2PREA

Crystal structure of plant cysteine protease ervatamin-c complexed with irreversible inhibitor e-64 at 2.7 a resolution
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
208
structure length
208
Chain Sequence
LPEQIDWRKKGAVTPVKNQGKCGSCWAFSTVSTVESINQIRTGNLISLSEQQLVDCNKKNHGCKGGAFVYAYQYIIDNGGIDTEANYPYKAVQGPCRAAKKVVRIDGYKGVPHCNENALKKAVASQPSVVAIDASSKQFQHYKSGIFSGPCGTKLNHGVVIVGYWKDYWIVRNSWGRYWGEQGYIRMKRVGGCGLCGIARLPYYPTKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the substrate specificity and activity of ervatamins, the papain-like cysteine proteases from a tropical plant, Ervatamia coronaria.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Ervatamin-C
total genus 62
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 3.4.22.-:
pdb deposition date 2007-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2preA00
4Q8HA 2DC9A 3OF9A 4QH6A 2P86A 3V6CA 3F5VA 3QJ3A 2DJGB 1SNKA 1EF7A 2B1NA 9PAPA 4K7CA 1FH0A 4YVAA 5CVOB 3MTNA 3U8EA 2AUZA 4YV8A 3S3RA 1F29A 1U9WA 3NHEA 2IBIA 3H8BA 1AECA 1CVZA 1TL9A 3IEJA 5J94A 4I07A 2OZ2A 1MDWA 4CDEB 1EWLA 3HWNA 3K8UA 1DEUA 3H6SA 4I04A 4CDCB 1AU0A 2E03A 4MZSA 3WXEA 2AU1A 2YJ8A 3P5WA 1ICFA 2F1GA 2F7DA 3IHPA 1PPDA 4DMYA 1AU2A 4DMXA 5CHVA 4P6EA 5EF4A 3P5VA 4PP1A 3B79A 3N3GA 3AI8A 2AS8A 2E02A 3M99A 3OF8A 1AYVA 1GLOA 1QXPA 4CZWA 2DCAA 2FRQA 3KWZA 4FJCA 2XU1A 2G8JA 3BOWA 3I3TA 3KWBX 1KXRA 3N3KA 1YVBA 2AYNA 1QDQA 2YJ9A 2FT2A 2ATOA 1TLOA 3QSDA 2CIOA 2R9FA 3RVVA 1K3BB 2P7UA 1CQDA 2PREA 1IWDA 1KHQA 1CS8A 1MHWA 3V6EA 1THEA 1CPJA 3PBHA 4YYQA 1PPOA 3MORA 4YYVA 2GHUA 1KFUL 1AYUA 1KFXL 2FQ9A 2WBFX 1YT7A 2PBHA 2NQDB 3H8CA 4N4ZA 2G7YA 4N8WA 1NQCA 4QRXA 2HD5A 1QMYA 3ZUAA 5A24A 4MSXA 3OVXA 8PCHA 5EGWA 2R6NA 4X6JA 1O0EA 3E1ZB 2DC8A 3P5UA 2FTDA 1GECE 1NB3A 1U9XA 2ARYA 1AYWA 4X6IA 2YJ2A 2FUDA 3C9EA 2R9OA 2NQIA 3K9MA 2O6XA 3HD3A 3KSEA 3MHHA 1Y4HA 3F75A 1QOLA 3IV2A 1AU3A 1EWPA 2DZYA 2Y5BA 3I06A 2OULA 4QRVA 3BPFA 1SP4B 2VHSA 3H89A 1MIRA 4KLBA 2R9CA 1ME3A 1EWOA 4HWYA 2G8EA 1STFE 4OELA 3CH2X 4MZOA 5JH3A 5K16A 1S4VA 4PI3A 2DCBA 3LXSA 5FPWA 2HH5A 1ITOA 1PCIA 1MS6A 2AYOA 2FO5A 1NL6A 2H7JA 4BQVA 4RY2A 1ZCMA 2GFOA 1PE6A 1U5IA 1ZIVA 3PNRA 1XKGA 1YALA 2HXZA 5CHTA 1ATKA 2NQGA 1PXVA 3KX1A 3P5XA 3BWKA 4QRGA 3LFYA 4YYSA 2YJCA 1F2CA 3MHSA 3IMAA 2OP3A 1EWMA 2FYEA 3KFQA 2AUXA 4P6GA 1CTEA 1GCBA 2PNSA 2IPPB 1MEGA 1DF0A 3BCNA 3WXFA 1AIMA 1CB5A 1NLJA 1CV8A 2DCCA 2HHNA 5JA7A 1VJVA 5CVMA 2NQAA 3OVZA 3OISA 2C0YA 2DCDA 3D6SA 2ACTA 4XUIA 4FIPA 4CDDB 3WXGA 4YYRA 4PADA 1Y08A 2AVWA 4ZUXU 5CVNB 1PBHA 