2PREA

Crystal structure of plant cysteine protease ervatamin-c complexed with irreversible inhibitor e-64 at 2.7 a resolution
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
208
structure length
208
Chain Sequence
LPEQIDWRKKGAVTPVKNQGKCGSCWAFSTVSTVESINQIRTGNLISLSEQQLVDCNKKNHGCKGGAFVYAYQYIIDNGGIDTEANYPYKAVQGPCRAAKKVVRIDGYKGVPHCNENALKKAVASQPSVVAIDASSKQFQHYKSGIFSGPCGTKLNHGVVIVGYWKDYWIVRNSWGRYWGEQGYIRMKRVGGCGLCGIARLPYYPTKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the substrate specificity and activity of ervatamins, the papain-like cysteine proteases from a tropical plant, Ervatamia coronaria.
pubmed doi rcsb
molecule keywords Ervatamin-C
molecule tags Hydrolase
total genus 62
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 3.4.22.-:
pdb deposition date 2007-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2preA00
4PP1A 4PADA 3I06A 2FYEA 1NLJA 4OELA 5J94A 1ITOA 2E00A 1MDWA 1KHPA 2YJ9A 2P86A 3HHIA 1AYUA 2O6XA 2NQAA 1NPZA 1YK7A 1O0EA 1PPDA 1YALA 3F5VA 3KSEA 1AYWA 9PAPA 1EWOA 3H6SA 3OVZA 3NHEA 1EF7A 2DJGB 1VSNA 4W5BA 2C0YA 1NB5A 3O1GA 2HD5A 4BPVA 3P5XA 3WXEA 4QRVA 2E02A 3QJ3A 3WXFA 1AYVA 3OF9A 4KLBA 3MTNA 2ARYA 1ATKA 2XU1A 1PE6A 2PBHA 4P6EA 1HUCB 1GECE 3BCNA 2B1NA 4QRXA 5JA7A 3LFYA 5EGWA 2PREA 3IMAA 3HHAA 1CS8A 3KKUA 1CPJA 1MS6A 1KHQA 1AU3A 3S3QA 2HHNA 3MHHA 2VHFA 2DZZA 1U9XA 1F2BA 1S4VA 4BSQA 1STFE 2DC9A 2DCBA 1THEA 3P5VA 4WA6A 4W4UA 5CVNB 1MEGA 2PADA 4MZOA 2G8EA 1F2AA 2AYNA 1JQPA 1U5IA 4CDEB 3TNXA 4BS5A 4X6IA 2FT2A 2PNSA 1GCBA 5CHTA 1AU4A 1ME4A 2AS8A 4OEMA 3KX1A 1CQDA 2R9NA 2E01A 3IEJA 5K16A 3IHPA 1GLOA 4P6GA 1F29A 2R9MA 4YV8A 4FIPA 2GFOA 2F7DA 4CDCB 2Y5BA 1PPPA 2OP3A 3P5UA 1ZCMA 1CTEA 3H89A 3S3RA 1BQIA 1PBHA 1YK8A 1SP4B 1ZIVA 5CVOB 3KFQA 3U8EA 5F02A 3QSDA 1BP4A 6PADA 4QH6A 4I05A 3CBKA 1TLOA 1KFXL 4N8WA 1PPOA 3HD3A 3CH3X 2AIMA 8PCHA 2AU1A 3PDFA 2R6NA 3LXSA 1ICFA 2BDZA 4BQVA 4XUIA 5A24A 2NQDB 4PP2E 4PI3A 4XR7A 3USVA 4YYVA 1PXVA 3V6CA 2P7UA 3BOWA 1Y08A 4YVAA 1K3BB 3K9MA 4QRGA 3IUTA 1DEUA 3V6EA 1YVBA 1MIRA 1EWPA 3K8UA 2FTDA 2YJBA 3MORA 3C9EA 3OISA 2YJCA 2B1MA 2R9CA 2DC8A 1QDQA 4CDDB 2NQIA 2P0RA 1TL9A 1PADA 2JQFR 3E1ZB 2FUDA 3I3TA 2OZ2A 2XU5A 2F1GA 4I04A 3H8CA 3BC3A 2R9FA 4YYUA 3OF8A 2DC7A 4DMXA 2DZYA 1KXRA 3D6SA 2FO5A 1TU6A 2FQ9A 2IPPB 3BWKA 3N3GA 1EWLA 4X6HA 3GCBA 4YYSA 1NB3A 1CV8A 1XKGA 4N79A 4FK5A 5CVMA 4Q8HA 1EWMA 1Y4HA 4DMYA 4AXMA 1PIPA 4ZUXU 1U9WA 4HWYA 4N4ZA 2ATOA 3WXGA 1QMYA 1CB5A 1CJLA 3MHSA 2DCDA 2H7JA 2DCCA 3KWZA 1SNKA 2R9OA 4K7CA 2HH5A 3K24A 3IV2A 3CBJA 1NL6A 