  3O0U A;  3PW3 A;  3C9E A;  3MJ5 A;  2DZZ A;  1CVZ A;  3KKU A;  1AEC A;  3B79 A;  2BDL A;  3ZUA A;  5CVM A;  4I05 A;  4Q8H A;  2FQ9 A;  2NQA A;  3PRM A;  5A24 A;  2GFO A;  2WBF X;  1ME3 A;  1Q6K A;  3PDF A;  2Y5B A;  3KFQ A;  4FK5 A;  2DJF B;  4PT5 A;  2P7U A;  2DCA A;  3CBJ A;  4QBB A;  1BQI A;  2Y6E A;  1U9X A;  1NB5 A;  1X9Y A;  1QOL A;  3TMP A;  5JA7 A;  2HH5 A;  4WA6 A;  2HD5 A;  2PNS A;  4P6G A;  2JRI A;  1EWM A;  3IUT A;  3OQC A;  2FRA A;  3O1G A;  1CB5 A;  1F2A A;  2DJG B;  3IV2 A;  4REZ A;  3RVV A;  5EF4 A;  1DKI A;  2G8E A;  1CQD A;  3LXS A;  4YV8 A;  1EWL A;  2DCB A;  2E00 A;  3F5V A;  3ZNH A;  1AYU A;  1HUC B;  1YK8 A;  5EZQ A;  2F7D A;  5K16 A;  4CDE B;  5JZE A;  3S3R A;  3IOQ A;  1EWO A;  3OIS A;  4XZX A;  2FO5 A;  1MEG A;  4MSX A;  4BOZ A;  2E02 A;  1KHQ A;  4CZW A;  3H8B A;  1NL6 A;  1XKG A;  2FT2 A;  2HHN A;  4FIP A;  3DF0 A;  1DEU A;  1GEC E;  2DC8 A;  4BS5 A;  4X6J A;  3I3T A;  4XR7 A;  2O6X A;  2XU1 A;  3S3Q A;  4D8B A; 
#chains in the Genus database with same CATH homology
 4CDD B;  4QRV A;  1F29 A;  1PXV A;  2R6N A;  1YVB A;  2NQI A;  4X6I A;  2P0R A;  3D6S A;  5CHV A;  1M6D A;  4BPV A;  2AYO A;  3H89 A;  3TNX A;  1EF7 A;  1TU6 A;  4DMY A;  4ZUX U;  3WXE A;  2R9N A;  3NHE A;  2AS8 A;  2AUX A;  2CB5 A;  1AYV A;  5JH3 A;  1U9Q X;  3CH3 X;  3CBK A;  1K3B B;  4MZO A;  3P5U A;  1U9V A;  1QMY A;  3K9M A;  2AYN A;  3HHA A;  4YVA A;  1QXP A;  3PBH A;  1O0E A;  1W6F A;  4PAD A;  3QSD A;  4OEM A;  1F2C A;  1ITO A;  1MS6 A;  1GLO A;  3BWK A;  2YJ2 A;  3K8U A;  4G54 A;  2B1N A;  4B55 A;  1ZIV A;  3HWN A;  2ATO A;  3KX1 A;  2XU4 A;  1ZCM A;  4NV7 A;  1CS8 A;  2DC7 A;  4N4Z A;  4KLB A;  1MEM A;  2G6D A;  1KFU L;  4NV8 A;  3HHI A;  9PAP A;  1AU2 A;  2YJ9 A;  3GCB A;  4K7C A;  4YYV A;  3BOW A;  3OF9 A;  3PNR A;  1A6R A;  4BS6 A;  4BGF A;  1BY8 A;  2R9O A;  3WXF A;  1ATK A;  2H7J A;  3H8C A;  2JQF R;  3E1Z B;  3KWB X;  1JQP A;  1EWP A;  1SP4 B;  3D9W A;  5EGW A;  1YK7 A;  2E01 A;  3OVX A;  1THE A;  4YYS A;  3BPM A;  1MHW A;  2DZY A;  3OF8 A;  1U5I A;  1MIR A;  4YYR A;  1GCB A;  1CJL A;  3ERV A;  2IBI A;  1KXR A;  1W4T A;  2IPP B;  1NLJ A;  4W4U A;  3RVX A;  3P5V A;  5CHT A;  4BSQ A;  1BP4 A;  1SNK A;  2FYE A;  2VFB A;  4N79 A;  1CSB B;  3RVW A;  5F02 A;  1PIP A;  1PCI A;  1PPO A;  2OUL A;  3IEJ A;  1CTE A;  1PAD A;  4Q8G A;  4QRX A;  2C0Y A;  2ACT