4BS6A 2YJBA 5PADA 3PDFA 1BQIA 1CJLA 3O1GA 1PPNA 4X6HA 1Q6KA 2E01A 1PADA 3S3QA 3QT4A 4FK5A 4OEMA 2DC6A 1F2AA 4W5BA 3KW9A 3H7DA 3GCBA 3O0UA 1PIPA 3KKUA 2XU5A 4W4UA 4Q8GA 3HHAA 2AIMA 4G54A 1HUCB 2DZZA 3CBKA 3HHIA 1PPPA 2JQFR 4I05A 1A6RA 4PP2E 2BDZA 4BPVA 2XU4A 3RVWA 1NPZA 1MEMA 4AXMA 1VSNA 2P0RA 1M6DA 2E00A 3CBJA 4N79A 1F2BA 2BDLA 4WA6A 2XU3A 4XR7A 4CDFB 1BGOA 3TNXA 2G6DA 3K24A 4W5CA 4YYUA 1BY8A 5F02A 4YYWA 2JQGR 1BP4A 1TU6A 6PADA 1ME4A 2R9MA 7PCKA 3CH3X 3N4CA 3USVA 4QBBA 3RVXA 1POPA 3IUTA 1AU4A 2Y6EA 3IOQA 1GMYA 4BS5A 2VHFA 1X9YA 1YK7A 1NB5A 2PADA 2DJFB 3BC3A 1U9QX 1YK8A 1CSBB 4AXLA 2R9NA 1U9VA 2CB5A 3DF0A 4BSQA 3PW3A 2DC7A 2B1MA 2FRAA 1JQPA 3BPMA 1KHPA 3ERVA
chains in the Genus database with same CATH superfamily
4Q8HA 2DC9A 4WURA 3OF9A 2JRIA 4QH6A 2P86A 3V6CA 3F5VA 3QJ3A 2DJGB 1SNKA 1EF7A 2B1NA 9PAPA 4P16A 4RKXA 3MJ5A 1FH0A 4K7CA 4YVAA 5CVOB 3MTNA 3U8EA 2UZJA 3ZNHA 2AUZA 4YV8A 3TMPA 4D8IA 3S3RA 1F29A 1U9WA 3NHEA 2IBIA 3H8BA 1AECA 1CVZA 1TL9A 3IEJA 5J94A 4I07A 2OZ2A 1MDWA 4CDEB 1EWLA 3HWNA 3K8UA 1DEUA 3H6SA 4I04A 4CDCB 1AU0A 2E03A 4MZSA 3WXEA 2AU1A 2YJ8A 3P5WA 1ICFA 2F1GA 2F7DA 3IHPA 1PPDA 4DMYA 1AU2A 4DMXA 5CHVA 4P6EA 5EF4A 3P5VA 4PP1A 3B79A 3N3GA 3AI8A 2AS8A 2E02A 4RF1A 3M99A 3OF8A 1AYVA 1GLOA 1QXPA 4CZWA 2DCAA 2FRQA 3KWZA 4FJCA 4M0WA 2XU1A 2G8JA 3BOWA 3I3TA 3KWBX 1KXRA 3N3KA 1YVBA 2AYNA 1QDQA 2FE8A 2YJ9A 5JZEA 2FT2A 4GUAA 2ATOA 1TLOA 3QSDA 2CIOA 4BOPA 2R9FA 3RVVA 1K3BB 2P7UA 4RF0A 1CQDA 2PREA 1IWDA 1KHQA 4OW0A 1CS8A 1MHWA 2AGAA 3PRPA 3PT2A 3V6EA 1THEA 3C0RA 1CPJA 3BY4A 3PBHA 4YYQA 4MI7A 1PPOA 3MORA 4YYVA 2GHUA 1KFUL 1AYUA 1KFXL 2FQ9A 2WBFX 1DKIA 1YT7A 2PBHA 2NQDB 3H8CA 4N4ZA 2G7YA 4N8WA 3E9SA 2BTWA 1NQCA 4QRXA 3PHXA 2HD5A 3MTVA 1QMYA 3ZUAA 3PHWA 4BOQA 5A24A 4MSXA 3OVXA 8PCHA 5EGWA 2R6NA 3W30A 4X6JA 1O0EA 3E1ZB 3PRMA 1PVJA 2DC8A 3P5UA 2FTDA 1GECE 1NB3A 1U9XA 2ARYA 3BBAA 1AYWA 4X6IA 2YJ2A 1YZBA 2FUDA 3C9EA 2R9OA 5KO3A 2NQIA 3K9MA 2O6XA 3HD3A 3KSEA 3MHHA 1Y4HA 3F75A 1QOLA 3IV2A 1AU3A 1EWPA 3MP2A 2DZYA 2DOSA 2Y5BA 3I06A 2OULA 4QRVA 3BPFA 1SP4B 2VHSA 3H89A 1MIRA 4KLBA 2R9CA 1ME3A 1EWOA 4HWYA 2G8EA 5E6JA 1STFE 4OELA 3CH2X 4RNAA 4MZOA 5JH3A 5K16A 1S4VA 4PI3A 2DCBA 3LXSA 5FPWA 2HH5A 1ITOA 1PCIA 1MS6A 2AYOA 2FO5A 1NL6A 2H7JA 4BQVA 4RY2A 1ZCMA 3IFUA 2GFOA 1PE6A 1U5IA 1ZIVA 3PNRA 4D8EA 2Z84A 1XKGA 1YALA 2HXZA 5CHTA 4IP3A 1ATKA 2NQGA 4OVZA 1PXVA 3KX1A 3P5XA 3BWKA 4OVZB 4BOSA 4QRGA 3LFYA 4YYSA 5EZSA 2YJCA 4BOUA 1F2CA 3MHSA 3IMAA 2OP3A 1EWMA 2FYEA 3KFQA 2AUXA 4P6GA 1CTEA 1GCBA 2PNSA 2IPPB 1MEGA 1DF0A 3BCNA 