3H8BA 3RVWA 2AVWA 3B79A 4YYRA 3P5WA 2AUZA 3BPFA 4CDFB 5FPWA 2FRAA 2ACTA 2AYOA 1F2CA 2OULA 4W5CA 1KFUL 1MEMA 3KW9A 4MZSA 2G6DA 3ERVA 3PNRA 4I07A 1YT7A 2VHSA 3M99A 4Q8GA 1AU2A 1Q6KA 5JH3A 2JQGR 1U9VA 3OVXA 1BY8A 2WBFX 2YJ2A 3O0UA 2NQGA 3N3KA 7PCKA 3DF0A 4FJCA 2YJ8A 2XU3A 2DJFB 3PBHA 3PW3A 2HXZA 3BPMA 1VJVA 1NQCA 5PADA 5CHVA 2IBIA 2Y6EA 3AI8A 1FH0A 1GMYA 3RVXA 1BGOA 3HWNA 1DF0A 1ME3A 1AECA 4CZWA 1IWDA 2BDLA 3F75A 4G54A 2G7YA 2E03A 4MSXA 1AIMA 4YYQA 1CVZA 3RVVA 1CSBB 2DC6A 2XU4A 2G8JA 2CB5A 1M6DA 3N4CA 4BS6A 1POPA 5EF4A 1A6RA 2CIOA 2AUXA 3KWBX 4QBBA 1MHWA 1QOLA 3IOQA 1PCIA 1U9QX 2FRQA 3H7DA 4RY2A 1AU0A 4YYWA 2GHUA 1PPNA 2DCAA 4AXLA 3ZUAA 3CH2X 1X9YA 3QT4A 4X6JA 1QXPA
chains in the Genus database with same CATH superfamily
4PP1A 4PADA 3I06A 2FYEA 4BOUA 1NLJA 4OELA 2UZJA 5J94A 2FE8A 1ITOA 2E00A 1MDWA 1KHPA 2YJ9A 2P86A 3HHIA 1AYUA 2O6XA 2NQAA 1NPZA 1YK7A 1O0EA 1PPDA 2Z84A 1YALA 3F5VA 3KSEA 1AYWA 9PAPA 1EWOA 3H6SA 3OVZA 3NHEA 1EF7A 2DJGB 1VSNA 4W5BA 2C0YA 1NB5A 3O1GA 2HD5A 4BPVA 3P5XA 3WXEA 4D8BA 4QRVA 2E02A 3QJ3A 4OVZA 3WXFA 1AYVA 3OF9A 4KLBA 3BY4A 3MTNA 2ARYA 1ATKA 2XU1A 4GUAA 1PE6A 2PBHA 4P6EA 1HUCB 1GECE 3BCNA 2B1NA 4QRXA 5JA7A 3LFYA 5EGWA 2PREA 3IMAA 3HHAA 1CS8A 5JZEA 3KKUA 1CPJA 3IFUA 4OVZB 1MS6A 1KHQA 4RF0A 1AU3A 3S3QA 2HHNA 3MHHA 2VHFA 2DZZA 1U9XA 4BOZA 1F2BA 1S4VA 4BSQA 1STFE 4REZA 2DC9A 2DCBA 2BU3A 1THEA 3P5VA 4HXDB 4WA6A 4W4UA 5CVNB 1MEGA 2PADA 4MZOA 2J7QC 4P16A 4M0WA 2G8EA 1F2AA 2AYNA 1JQPA 1U5IA 4CDEB 3TNXA 4BS5A 4X6IA 2FT2A 2PNSA 1GCBA 3TMPA 5CHTA 3PRMA 2HWKA 1AU4A 1ME4A 2AS8A 4BOQA 4OEMA 3KX1A 1CQDA 2R9NA 2E01A 3IEJA 5K16A 3IHPA 1GLOA 4R3DA 4P6GA 1F29A 2R9MA 4YV8A 4FIPA 2GFOA 2F7DA 4CDCB 2Y5BA 1PPPA 2OP3A 3P5UA 1ZCMA 1CTEA 3H89A 3S3RA 1BQIA 4BOPA 1PBHA 1YK8A 1SP4B 1ZIVA 5CVOB 4D8IA 3KFQA 3U8EA 2BTWA 5F02A 3QSDA 1BP4A 6PADA 3PT2A 4QH6A 4IP3A 4I05A 3CBKA 4XZXA 1TLOA 1KFXL 4N8WA 1PPOA 3HD3A 3RNVA 3CH3X 2AIMA 8PCHA 2AU1A 3PDFA 2JTCA 2R6NA 3LXSA 1ICFA 2BDZA 3BB7A 3TRKA 4BQVA 4XUIA 5A24A 2NQDB 4PP2E 3PSEA 4PI3A 4XR7A 3USVA 4YYVA 4OW0A 1PXVA 2BTWB 2P7UA 3V6CA 3BOWA 1Y08A 3C0RA 3ZNHA 4YVAA 1K3BB 3K9MA 4QRGA 3IUTA 4A5UA 1DEUA 3V6EA 5KO3A 1YVBA 1MIRA 5EZQA 1EWPA 1UKFA 3K8UA 2FTDA 2YJBA 3MORA 4RNAA 3C9EA 3OISA 2YJCA 2B1MA 2R9CA 2DC8A 1QDQA 4CDDB 5EZSA 2NQIA 2P0RA 1TL9A 1PADA 2JQFR 3E1ZB 2FUDA 3I3TA 2OZ2A 4MM3B 2XU5A 2F1GA 4I04A 3H8CA 3BC3A 2R9FA 4YYUA 3PRPA 3OF8A 2DC7A 4DMXA 2DZYA 1KXRA 3D6SA 2FO5A 1TU6A 2FQ9A 2IPPB 3BWKA 3N3GA 1EWLA 3E9SA 4X6HA 3GCBA 4YYSA 1NB3A 1CV8A 1XKGA 4N79A 4FK5A 5CVMA 4Q8HA 