A;  4HWY A;  5J94 A;  4X6H A;  4I07 A;  4YYW A;  1IWD A;  2DC9 A;  1ME4 A;  3U8E A;  3N3K A;  2AUZ A;  3P5W A;  1KHP A;  2PRE A;  3MTN A;  4OEL A;  3KSE A;  2VHF A;  2XU5 A;  1BGO A;  3BPF A;  2DCC A;  2FRQ A;  3K24 A;  3WXG A;  3QJ3 A;  1PPN A;  4I04 A;  3MHH A;  4P6E A;  1FH0 A;  3LFY A;  2P86 A;  1PPD A;  2YJB A;  1YAL A;  2FUD A;  3M99 A;  1PBH A;  1E2T A;  1KFX L;  3IMA A;  8PCH A;  1ICF A;  2PAD A;  2FTD A;  3BC3 A;  2YJ8 A;  1QDQ A;  1GX3 A;  5CVO B;  2R9C A;  3V6C A;  3QT4 A;  3BCN A;  4FJC A;  1NQC A;  2PBH A;  2R9F A;  2AIM A;  4YYQ A;  2B1M A;  3F75 A;  2DC6 A;  1Y08 A;  2DCD A;  3MOR A;  2ARY A;  2YJC A;  3P5X A;  5FPW A;  1DF0 A;  1Y4H A;  4AXM A;  2GHU A;  2R9M A;  2AU1 A;  2CIO A;  7PCK A;  1NB3 A;  6PAD A;  1AU3 A;  1AYW A;  2OZ2 A;  3V6E A;  2G8J A;  2AVW A;  4BQV A;  4AXL A;  1AU4 A;  2JQG R;  2VHS A;  3USV A;  1AIM A;  1PE6 A;  1MDW A;  2E03 A;  4MZS A;  3CH2 X;  1F2B A;  3IHP A;  4DMX A;  4QRG A;  1NPZ A;  3I06 A;  2NQG A;  1TLO A;  1TL9 A;  1VJV A;  2G7Y A;  3HD3 A;  4N8W A;  1CV8 A;  4PP2 E;  1S4V A;  4RY2 A;  2F1G A;  4W5C A;  1GMY A;  2BDZ A;  2XU3 A;  3KW9 A;  3OVZ A;  3N4C A;  4CDF B;  3AI8 A;  4W5B A;  5CVN B;  4QH6 A;  3H7D A;  1U9W A;  2NQD B;  1CPJ A;  4PI3 A;  1VSN A;  2OP3 A;  1POP A;  1STF E;  5PAD A;  1PPP A;  3N3G A;  3H6S A;  4YYU A;  1AU0 A;  2HXZ A;  4PP1 A;  4CDC B;  3MHS A;  1YT7 A;  4XUI A;  3KWZ A;  3O0U A;  3PW3 A;  3C9E A;  2DZZ A;  1CVZ A;  3KKU A;  1AEC A;  3LTW A;  3B79 A;  2BDL A;  3ZUA A;  5CVM A;  4I05 A;  4Q8H A;  2FQ9 A;  2NQA A;  5A24 A;  2GFO A;  2WBF X;  1ME3 A;  4GUZ A;  1Q6K A;  3PDF A;  2Y5B A;  3KFQ A;  4FK5 A;  2DJF B;  4C5P A;  2P7U A;  2DCA A;  3CBJ A;  4QBB A;  1BQI A;  2Y6E A;  1U9X A;  1NB5 A;  1X9Y A;  1QOL A;  5JA7 A;  2HH5 A;  4WA6 A;  2HD5 A;  2PNS A;  2BSZ A;  4P6G A;  1EWM A;  3IUT A;  2FRA A;  3O1G A;  1CB5 A;  1F2A A;  2DJG B;  3IV2 A;  3RVV A;  5EF4 A;  2G8E A;  1CQD A;  3LXS A;  4YV8 A;  1EWL A;  2DCB A;  2E00 A;  3F5V A;  1AYU A;  1HUC B;  1YK8 A;  2F7D A;  5K16 A;  4CDE B;  3S3R A;  1W5R A;  3IOQ A;  1EWO A;  3OIS A;  2FO5 A;  2VFC A;  1MEG A;  4MSX A;  2E02 A;  1KHQ A;  4CZW A;  3H8B A;  1NL6 A;  1XKG A;  2FT2 A;  2HHN A;  4FIP A;  3DF0 A;  1DEU A;  1GEC E;  2DC8 A;  4BS5 A;  4X6J A;  3I3T A;  4XR7 A;  2O6X A;  2XU1 A;  3S3Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...