3RNVA 3WXFA 1AIMA 1CB5A 1NLJA 1CV8A 2DCCA 2HHNA 5JA7A 1VJVA 5CVMA 2NQAA 4D8BA 3OVZA 3OISA 2C0YA 4IUMA 2DCDA 3D6SA 2ACTA 4XUIA 3W31A 4FIPA 4CDDB 3O65A 3WXGA 4YYRA 4PADA 1Y08A 2AVWA 4ZUXU 4ZTBA 4XZXA 5CVNB 1PBHA 4BS6A 2YJBA 5PADA 3PSEA 3PDFA 1BQIA 1CJLA 3O1GA 1PPNA 4X6HA 1Q6KA 2JTCA 2E01A 1PADA 3S3QA 3QT4A 4FK5A 4OEMA 2DC6A 4HXDB 1F2AA 4W5BA 3KW9A 3H7DA 3GCBA 3PHUA 3O0UA 1PIPA 2BU3A 2J7QC 3KKUA 2XU5A 4W4UA 4Q8GA 3HHAA 2AIMA 4G54A 1HUCB 2DZZA 2BTWB 3CBKA 3HHIA 1PPPA 2JQFR 4I05A 3TRKA 5EZQA 2HWKA 1A6RA 4PP2E 2BDZA 4BPVA 2XU4A 3B21A 1NPZA 3RVWA 4R3DA 2J7QA 1MEMA 4AXMA 1VSNA 2P0RA 1M6DA 2E00A 3CBJA 3OQCA 4N79A 1F2BA 2BDLA 4MM3B 4WA6A 2XU3A 4XR7A 4CDFB 1BGOA 3TNXA 2G6DA 3BB7A 3K24A 4W5CA 4YYUA 1BY8A 5F02A 4YYWA 2JQGR 1BP4A 1TU6A 1UKFA 6PADA 1ME4A 2R9MA 7PCKA 3CH3X 3N4CA 3USVA 4QBBA 3RVXA 1POPA 3IUTA 1AU4A 2Y6EA 3IOQA 1GMYA 4BS5A 2VHFA 1X9YA 1YK7A 1NB5A 2PADA 2DJFB 3BC3A 1U9QX 1YK8A 1CSBB 4REZA 4AXLA 2R9NA 1U9VA 2CB5A 3DF0A 4BSQA 3PW3A 4BOZA 4PT5A 2DC7A 2B1MA 2FRAA 1JQPA 3BPMA 1KHPA 4A5UA 3ERVA
chains in the Genus database with same CATH topology
4Q8HA 2DC9A 3OF9A 4QH6A 2P86A 3V6CA 3F5VA 3QJ3A 2DJGB 1SNKA 1EF7A 2B1NA 9PAPA 3D9WA 1FH0A 4K7CA 4YVAA 5CVOB 4C5PA 3MTNA 3U8EA 2AUZA 4YV8A 3S3RA 1F29A 1U9WA 3NHEA 2IBIA 3H8BA 1AECA 4NV7A 1CVZA 1TL9A 3IEJA 5J94A 4I07A 2OZ2A 1MDWA 2BSZA 1EWLA 4CDEB 3HWNA 3K8UA 1DEUA 3H6SA 4I04A 4CDCB 1W5RA 1AU0A 2E03A 4MZSA 3WXEA 2AU1A 2YJ8A 3P5WA 1ICFA 2F1GA 2F7DA 3IHPA 1PPDA 4DMYA 1AU2A 4DMXA 5CHVA 4P6EA 5EF4A 3P5VA 4PP1A 3B79A 3N3GA 3AI8A 2AS8A 2E02A 3M99A 3OF8A 1AYVA 1GLOA 1QXPA 4CZWA 2DCAA 2FRQA 3KWZA 4FJCA 2XU1A 2G8JA 3BOWA 3I3TA 3KWBX 1KXRA 3N3KA 1YVBA 2AYNA 1QDQA 2YJ9A 2FT2A 2ATOA 1TLOA 1W4TA 3QSDA 2CIOA 2R9FA 3RVVA 1K3BB 2P7UA 1CQDA 2PREA 1IWDA 1KHQA 1CS8A 1MHWA 3V6EA 1THEA 1CPJA 3PBHA 4YYQA 1PPOA 3MORA 4YYVA 2GHUA 1KFUL 1AYUA 1KFXL 2FQ9A 2WBFX 3LTWA 1YT7A 2PBHA 2NQDB 3H8CA 4N4ZA 2G7YA 4N8WA 1NQCA 4QRXA 2HD5A 1QMYA 3ZUAA 5A24A 4MSXA 3OVXA 8PCHA 5EGWA 2R6NA 4X6JA 1O0EA 3E1ZB 2DC8A 3P5UA 2FTDA 1GECE 1NB3A 1U9XA 2ARYA 1AYWA 4X6IA 2YJ2A 2FUDA 3C9EA 2R9OA 2NQIA 3K9MA 2O6XA 3HD3A 3KSEA 3MHHA 1Y4HA 3F75A 1QOLA 3IV2A 1AU3A 1EWPA 2DZYA 2Y5BA 3I06A 2OULA 4QRVA 3BPFA 1SP4B 2VHSA 3H89A 1MIRA 4KLBA 2R9CA 1ME3A 1EWOA 4HWYA 2G8EA 1STFE 4OELA 3CH2X 4BGFA 4B55A 1E2TA 4MZOA 5JH3A 5K16A 1S4VA 4PI3A 4NV8A 2DCBA 2VFCA 3LXSA 5FPWA 2HH5A 1ITOA 1PCIA 1MS6A 2AYOA 2FO5A 1NL6A 2H7JA 4BQVA 4RY2A 1ZCMA 2GFOA 1PE6A 1U5IA 1ZIVA 3PNRA 1XKGA 1YALA 2HXZA 5CHTA 1ATKA 2NQGA 1PXVA 3KX1A 3P5XA 3BWKA 4QRGA 