1EWMA 1Y4HA 4DMYA 4AXMA 3MTVA 1PIPA 4ZUXU 1U9WA 4HWYA 4N4ZA 2ATOA 3WXGA 1QMYA 4RF1A 1CB5A 1CJLA 2AGAA 3MHSA 2DCDA 2H7JA 3OQCA 2DCCA 3KWZA 1SNKA 2R9OA 4K7CA 2HH5A 1PVJA 3K24A 3IV2A 3CBJA 1NL6A 3H8BA 3MJ5A 3RVWA 2AVWA 3B79A 4YYRA 3P5WA 2AUZA 3BPFA 4CDFB 3BBAA 1DKIA 5FPWA 2FRAA 2ACTA 2AYOA 1F2CA 2OULA 4W5CA 1KFUL 1MEMA 3KW9A 4MZSA 2G6DA 3ERVA 3PNRA 1YZBA 4I07A 1YT7A 3O65A 2VHSA 3M99A 2DOSA 4Q8GA 1AU2A 1Q6KA 5JH3A 2JQGR 1U9VA 3OVXA 1BY8A 2WBFX 2YJ2A 3O0UA 2NQGA 3N3KA 7PCKA 4IUMA 3PHXA 3DF0A 4FJCA 2YJ8A 2XU3A 2DJFB 2J7QA 3PBHA 3PW3A 2HXZA 3BPMA 1VJVA 2JRIA 1NQCA 5PADA 5CHVA 2IBIA 2Y6EA 3AI8A 1FH0A 1GMYA 3RVXA 1BGOA 3HWNA 5E6JA 1DF0A 4RKXA 1ME3A 4WURA 1AECA 4CZWA 1IWDA 2BDLA 3F75A 4G54A 2G7YA 3PHWA 2E03A 4MSXA 1AIMA 4PT5A 4D8EA 4YYQA 1CVZA 4MI7A 4BOSA 3RVVA 1CSBB 2DC6A 2XU4A 2G8JA 2CB5A 1M6DA 4ZTBA 3N4CA 3W30A 3MP2A 4BS6A 1POPA 5EF4A 1A6RA 2CIOA 2AUXA 3W31A 3KWBX 4QBBA 1MHWA 1QOLA 3IOQA 1PCIA 3H7DA 1U9QX 2FRQA 4RY2A 1AU0A 4YYWA 2GHUA 1PPNA 2DCAA 3B21A 4AXLA 3PHUA 3ZUAA 3CH2X 1X9YA 3QT4A 4X6JA 1QXPA
chains in the Genus database with same CATH topology
4PP1A 4PADA 3I06A 2FYEA 1NLJA 4OELA 5J94A 1ITOA 2E00A 1MDWA 1KHPA 2YJ9A 2P86A 3HHIA 1AYUA 2O6XA 3LTWA 2NQAA 1NPZA 1YK7A 4NV8A 1O0EA 1PPDA 1YALA 3F5VA 3KSEA 1AYWA 4BGFA 9PAPA 1EWOA 3H6SA 3OVZA 3NHEA 1EF7A 2DJGB 1VSNA 4W5BA 2C0YA 1NB5A 3O1GA 2HD5A 4BPVA 3P5XA 3WXEA 4QRVA 2E02A 3QJ3A 3D9WA 4B55A 2BSZA 3WXFA 1AYVA 3OF9A 4KLBA 3MTNA 2ARYA 1ATKA 2XU1A 1PE6A 2PBHA 4P6EA 1HUCB 1GECE 3BCNA 2B1NA 4QRXA 5JA7A 3LFYA 5EGWA 2PREA 3IMAA 3HHAA 1CS8A 3KKUA 1CPJA 1MS6A 1KHQA 1AU3A 3S3QA 1W4TA 2HHNA 4GUZA 3MHHA 2VHFA 2DZZA 1U9XA 1F2BA 1S4VA 4BSQA 1STFE 2DC9A 2DCBA 1THEA 3P5VA 4WA6A 4W4UA 5CVNB 1MEGA 2PADA 4MZOA 2G8EA 1F2AA 2AYNA 1JQPA 1U5IA 4CDEB 3TNXA 4BS5A 4X6IA 2FT2A 2PNSA 1GCBA 5CHTA 1AU4A 1ME4A 2AS8A 4OEMA 3KX1A 1CQDA 2R9NA 2E01A 3IEJA 5K16A 3IHPA 1GLOA 4P6GA 1F29A 2R9MA 4YV8A 4FIPA 2GFOA 2F7DA 4CDCB 2Y5BA 1PPPA 2OP3A 3P5UA 2VFBA 1ZCMA 1CTEA 3H89A 3S3RA 1BQIA 1PBHA 1YK8A 1SP4B 1ZIVA 5CVOB 3KFQA 3U8EA 5F02A 3QSDA 1BP4A 6PADA 4QH6A 4I05A 3CBKA 1TLOA 2VFCA 1KFXL 4N8WA 1PPOA 3HD3A 3CH3X 2AIMA 8PCHA 2AU1A 3PDFA 2R6NA 3LXSA 1ICFA 2BDZA 4BQVA 1W5RA 4XUIA 5A24A 2NQDB 4PP2E 4PI3A 4XR7A 3USVA 4YYVA 1PXVA 3V6CA 2P7UA 3BOWA 1Y08A 4YVAA 1K3BB 3K9MA 4QRGA 3IUTA 1DEUA 3V6EA 1YVBA 1MIRA 1EWPA 3K8UA 2FTDA 2YJBA 3MORA 3C9EA 3OISA 2YJCA 2B1MA 2R9CA 2DC8A 1QDQA 4CDDB 2NQIA 2P0RA 1TL9A 1PADA 2JQFR 3E1ZB 2FUDA 3I3TA 2OZ2A 2XU5A 2F1GA 4I04A 3H8CA 4C5PA 3BC3A 2R9FA 4YYUA 1E2TA 3OF8A 2DC7A 4DMXA 2DZYA 1KXRA 3D6SA 2FO5A 1TU6A 2FQ9A 2IPPB 3BWKA 3N3GA 1EWLA 4X6HA 3GCBA 4YYSA 1NB3A 1CV8A 1XKGA 4N79A 4FK5A 5CVMA 4Q8HA 1EWMA 1GX3A 1Y4HA 4DMYA 4AXMA 1PIPA 4ZUXU 1U9WA 4HWYA 4N4ZA 1W6FA 2ATOA 3WXGA 1QMYA 1CB5A 1CJLA 3MHSA 2DCDA 2H7JA 2DCCA 3KWZA 1SNKA 2R9OA 4K7CA 2HH5A 3K24A 3IV2A 3CBJA 1NL6A 3H8BA 3RVWA 2AVWA 3B79A 4YYRA 3P5WA 2AUZA 3BPFA 4CDFB 4NV7A 5FPWA 2FRAA 2ACTA 2AYOA 1F2CA 2OULA 4W5CA 1KFUL 1MEMA 3KW9A 4MZSA 2G6DA 3ERVA 3PNRA 4I07A 1YT7A 2VHSA 3M99A 4Q8GA 1AU2A 1Q6KA 5JH3A 2JQGR 1U9VA 3OVXA 1BY8A 2WBFX 2YJ2A 3O0UA 2NQGA 3N3KA 7PCKA 3DF0A 4FJCA 2YJ8A 2XU3A 2DJFB 3PBHA 3PW3A 2HXZA 3BPMA 1VJVA 1NQCA 5PADA 5CHVA 2IBIA 2Y6EA 3AI8A 1FH0A 1GMYA 3RVXA 1BGOA 3HWNA 1DF0A 1ME3A 1AECA 4CZWA 1IWDA 2BDLA 3F75A 4G54A 2G7YA 2E03A 4MSXA 1AIMA 4YYQA 1CVZA 3RVVA 1CSBB 2DC6A 2XU4A 2G8JA 2CB5A 1M6DA 3N4CA 4BS6A 1POPA 5EF4A 1A6RA 2CIOA 2AUXA 3KWBX 4QBBA 1MHWA 1QOLA 3IOQA 1PCIA 1U9QX 2FRQA 3H7DA 4RY2A 1AU0A 4YYWA 2GHUA 1PPNA 2DCAA 4AXLA 3ZUAA 3CH2X 1X9YA 3QT4A 4X6JA 1QXPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PP1 A;  4PAD A;  3I06 A;  2FYE A;  1NLJ A;  4OEL A;  5J94 A;  1ITO A;  2E00 A;  1MDW A;  1KHP A;  2YJ9 A;  2P86 A;  3HHI A;  1AYU A;  2O6X A;  2NQA A;  1NPZ A;  1YK7 A;  1O0E A;  1PPD A;  1YAL A;  3F5V A;  3KSE A;  1AYW A;  9PAP A;  1EWO A;  3H6S A;  3OVZ A;  3NHE A;  1EF7 A;  2DJG B;  1VSN A;  4W5B A;  2C0Y A;  1NB5 A;  3O1G A;  2HD5 A;  4BPV A;  3P5X A;  3WXE A;  4QRV A;  2E02 A;  3QJ3 A;  3WXF A;  1AYV A;  3OF9 A;  4KLB A;  3MTN A;  2ARY A;  1ATK A;  2XU1 A;  1PE6 A;  2PBH A;  4P6E A;  1HUC B;  1GEC E;  3BCN A;  2B1N A;  4QRX A;  5JA7 A;  3LFY A;  5EGW A;  2PRE A;  3IMA A;  3HHA A;  1CS8 A;  3KKU A;  1CPJ A;  1MS6 A;  1KHQ A;  1AU3 A;  3S3Q A;  2HHN A;  3MHH A;  2VHF A;  2DZZ A;  1U9X A;  1F2B A;  1S4V A;  4BSQ A;  1STF E;  2DC9 A;  2DCB A;  1THE A;  3P5V A;  4WA6 A;  4W4U A;  5CVN B;  1MEG A;  2PAD A;  4MZO A;  2G8E A;  1F2A A;  2AYN A;  1JQP A;  1U5I A;  4CDE B;  3TNX A;  4BS5 A;  4X6I A;  2FT2 A;  2PNS A;  1GCB A;  5CHT A;  1AU4 A;  1ME4 A;  2AS8 A;  4OEM A;  3KX1 A;  1CQD A;  2R9N A;  2E01 A;  3IEJ A;  5K16 A;  3IHP A;  1GLO A;  4P6G A;  1F29 A;  2R9M A;  4YV8 A;  4FIP A;  2GFO A;  2F7D A;  4CDC B;  2Y5B A;  1PPP A;  2OP3 A;  3P5U A;  1ZCM A;  1CTE A;  3H89 A;  3S3R A;  1BQI A;  1PBH A;  1YK8 A;  1SP4 B;  1ZIV A;  5CVO B;  3KFQ A;  3U8E A;  5F02 A;  3QSD A;  1BP4 A;  6PAD A;  4QH6 A;  4I05 A;  3CBK A;  1TLO A;  1KFX L;  4N8W A;  1PPO A;  3HD3 A;  3CH3 X;  2AIM A;  8PCH A;  2AU1 