3LFYA 4YYSA 2YJCA 1F2CA 3MHSA 3IMAA 2OP3A 1EWMA 2VFBA 2FYEA 3KFQA 2AUXA 4P6GA 1CTEA 1GCBA 2PNSA 2IPPB 1MEGA 1DF0A 3BCNA 4GUZA 3WXFA 1AIMA 1CB5A 1NLJA 1CV8A 2DCCA 2HHNA 5JA7A 1VJVA 5CVMA 2NQAA 3OVZA 3OISA 2C0YA 1GX3A 2DCDA 3D6SA 2ACTA 4XUIA 4FIPA 4CDDB 3WXGA 4YYRA 4PADA 1Y08A 2AVWA 4ZUXU 5CVNB 1PBHA 4BS6A 2YJBA 5PADA 3PDFA 1BQIA 1CJLA 3O1GA 1PPNA 4X6HA 1Q6KA 2E01A 1PADA 3S3QA 3QT4A 4FK5A 4OEMA 2DC6A 1F2AA 4W5BA 3KW9A 3H7DA 3GCBA 3O0UA 1PIPA 3KKUA 2XU5A 4W4UA 4Q8GA 1W6FA 3HHAA 2AIMA 4G54A 1HUCB 2DZZA 3CBKA 3HHIA 1PPPA 2JQFR 4I05A 1A6RA 4PP2E 2BDZA 4BPVA 2XU4A 3RVWA 1NPZA 1MEMA 4AXMA 1VSNA 2P0RA 1M6DA 2E00A 3CBJA 4N79A 1F2BA 2BDLA 4WA6A 2XU3A 4XR7A 4CDFB 1BGOA 3TNXA 2G6DA 3K24A 4W5CA 4YYUA 1BY8A 5F02A 4YYWA 2JQGR 1BP4A 1TU6A 6PADA 1ME4A 2R9MA 7PCKA 3CH3X 3N4CA 3USVA 4QBBA 3RVXA 1POPA 3IUTA 1AU4A 2Y6EA 3IOQA 1GMYA 4BS5A 2VHFA 1X9YA 1YK7A 1NB5A 2PADA 2DJFB 3BC3A 1U9QX 1YK8A 1CSBB 4AXLA 2R9NA 1U9VA 2CB5A 3DF0A 4BSQA 3PW3A 2DC7A 2B1MA 2FRAA 1JQPA 3BPMA 1KHPA 3ERVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q8H A;  2DC9 A;  3OF9 A;  4QH6 A;  2P86 A;  3V6C A;  3F5V A;  3QJ3 A;  2DJG B;  1SNK A;  1EF7 A;  2B1N A;  9PAP A;  4K7C A;  1FH0 A;  4YVA A;  5CVO B;  3MTN A;  3U8E A;  2AUZ A;  4YV8 A;  3S3R A;  1F29 A;  1U9W A;  3NHE A;  2IBI A;  3H8B A;  1AEC A;  1CVZ A;  1TL9 A;  3IEJ A;  5J94 A;  4I07 A;  2OZ2 A;  1MDW A;  4CDE B;  1EWL A;  3HWN A;  3K8U A;  1DEU A;  3H6S A;  4I04 A;  4CDC B;  1AU0 A;  2E03 A;  4MZS A;  3WXE A;  2AU1 A;  2YJ8 A;  3P5W A;  1ICF A;  2F1G A;  2F7D A;  3IHP A;  1PPD A;  4DMY A;  1AU2 A;  4DMX A;  5CHV A;  4P6E A;  5EF4 A;  3P5V A;  4PP1 A;  3B79 A;  3N3G A;  3AI8 A;  2AS8 A;  2E02 A;  3M99 A;  3OF8 A;  1AYV A;  1GLO A;  1QXP A;  4CZW A;  2DCA A;  2FRQ A;  3KWZ A;  4FJC A;  2XU1 A;  2G8J A;  3BOW A;  3I3T A;  3KWB X;  1KXR A;  3N3K A;  1YVB A;  2AYN A;  1QDQ A;  2YJ9 A;  2FT2 A;  2ATO A;  1TLO A;  3QSD A;  2CIO A;  2R9F A;  3RVV A;  1K3B B;  2P7U A;  1CQD A;  2PRE A;  1IWD A;  1KHQ A;  1CS8 A;  1MHW A;  3V6E A;  1THE A;  1CPJ A;  3PBH A;  4YYQ A;  1PPO A;  3MOR A;  4YYV A;  2GHU A;  1KFU L;  1AYU A;  1KFX L;  2FQ9 A;  2WBF X;  1YT7 A;  2PBH A;  2NQD B;  3H8C A;  4N4Z A;  2G7Y A;  4N8W A;  1NQC A;  4QRX A;  2HD5 A;  1QMY A;  3ZUA A;  5A24 A;  4MSX A;  3OVX A;  8PCH A;  5EGW A;  2R6N A;  4X6J A;  1O0E A;  3E1Z B;  2DC8 A;  3P5U A;  2FTD A;  1GEC E;  1NB3 A;  1U9X A;  2ARY A;  1AYW A;  4X6I A;  2YJ2 A;  2FUD A;  3C9E A;  2R9O A;  2NQI A;  3K9M A;  2O6X A;  3HD3 A;  3KSE