A;  3PDF A;  2R6N A;  3LXS A;  1ICF A;  2BDZ A;  4BQV A;  4XUI A;  5A24 A;  2NQD B;  4PP2 E;  4PI3 A;  4XR7 A;  3USV A;  4YYV A;  1PXV A;  3V6C A;  2P7U A;  3BOW A;  1Y08 A;  4YVA A;  1K3B B;  3K9M A;  4QRG A;  3IUT A;  1DEU A;  3V6E A;  1YVB A;  1MIR A;  1EWP A;  3K8U A;  2FTD A;  2YJB A;  3MOR A;  3C9E A;  3OIS A;  2YJC A;  2B1M A;  2R9C A;  2DC8 A;  1QDQ A;  4CDD B;  2NQI A;  2P0R A;  1TL9 A;  1PAD A;  2JQF R;  3E1Z B;  2FUD A;  3I3T A;  2OZ2 A;  2XU5 A;  2F1G A;  4I04 A;  3H8C A;  3BC3 A;  2R9F A;  4YYU A;  3OF8 A;  2DC7 A;  4DMX A;  2DZY A;  1KXR A;  3D6S A;  2FO5 A;  1TU6 A;  2FQ9 A;  2IPP B;  3BWK A;  3N3G A;  1EWL A;  4X6H A;  3GCB A;  4YYS A;  1NB3 A;  1CV8 A;  1XKG A;  4N79 A;  4FK5 A;  5CVM A;  4Q8H A;  1EWM A;  1Y4H A;  4DMY A;  4AXM A;  1PIP A;  4ZUX U;  1U9W A;  4HWY A;  4N4Z A;  2ATO A;  3WXG A;  1QMY A;  1CB5 A;  1CJL A;  3MHS A;  2DCD A;  2H7J A;  2DCC A;  3KWZ A;  1SNK A;  2R9O A;  4K7C A;  2HH5 A;  3K24 A;  3IV2 A;  3CBJ A;  1NL6 A;  3H8B A;  3RVW A;  2AVW A;  3B79 A;  4YYR A;  3P5W A;  2AUZ A;  3BPF A;  4CDF B;  5FPW A;  2FRA A;  2ACT A;  2AYO A;  1F2C A;  2OUL A;  4W5C A;  1KFU L;  1MEM A;  3KW9 A;  4MZS A;  2G6D A;  3ERV A;  3PNR A;  4I07 A;  1YT7 A;  2VHS A;  3M99 A;  4Q8G A;  1AU2 A;  1Q6K A;  5JH3 A;  2JQG R;  1U9V A;  3OVX A;  1BY8 A;  2WBF X;  2YJ2 A;  3O0U A;  2NQG A;  3N3K A;  7PCK A;  3DF0 A;  4FJC A;  2YJ8 A;  2XU3 A;  2DJF B;  3PBH A;  3PW3 A;  2HXZ A;  3BPM A;  1VJV A;  1NQC A;  5PAD A;  5CHV A;  2IBI A;  2Y6E A;  3AI8 A;  1FH0 A;  1GMY A;  3RVX A;  1BGO A;  3HWN A;  1DF0 A;  1ME3 A;  1AEC A;  4CZW A;  1IWD A;  2BDL A;  3F75 A;  4G54 A;  2G7Y A;  2E03 A;  4MSX A;  1AIM A;  4YYQ A;  1CVZ A;  3RVV A;  1CSB B;  2DC6 A;  2XU4 A;  2G8J A;  2CB5 A;  1M6D A;  3N4C A;  4BS6 A;  1POP A;  5EF4 A;  1A6R A;  2CIO A;  2AUX A;  3KWB X;  4QBB A;  1MHW A;  1QOL A;  3IOQ A;  1PCI A;  1U9Q X;  2FRQ A;  3H7D A;  4RY2 A;  1AU0 A;  4YYW A;  2GHU A;  1PPN A;  2DCA A;  4AXL A;  3ZUA A;  3CH2 X;  1X9Y A;  3QT4 A;  4X6J A;  1QXP A; 
#chains in the Genus database with same CATH topology
 4PP1 A;  4PAD A;  3I06 A;  2FYE A;  4BOU A;  1NLJ A;  4OEL A;  2UZJ A;  5J94 A;  2FE8 A;  1ITO A;  2E00 A;  1MDW A;  1KHP A;  2YJ9 A;  2P86 A;  3HHI A;  1AYU A;  2O6X A;  2NQA A;  1NPZ A;  1YK7 A;  1O0E A;  1PPD A;  2Z84 A;  1YAL A;  3F5V A;  3KSE A;  1AYW A;  9PAP A;  1EWO A;  3H6S A;  3OVZ A;  3NHE A;  1EF7 A;  2DJG B;  1VSN A;  4W5B A;  2C0Y A;  1NB5 A;  3O1G A;  2HD5 A;  4BPV A;  3P5X A;  3WXE A;  