A;  3MHH A;  1Y4H A;  3F75 A;  1QOL A;  3IV2 A;  1AU3 A;  1EWP A;  2DZY A;  2Y5B A;  3I06 A;  2OUL A;  4QRV A;  3BPF A;  1SP4 B;  2VHS A;  3H89 A;  1MIR A;  4KLB A;  2R9C A;  1ME3 A;  1EWO A;  4HWY A;  2G8E A;  1STF E;  4OEL A;  3CH2 X;  4MZO A;  5JH3 A;  5K16 A;  1S4V A;  4PI3 A;  2DCB A;  3LXS A;  5FPW A;  2HH5 A;  1ITO A;  1PCI A;  1MS6 A;  2AYO A;  2FO5 A;  1NL6 A;  2H7J A;  4BQV A;  4RY2 A;  1ZCM A;  2GFO A;  1PE6 A;  1U5I A;  1ZIV A;  3PNR A;  1XKG A;  1YAL A;  2HXZ A;  5CHT A;  1ATK A;  2NQG A;  1PXV A;  3KX1 A;  3P5X A;  3BWK A;  4QRG A;  3LFY A;  4YYS A;  2YJC A;  1F2C A;  3MHS A;  3IMA A;  2OP3 A;  1EWM A;  2FYE A;  3KFQ A;  2AUX A;  4P6G A;  1CTE A;  1GCB A;  2PNS A;  2IPP B;  1MEG A;  1DF0 A;  3BCN A;  3WXF A;  1AIM A;  1CB5 A;  1NLJ A;  1CV8 A;  2DCC A;  2HHN A;  5JA7 A;  1VJV A;  5CVM A;  2NQA A;  3OVZ A;  3OIS A;  2C0Y A;  2DCD A;  3D6S A;  2ACT A;  4XUI A;  4FIP A;  4CDD B;  3WXG A;  4YYR A;  4PAD A;  1Y08 A;  2AVW A;  4ZUX U;  5CVN B;  1PBH A;  4BS6 A;  2YJB A;  5PAD A;  3PDF A;  1BQI A;  1CJL A;  3O1G A;  1PPN A;  4X6H A;  1Q6K A;  2E01 A;  1PAD A;  3S3Q A;  3QT4 A;  4FK5 A;  4OEM A;  2DC6 A;  1F2A A;  4W5B A;  3KW9 A;  3H7D A;  3GCB A;  3O0U A;  1PIP A;  3KKU A;  2XU5 A;  4W4U A;  4Q8G A;  3HHA A;  2AIM A;  4G54 A;  1HUC B;  2DZZ A;  3CBK A;  3HHI A;  1PPP A;  2JQF R;  4I05 A;  1A6R A;  4PP2 E;  2BDZ A;  4BPV A;  2XU4 A;  3RVW A;  1NPZ A;  1MEM A;  4AXM A;  1VSN A;  2P0R A;  1M6D A;  2E00 A;  3CBJ A;  4N79 A;  1F2B A;  2BDL A;  4WA6 A;  2XU3 A;  4XR7 A;  4CDF B;  1BGO A;  3TNX A;  2G6D A;  3K24 A;  4W5C A;  4YYU A;  1BY8 A;  5F02 A;  4YYW A;  2JQG R;  1BP4 A;  1TU6 A;  6PAD A;  1ME4 A;  2R9M A;  7PCK A;  3CH3 X;  3N4C A;  3USV A;  4QBB A;  3RVX A;  1POP A;  3IUT A;  1AU4 A;  2Y6E A;  3IOQ A;  1GMY A;  4BS5 A;  2VHF A;  1X9Y A;  1YK7 A;  1NB5 A;  2PAD A;  2DJF B;  3BC3 A;  1U9Q X;  1YK8 A;  1CSB B;  4AXL A;  2R9N A;  1U9V A;  2CB5 A;  3DF0 A;  4BSQ A;  3PW3 A;  2DC7 A;  2B1M A;  2FRA A;  1JQP A;  3BPM A;  1KHP A;  3ERV A; 
#chains in the Genus database with same CATH topology
 4Q8H A;  2DC9 A;  4WUR A;  3OF9 A;  2JRI A;  4QH6 A;  2P86 A;  3V6C A;  3F5V A;  3QJ3 A;  2DJG B;  1SNK A;  1EF7 A;  2B1N A;  9PAP A;  4P16 A;  4RKX A;  3MJ5 A;  1FH0 A;  4K7C A;  4YVA A;  5CVO B;  3MTN A;  3U8E A;  2UZJ A;  3ZNH A;  2AUZ A;  4YV8 A;  3TMP A;  4D8I A;  3S3R A;  1F29 A;  1U9W A;  3NHE A;  2IBI A;  3H8B A;  1AEC A;  1CVZ A;  1TL9 A;  3IEJ A;  5J94 A;  4I07 A;  2OZ2 A;  1MDW A;  4CDE B;  1EWL A;  3HWN A;  3K8U A;  1DEU A;  3H6S A;  4I04 A;  4CDC B;  1AU0 A;  2E03 A;  4MZS A;  3WXE A;  2AU1 A;  2YJ8 A;  3P5W A;  1ICF A;  2F1G A;  2F7D A;  3IHP A;  1PPD A;  4DMY A;  1AU2 A;  4DMX A;  5CHV A;  4P6E A;  5EF4 A;  3P5V A;  4PP1 A;  3B79 A;  3N3G A;  3AI8 A;  2AS8 A;  2E02 A;  4RF1 A;  3M99 A;  3OF8 A;  1AYV A;  1GLO A;  1QXP A;  4CZW A;  2DCA A;  2FRQ A;  3KWZ A;  4FJC A;  4M0W A;  2XU1 A;  2G8J A;  3BOW A;  3I3T A;  3KWB X;  1KXR A;  3N3K A;  1YVB A;  2AYN A;  1QDQ A;  2FE8 A;  2YJ9 A;  5JZE A;  2FT2 A;  4GUA A;  2ATO A;  1TLO A;  3QSD A;  2CIO A;  4BOP A;  2R9F A;  3RVV A;  1K3B B;  2P7U A;  4RF0 A;  1CQD A;  2PRE A;  1IWD A;  1KHQ A;  4OW0 A;  1CS8 A;  1MHW A;  2AGA A;  3PRP A;  3PT2 A;  3V6E A;  1THE A;  3C0R A;  1CPJ A;  3BY4 A;  3PBH A;  4YYQ A;  4MI7 A;  1PPO A;  3MOR A;  4YYV A;  2GHU A;  1KFU L;  1AYU A;  1KFX L;  2FQ9 A;  2WBF X;  1DKI A;  1YT7 A;  2PBH A;  2NQD B;  3H8C A;  4N4Z A;  2G7Y A;  4N8W A;  3E9S A;  2BTW A;  1NQC A;  4QRX A;  3PHX A;  2HD5 A;  3MTV A;  1QMY A;  3ZUA A;  3PHW A;  4BOQ A;  5A24 A;  4MSX A;  3OVX A;  8PCH A;  5EGW A;  2R6N A;  3W30 A;  4X6J A;  1O0E A;  3E1Z B;  3PRM A;  1PVJ A;  2DC8 A;  3P5U A;  2FTD A;  1GEC E;  1NB3 A;  1U9X A;  2ARY A;  3BBA A;  1AYW A;  4X6I A;  2YJ2 A;  1YZB A;  2FUD A;  3C9E A;  2R9O A;  5KO3 A;  2NQI A;  3K9M A;  2O6X A;  3HD3 A;  3KSE A;  3MHH A;  1Y4H A;  3F75 A;  1QOL A;  3IV2 A;  1AU3 A;  1EWP A;  3MP2 A;  2DZY A;  2DOS A;  2Y5B A;  3I06 A;  2OUL A;  4QRV A;  3BPF A;  1SP4 B;  2VHS A;  3H89 A;  1MIR A;  4KLB A;  2R9C A;  1ME3 A;  1EWO A;  4HWY A;  2G8E A;  5E6J A;  1STF E;  4OEL A;  3CH2 X;  4RNA A;  4MZO A;  5JH3 A;  5K16 A;  1S4V A;  4PI3 A;  2DCB A;  3LXS A;  5FPW A;  2HH5 A;  1ITO A;  1PCI A;  1MS6 A;  2AYO A;  2FO5 A;  1NL6 A;  2H7J A;  4BQV A;  4RY2 A;  1ZCM A;  3IFU A;  2GFO A;  1PE6 A;  1U5I A;  1ZIV A;  3PNR A;  4D8E A;  2Z84 A;  1XKG A;  1YAL A;  2HXZ A;  5CHT A;  4IP3 A;  1ATK A;  2NQG A;  4OVZ A;  1PXV A;  3KX1 A;  3P5X A;  3BWK A;  4OVZ B;  4BOS A;  4QRG A;  3LFY A;  4YYS A;  5EZS A;  2YJC A;  4BOU A;  1F2C A;  3MHS A;  3IMA A;  2OP3 A;  1EWM A;  2FYE A;  3KFQ A;  2AUX A;  4P6G A;  1CTE A;  1GCB A;  2PNS A;  2IPP B;  1MEG A;  1DF0 A;  3BCN A;  3RNV A;  3WXF A;  1AIM A;  1CB5 A;  1NLJ A;  1CV8 A;  2DCC A;  2HHN A;  5JA7 A;  1VJV A;  5CVM A;  2NQA A;  4D8B A;  3OVZ A;  3OIS A;  2C0Y A;  4IUM A;  2DCD A;  3D6S A;  2ACT A;  4XUI A;  3W31 A;  4FIP A;  4CDD B;  3O65 A;  3WXG A;  4YYR A;  4PAD A;  1Y08 A;  2AVW