4D8B A;  4QRV A;  2E02 A;  3QJ3 A;  4OVZ A;  3WXF A;  1AYV A;  3OF9 A;  4KLB A;  3BY4 A;  3MTN A;  2ARY A;  1ATK A;  2XU1 A;  4GUA A;  1PE6 A;  2PBH A;  4P6E A;  1HUC B;  1GEC E;  3BCN A;  2B1N A;  4QRX A;  5JA7 A;  3LFY A;  5EGW A;  2PRE A;  3IMA A;  3HHA A;  1CS8 A;  5JZE A;  3KKU A;  1CPJ A;  3IFU A;  4OVZ B;  1MS6 A;  1KHQ A;  4RF0 A;  1AU3 A;  3S3Q A;  2HHN A;  3MHH A;  2VHF A;  2DZZ A;  1U9X A;  4BOZ A;  1F2B A;  1S4V A;  4BSQ A;  1STF E;  4REZ A;  2DC9 A;  2DCB A;  2BU3 A;  1THE A;  3P5V A;  4HXD B;  4WA6 A;  4W4U A;  5CVN B;  1MEG A;  2PAD A;  4MZO A;  2J7Q C;  4P16 A;  4M0W A;  2G8E A;  1F2A A;  2AYN A;  1JQP A;  1U5I A;  4CDE B;  3TNX A;  4BS5 A;  4X6I A;  2FT2 A;  2PNS A;  1GCB A;  3TMP A;  5CHT A;  3PRM A;  2HWK A;  1AU4 A;  1ME4 A;  2AS8 A;  4BOQ A;  4OEM A;  3KX1 A;  1CQD A;  2R9N A;  2E01 A;  3IEJ A;  5K16 A;  3IHP A;  1GLO A;  4R3D A;  4P6G A;  1F29 A;  2R9M A;  4YV8 A;  4FIP A;  2GFO A;  2F7D A;  4CDC B;  2Y5B A;  1PPP A;  2OP3 A;  3P5U A;  1ZCM A;  1CTE A;  3H89 A;  3S3R A;  1BQI A;  4BOP A;  1PBH A;  1YK8 A;  1SP4 B;  1ZIV A;  5CVO B;  4D8I A;  3KFQ A;  3U8E A;  2BTW A;  5F02 A;  3QSD A;  1BP4 A;  6PAD A;  3PT2 A;  4QH6 A;  4IP3 A;  4I05 A;  3CBK A;  4XZX A;  1TLO A;  1KFX L;  4N8W A;  1PPO A;  3HD3 A;  3RNV A;  3CH3 X;  2AIM A;  8PCH A;  2AU1 A;  3PDF A;  2JTC A;  2R6N A;  3LXS A;  1ICF A;  2BDZ A;  3BB7 A;  3TRK A;  4BQV A;  4XUI A;  5A24 A;  2NQD B;  4PP2 E;  3PSE A;  4PI3 A;  4XR7 A;  3USV A;  4YYV A;  4OW0 A;  1PXV A;  2BTW B;  2P7U A;  3V6C A;  3BOW A;  1Y08 A;  3C0R A;  3ZNH A;  4YVA A;  1K3B B;  3K9M A;  4QRG A;  3IUT A;  4A5U A;  1DEU A;  3V6E A;  5KO3 A;  1YVB A;  1MIR A;  5EZQ A;  1EWP A;  1UKF A;  3K8U A;  2FTD A;  2YJB A;  3MOR A;  4RNA A;  3C9E A;  3OIS A;  2YJC A;  2B1M A;  2R9C A;  2DC8 A;  1QDQ A;  4CDD B;  5EZS A;  2NQI A;  2P0R A;  1TL9 A;  1PAD A;  2JQF R;  3E1Z B;  2FUD A;  3I3T A;  2OZ2 A;  4MM3 B;  2XU5 A;  2F1G A;  4I04 A;  3H8C A;  3BC3 A;  2R9F A;  4YYU A;  3PRP A;  3OF8 A;  2DC7 A;  4DMX A;  2DZY A;  1KXR A;  3D6S A;  2FO5 A;  1TU6 A;  2FQ9 A;  2IPP B;  3BWK A;  3N3G A;  1EWL A;  3E9S A;  4X6H A;  3GCB A;  4YYS A;  1NB3 A;  1CV8 A;  1XKG A;  4N79 A;  4FK5 A;  5CVM A;  4Q8H A;  1EWM A;  1Y4H A;  4DMY A;  4AXM A;  3MTV A;  1PIP A;  4ZUX U;  1U9W A;  4HWY A;  4N4Z A;  2ATO A;  3WXG A;  1QMY A;  4RF1 A;  1CB5 A;  1CJL A;  2AGA A;  3MHS A;  2DCD A;  2H7J A;  3OQC A;  2DCC A;  3KWZ A;  1SNK A;  2R9O A;  4K7C A;  2HH5 A;  1PVJ A;  3K24 A;  3IV2 A;  3CBJ A;  1NL6 A;  3H8B A;  3MJ5 A;  3RVW A;  2AVW A;  3B79 A;  4YYR A;  3P5W A;  2AUZ A;  3BPF A;  4CDF B;  3BBA A;  1DKI A;  5FPW A;  2FRA A;  2ACT A;  2AYO A;  1F2C A;  2OUL A;  4W5C A;  1KFU L;  1MEM A;  3KW9 A;  4MZS A;  2G6D A;  3ERV A;  3PNR A;  1YZB A;  4I07 A;  1YT7 A;  3O65 A;  2VHS A;  3M99 A;  2DOS A;  4Q8G A;  1AU2 A;  1Q6K A;  5JH3 A;  2JQG R;  1U9V A;  3OVX A;  1BY8 A;  2WBF X;  2YJ2 A;  3O0U A;  2NQG A;  3N3K A;  7PCK A;  4IUM A;  3PHX A;  3DF0 A;  4FJC A;  2YJ8 A;  2XU3 A;  2DJF B;  2J7Q A;  3PBH A;  3PW3 A;  2HXZ A;  3BPM A;  1VJV A;  2JRI A;  1NQC A;  5PAD A;  5CHV A;  2IBI A;  2Y6E A;  3AI8 A;  1FH0 A;  1GMY A;  3RVX A;  1BGO A;  3HWN A;  5E6J A;  1DF0 A;  4RKX A;  1ME3 A;  4WUR A;  1AEC A;  4CZW A;  1IWD A;  2BDL A;  3F75 A;  4G54 A;  2G7Y A;  3PHW A;  2E03 A;  4MSX A;  1AIM A;  4PT5 A;  4D8E A;  4YYQ A;  1CVZ A;  4MI7 A;  4BOS A;  3RVV A;  1CSB B;  2DC6 A;  2XU4 A;  2G8J A;  2CB5 A;  1M6D A;  4ZTB A;  3N4C A;  3W30 A;  3MP2 A;  4BS6 A;  1POP A;  5EF4 A;  1A6R A;  2CIO A;  2AUX A;  3W31 A;  3KWB X;  4QBB A;  1MHW A;  1QOL A;  3IOQ A;  1PCI A;  3H7D A;  1U9Q X;  2FRQ A;  4RY2 A;  1AU0 A;  4YYW A;  2GHU A;  1PPN A;  2DCA A;  3B21 A;  4AXL A;  3PHU A;  3ZUA A;  3CH2 X;  1X9Y A;  3QT4 A;  4X6J A;  1QXP A; 
#chains in the Genus database with same CATH homology
 4PP1 A;  4PAD A;  3I06 A;  2FYE A;  1NLJ A;  4OEL A;  5J94 A;  1ITO A;  2E00 A;  1MDW A;  1KHP A;  2YJ9 A;  2P86 A;  3HHI A;  1AYU A;  2O6X A;  3LTW A;  2NQA A;  1NPZ A;  1YK7 A;  4NV8 A;  1O0E A;  1PPD A;  1YAL A;  3F5V A;  3KSE A;  1AYW A;  4BGF A;  9PAP A;  1EWO A;  3H6S A;  3OVZ A;  3NHE A;  1EF7 A;  2DJG B;  1VSN A;  4W5B A;  2C0Y A;  1NB5 A;  3O1G A;  2HD5 A;  4BPV A;  3P5X A;  3WXE A;  4QRV A;  2E02 A;  3QJ3 A;  3D9W A;  4B55 A;  2BSZ A;  3WXF A;  1AYV A;  3OF9 A;  4KLB A;  3MTN A;  2ARY A;  1ATK A;  2XU1 A;  1PE6 A;  2PBH A;  4P6E A;  1HUC B;  1GEC E;  3BCN A;  2B1N A;  4QRX A;  5JA7 A;  3LFY A;  5EGW A;  2PRE A;  3IMA A;  3HHA A;  1CS8 A;  3KKU A;  1CPJ A;  1MS6 A;  1KHQ A;  1AU3 A;  3S3Q A;  1W4T A;  2HHN A;  4GUZ A;  3MHH A;  2VHF A;  2DZZ A;  1U9X A;  1F2B A;  1S4V A;  4BSQ A;  1STF E;  2DC9 A;  2DCB A;  1THE A;  3P5V A;  4WA6 A;  4W4U A;  5CVN B;  1MEG A;  2PAD A;  4MZO A;  2G8E A;  1F2A A;  2AYN A;  1JQP A;  1U5I A;  4CDE B;  3TNX A;  4BS5 A;  4X6I A;  2FT2 A;  2PNS A;  1GCB A;  5CHT A;  1AU4 A;  1ME4 A;  2AS8 A;  4OEM A;  3KX1 A;  1CQD A;  2R9N A;  2E01 A;  3IEJ A;  5K16 A;  3IHP A;  1GLO A;  4P6G A;  1F29 A;  