A;  4ZUX U;  4ZTB A;  4XZX A;  5CVN B;  1PBH A;  4BS6 A;  2YJB A;  5PAD A;  3PSE A;  3PDF A;  1BQI A;  1CJL A;  3O1G A;  1PPN A;  4X6H A;  1Q6K A;  2JTC A;  2E01 A;  1PAD A;  3S3Q A;  3QT4 A;  4FK5 A;  4OEM A;  2DC6 A;  4HXD B;  1F2A A;  4W5B A;  3KW9 A;  3H7D A;  3GCB A;  3PHU A;  3O0U A;  1PIP A;  2BU3 A;  2J7Q C;  3KKU A;  2XU5 A;  4W4U A;  4Q8G A;  3HHA A;  2AIM A;  4G54 A;  1HUC B;  2DZZ A;  2BTW B;  3CBK A;  3HHI A;  1PPP A;  2JQF R;  4I05 A;  3TRK A;  5EZQ A;  2HWK A;  1A6R A;  4PP2 E;  2BDZ A;  4BPV A;  2XU4 A;  3B21 A;  1NPZ A;  3RVW A;  4R3D A;  2J7Q A;  1MEM A;  4AXM A;  1VSN A;  2P0R A;  1M6D A;  2E00 A;  3CBJ A;  3OQC A;  4N79 A;  1F2B A;  2BDL A;  4MM3 B;  4WA6 A;  2XU3 A;  4XR7 A;  4CDF B;  1BGO A;  3TNX A;  2G6D A;  3BB7 A;  3K24 A;  4W5C A;  4YYU A;  1BY8 A;  5F02 A;  4YYW A;  2JQG R;  1BP4 A;  1TU6 A;  1UKF A;  6PAD A;  1ME4 A;  2R9M A;  7PCK A;  3CH3 X;  3N4C A;  3USV A;  4QBB A;  3RVX A;  1POP A;  3IUT A;  1AU4 A;  2Y6E A;  3IOQ A;  1GMY A;  4BS5 A;  2VHF A;  1X9Y A;  1YK7 A;  1NB5 A;  2PAD A;  2DJF B;  3BC3 A;  1U9Q X;  1YK8 A;  1CSB B;  4REZ A;  4AXL A;  2R9N A;  1U9V A;  2CB5 A;  3DF0 A;  4BSQ A;  3PW3 A;  4BOZ A;  4PT5 A;  2DC7 A;  2B1M A;  2FRA A;  1JQP A;  3BPM A;  1KHP A;  4A5U A;  3ERV A; 
#chains in the Genus database with same CATH homology
 4Q8H A;  2DC9 A;  3OF9 A;  4QH6 A;  2P86 A;  3V6C A;  3F5V A;  3QJ3 A;  2DJG B;  1SNK A;  1EF7 A;  2B1N A;  9PAP A;  3D9W A;  1FH0 A;  4K7C A;  4YVA A;  5CVO B;  4C5P A;  3MTN A;  3U8E A;  2AUZ A;  4YV8 A;  3S3R A;  1F29 A;  1U9W A;  3NHE A;  2IBI A;  3H8B A;  1AEC A;  4NV7 A;  1CVZ A;  1TL9 A;  3IEJ A;  5J94 A;  4I07 A;  2OZ2 A;  1MDW A;  2BSZ A;  1EWL A;  4CDE B;  3HWN A;  3K8U A;  1DEU A;  3H6S A;  4I04 A;  4CDC B;  1W5R A;  1AU0 A;  2E03 A;  4MZS A;  3WXE A;  2AU1 A;  2YJ8 A;  3P5W A;  1ICF A;  2F1G A;  2F7D A;  3IHP A;  1PPD A;  4DMY A;  1AU2 A;  4DMX A;  5CHV A;  4P6E A;  5EF4 A;  3P5V A;  4PP1 A;  3B79 A;  3N3G A;  3AI8 A;  2AS8 A;  2E02 A;  3M99 A;  3OF8 A;  1AYV A;  1GLO A;  1QXP A;  4CZW A;  2DCA A;  2FRQ A;  3KWZ A;  4FJC A;  2XU1 A;  2G8J A;  3BOW A;  3I3T A;  3KWB X;  1KXR A;  3N3K A;  1YVB A;  2AYN A;  1QDQ A;  2YJ9 A;  2FT2 A;  2ATO A;  1TLO A;  1W4T A;  3QSD A;  2CIO A;  2R9F A;  3RVV A;  1K3B B;  2P7U A;  1CQD A;  2PRE A;  1IWD A;  1KHQ A;  1CS8 A;  1MHW A;  3V6E A;  1THE A;  1CPJ A;  3PBH A;  4YYQ A;  1PPO A;  3MOR A;  4YYV A;  2GHU A;  1KFU L;  1AYU A;  1KFX L;  2FQ9 A;  2WBF X;  3LTW A;  1YT7 A;  2PBH A;  