2R9M A;  4YV8 A;  4FIP A;  2GFO A;  2F7D A;  4CDC B;  2Y5B A;  1PPP A;  2OP3 A;  3P5U A;  2VFB A;  1ZCM A;  1CTE A;  3H89 A;  3S3R A;  1BQI A;  1PBH A;  1YK8 A;  1SP4 B;  1ZIV A;  5CVO B;  3KFQ A;  3U8E A;  5F02 A;  3QSD A;  1BP4 A;  6PAD A;  4QH6 A;  4I05 A;  3CBK A;  1TLO A;  2VFC A;  1KFX L;  4N8W A;  1PPO A;  3HD3 A;  3CH3 X;  2AIM A;  8PCH A;  2AU1 A;  3PDF A;  2R6N A;  3LXS A;  1ICF A;  2BDZ A;  4BQV A;  1W5R A;  4XUI A;  5A24 A;  2NQD B;  4PP2 E;  4PI3 A;  4XR7 A;  3USV A;  4YYV A;  1PXV A;  3V6C A;  2P7U A;  3BOW A;  1Y08 A;  4YVA A;  1K3B B;  3K9M A;  4QRG A;  3IUT A;  1DEU A;  3V6E A;  1YVB A;  1MIR A;  1EWP A;  3K8U A;  2FTD A;  2YJB A;  3MOR A;  3C9E A;  3OIS A;  2YJC A;  2B1M A;  2R9C A;  2DC8 A;  1QDQ A;  4CDD B;  2NQI A;  2P0R A;  1TL9 A;  1PAD A;  2JQF R;  3E1Z B;  2FUD A;  3I3T A;  2OZ2 A;  2XU5 A;  2F1G A;  4I04 A;  3H8C A;  4C5P A;  3BC3 A;  2R9F A;  4YYU A;  1E2T A;  3OF8 A;  2DC7 A;  4DMX A;  2DZY A;  1KXR A;  3D6S A;  2FO5 A;  1TU6 A;  2FQ9 A;  2IPP B;  3BWK A;  3N3G A;  1EWL A;  4X6H A;  3GCB A;  4YYS A;  1NB3 A;  1CV8 A;  1XKG A;  4N79 A;  4FK5 A;  5CVM A;  4Q8H A;  1EWM A;  1GX3 A;  1Y4H A;  4DMY A;  4AXM A;  1PIP A;  4ZUX U;  1U9W A;  4HWY A;  4N4Z A;  1W6F A;  2ATO A;  3WXG A;  1QMY A;  1CB5 A;  1CJL A;  3MHS A;  2DCD A;  2H7J A;  2DCC A;  3KWZ A;  1SNK A;  2R9O A;  4K7C A;  2HH5 A;  3K24 A;  3IV2 A;  3CBJ A;  1NL6 A;  3H8B A;  3RVW A;  2AVW A;  3B79 A;  4YYR A;  3P5W A;  2AUZ A;  3BPF A;  4CDF B;  4NV7 A;  5FPW A;  2FRA A;  2ACT A;  2AYO A;  1F2C A;  2OUL A;  4W5C A;  1KFU L;  1MEM A;  3KW9 A;  4MZS A;  2G6D A;  3ERV A;  3PNR A;  4I07 A;  1YT7 A;  2VHS A;  3M99 A;  4Q8G A;  1AU2 A;  1Q6K A;  5JH3 A;  2JQG R;  1U9V A;  3OVX A;  1BY8 A;  2WBF X;  2YJ2 A;  3O0U A;  2NQG A;  3N3K A;  7PCK A;  3DF0 A;  4FJC A;  2YJ8 A;  2XU3 A;  2DJF B;  3PBH A;  3PW3 A;  2HXZ A;  3BPM A;  1VJV A;  1NQC A;  5PAD A;  5CHV A;  2IBI A;  2Y6E A;  3AI8 A;  1FH0 A;  1GMY A;  3RVX A;  1BGO A;  3HWN A;  1DF0 A;  1ME3 A;  1AEC A;  4CZW A;  1IWD A;  2BDL A;  3F75 A;  4G54 A;  2G7Y A;  2E03 A;  4MSX A;  1AIM A;  4YYQ A;  1CVZ A;  3RVV A;  1CSB B;  2DC6 A;  2XU4 A;  2G8J A;  2CB5 A;  1M6D A;  3N4C A;  4BS6 A;  1POP A;  5EF4 A;  1A6R A;  2CIO A;  2AUX A;  3KWB X;  4QBB A;  1MHW A;  1QOL A;  3IOQ A;  1PCI A;  1U9Q X;  2FRQ A;  3H7D A;  4RY2 A;  1AU0 A;  4YYW A;  2GHU A;  1PPN A;  2DCA A;  4AXL A;  3ZUA A;  3CH2 X;  1X9Y A;  3QT4 A;  4X6J A;  1QXP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...