2NQD B;  3H8C A;  4N4Z A;  2G7Y A;  4N8W A;  1NQC A;  4QRX A;  2HD5 A;  1QMY A;  3ZUA A;  5A24 A;  4MSX A;  3OVX A;  8PCH A;  5EGW A;  2R6N A;  4X6J A;  1O0E A;  3E1Z B;  2DC8 A;  3P5U A;  2FTD A;  1GEC E;  1NB3 A;  1U9X A;  2ARY A;  1AYW A;  4X6I A;  2YJ2 A;  2FUD A;  3C9E A;  2R9O A;  2NQI A;  3K9M A;  2O6X A;  3HD3 A;  3KSE A;  3MHH A;  1Y4H A;  3F75 A;  1QOL A;  3IV2 A;  1AU3 A;  1EWP A;  2DZY A;  2Y5B A;  3I06 A;  2OUL A;  4QRV A;  3BPF A;  1SP4 B;  2VHS A;  3H89 A;  1MIR A;  4KLB A;  2R9C A;  1ME3 A;  1EWO A;  4HWY A;  2G8E A;  1STF E;  4OEL A;  3CH2 X;  4BGF A;  4B55 A;  1E2T A;  4MZO A;  5JH3 A;  5K16 A;  1S4V A;  4PI3 A;  4NV8 A;  2DCB A;  2VFC A;  3LXS A;  5FPW A;  2HH5 A;  1ITO A;  1PCI A;  1MS6 A;  2AYO A;  2FO5 A;  1NL6 A;  2H7J A;  4BQV A;  4RY2 A;  1ZCM A;  2GFO A;  1PE6 A;  1U5I A;  1ZIV A;  3PNR A;  1XKG A;  1YAL A;  2HXZ A;  5CHT A;  1ATK A;  2NQG A;  1PXV A;  3KX1 A;  3P5X A;  3BWK A;  4QRG A;  3LFY A;  4YYS A;  2YJC A;  1F2C A;  3MHS A;  3IMA A;  2OP3 A;  1EWM A;  2VFB A;  2FYE A;  3KFQ A;  2AUX A;  4P6G A;  1CTE A;  1GCB A;  2PNS A;  2IPP B;  1MEG A;  1DF0 A;  3BCN A;  4GUZ A;  3WXF A;  1AIM A;  1CB5 A;  1NLJ A;  1CV8 A;  2DCC A;  2HHN A;  5JA7 A;  1VJV A;  5CVM A;  2NQA A;  3OVZ A;  3OIS A;  2C0Y A;  1GX3 A;  2DCD A;  3D6S A;  2ACT A;  4XUI A;  4FIP A;  4CDD B;  3WXG A;  4YYR A;  4PAD A;  1Y08 A;  2AVW A;  4ZUX U;  5CVN B;  1PBH A;  4BS6 A;  2YJB A;  5PAD A;  3PDF A;  1BQI A;  1CJL A;  3O1G A;  1PPN A;  4X6H A;  1Q6K A;  2E01 A;  1PAD A;  3S3Q A;  3QT4 A;  4FK5 A;  4OEM A;  2DC6 A;  1F2A A;  4W5B A;  3KW9 A;  3H7D A;  3GCB A;  3O0U A;  1PIP A;  3KKU A;  2XU5 A;  4W4U A;  4Q8G A;  1W6F A;  3HHA A;  2AIM A;  4G54 A;  1HUC B;  2DZZ A;  3CBK A;  3HHI A;  1PPP A;  2JQF R;  4I05 A;  1A6R A;  4PP2 E;  2BDZ A;  4BPV A;  2XU4 A;  3RVW A;  1NPZ A;  1MEM A;  4AXM A;  1VSN A;  2P0R A;  1M6D A;  2E00 A;  3CBJ A;  4N79 A;  1F2B A;  2BDL A;  4WA6 A;  2XU3 A;  4XR7 A;  4CDF B;  1BGO A;  3TNX A;  2G6D A;  3K24 A;  4W5C A;  4YYU A;  1BY8 A;  5F02 A;  4YYW A;  2JQG R;  1BP4 A;  1TU6 A;  6PAD A;  1ME4 A;  2R9M A;  7PCK A;  3CH3 X;  3N4C A;  3USV A;  4QBB A;  3RVX A;  1POP A;  3IUT A;  1AU4 A;  2Y6E A;  3IOQ A;  1GMY A;  4BS5 A;  2VHF A;  1X9Y A;  1YK7 A;  1NB5 A;  2PAD A;  2DJF B;  3BC3 A;  1U9Q X;  1YK8 A;  1CSB B;  4AXL A;  2R9N A;  1U9V A;  2CB5 A;  3DF0 A;  4BSQ A;  3PW3 A;  2DC7 A;  2B1M A;  2FRA A;  1JQP A;  3BPM A;  1KHP A;  3ERV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...