3QSDA

Structure of cathepsin b1 from schistosoma mansoni in complex with ca074 inhibitor
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
253
structure length
253
Chain Sequence
EIPSSFDSRKKWPRCKSIATIRDQSRCGSCWAFGAVEAMSDRSCIQSGGKQNVELSAVDLLSCCESCGLGCEGGILGPAWDYWVKEGIVTGSSKENHAGCEPYPFPKCEHHTKGKYPPCGSKIYKTPRCKQTCQKKYKTPYTQDKHRGKSSYNVKNDEKAIQKEIMKYGPVEAGFTVYEDFLNYKSGIYKHITGETLGGHAIRIIGWGVENKAPYWLIANSWNEDWGENGYFRIVRGRDECSIESEVTAGRIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Inhibition of Cathepsin B Drug Target from the Human Blood Fluke, Schistosoma mansoni.
pubmed doi rcsb
source organism Schistosoma mansoni
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cathepsin B-like peptidase (C01 family)
total genus 87
structure length 253
sequence length 253
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2011-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3qsdA00
1PCIA 2CIOA 4ZUXU 1GMYA 1CSBB 1KHPA 2FTDA 3H8CA 2HH5A 3I06A 1A6RA 1KHQA 2ARYA 3BPFA 3H7DA 2JQFR 3N3KA 3HWNA 4PADA 1F2BA 2YJBA 4CDDB 2DCAA 1QDQA 2AUXA 1HUCB 2DCCA 2OP3A 4QH6A 7PCKA 2NQAA 9PAPA 4W4UA 1DF0A 5FPWA 2XU4A 3BWKA 3IOQA 2DJFB 1CQDA 2G6DA 2R9NA 3P5XA 3PW3A 1YVBA 3OVZA 1FH0A 5K16A 4CDEB 4G54A 1YALA 1NPZA 1PPOA 2BDZA 3KX1A 5JA7A 2VHSA 2AYOA 4QBBA 4QRXA 2XU1A 2FYEA 5CVNB 1M6DA 3B79A 4X6IA 1YK8A 6PADA 2R9FA 2AYNA 2G8JA 1BGOA 1EWPA 1EWLA 1QXPA 4MZOA 1YT7A 2IPPB 4I07A 2PNSA 3O0UA 2DC9A 4BS5A 2FUDA 5F02A 1Q6KA 2XU5A 4HWYA 4YYRA 5A24A 4RY2A 4FIPA 5EGWA 2ACTA 1ZIVA 4DMXA 2B1MA 1KFUL 3WXEA 3CBJA 2AS8A 4P6GA 3NHEA 2E03A 3H8BA 2FRAA 1ATKA 4YYVA 4I05A 4PP2E 2OULA 1ZCMA 1BP4A 4MSXA 2DCBA 2PADA 4YV8A 3H89A 1PPNA 2R9MA 1GCBA 3IMAA 4DMYA 5JH3A 3BCNA 2AUZA 2F7DA 1AYVA 3USVA 1F2AA 4X6HA 1POPA 2E01A 4BQVA 1THEA 1VSNA 4YVAA 1BQIA 2DC7A 1AU3A 3KSEA 1CB5A 1O0EA 1QMYA 2DCDA 2G7YA 1Y08A 4W5BA 3I3TA 2FT2A 4BSQA 3LFYA 3C9EA 3IUTA 2YJCA 3E1ZB 1MDWA 2NQIA 1CPJA 1VJVA 4OELA 4Q8HA 2NQDB 3MORA 1NLJA 3WXGA 3CH2X 4QRGA 1CTEA 1ME4A 2GFOA 3U8EA 1X9YA 4XR7A 2BDLA 1AIMA 1PPPA 5CHTA 3IEJA 1NB5A 2XU3A 1DEUA 3S3RA 3HHIA 5CHVA 3KW9A 3PNRA 1F2CA 3K8UA 2Y5BA 3HD3A 3OVXA 3IHPA 3PDFA 4CDFB 5EF4A 1U9WA 4AXMA 3BC3A 3PBHA 3DF0A 4P6EA 3CH3X 2FQ9A 2HD5A 4K7CA 1MS6A 8PCHA 2HXZA 1U9VA 1IWDA 2P7UA 1MEGA 1AYWA 1EWOA 1YK7A 3MHSA 3QT4A 2R9CA 4PI3A 4N8WA 1CJLA 3RVVA 1PBHA 4KLBA 3KKUA 1Y4HA 1TL9A 4FK5A 4AXLA 4XUIA 3K24A 1ME3A 2H7JA 5J94A 3HHAA 1SP4B 2AU1A 1PE6A 3AI8A 1BY8A 2E00A 3V6EA 3RVWA 3RVXA 3ZUAA 2HHNA 3WXFA 5PADA 3QJ3A 4CDCB 1TU6A 1EWMA 3N3GA 4MZSA 4YYSA 1MHWA 3F75A 1NL6A 3CBKA 5CVOB 1CV8A 1AYUA 3BOWA 2YJ2A 3P5UA 2ATOA 1QOLA 3P5WA 1NB3A 1AECA 4PP1A 1AU0A 2P86A 1CS8A 1U9QX 3P5VA 4YYUA 4OEMA 1PADA 3KWZA 3O1GA 1SNKA 5CVMA 4FJCA 4BS6A 4X6JA 3ERVA 2G8EA 2YJ9A 4BPVA 1U9XA 3GCBA 2FRQA 3OF9A 3M99A 4QRVA 1XKGA 2OZ2A 2YJ8A 1NQCA 3N4CA 1PPDA 3KWBX 4WA6A 2DC8A 2C0YA 2DC6A 2CB5A 1PXVA 1AU2A 3D6SA 1ICFA 2Y6EA 3H6SA 1MIRA 1K3BB 2WBFX 2FO5A 4YYQA 1CVZA 1U5IA 2VHFA 1TLOA 3LXSA 1F29A 3MHHA 2E02A 1GLOA 2GHUA 3K9MA 4N79A 1S4VA 4YYWA 4Q8GA 2AIMA 3IV2A 4N4ZA 1ITOA 3OF8A 2R6NA 2P0RA 1MEMA 3BPMA 2PREA 2R9OA 2DZZA 2IBIA 3KFQA 3OISA 2DJGB 1EF7A 1PIPA 1AU4A 2JQGR 3V6CA 4W5CA 2DZYA 3MTNA 3TNXA 2AVWA 1KXRA 3S3QA 1KFXL 2PBHA 1GECE 2NQGA 4I04A 3F5VA 1STFE 1JQPA 2B1NA 4CZWA 2F1GA 3QSDA 2O6XA
chains in the Genus database with same CATH superfamily
4R3DA 1PCIA 2CIOA 4ZUXU 1GMYA 1CSBB 1KHPA 2FTDA 4MM3B 3H8CA 2HH5A 3I06A 1A6RA 4M0WA 4ZTBA 1KHQA 2BTWA 2ARYA 2FE8A 3BPFA 3H7DA 2JQFR 3N3KA 3HWNA 4BOSA 4PADA 1F2BA 2YJBA 3BY4A 2HWKA 4CDDB 2DCAA 1QDQA 3PHUA 4P16A 2AUXA 1HUCB 2DCCA 2OP3A 4QH6A 7PCKA 2NQAA 9PAPA 4W4UA 4OVZA 1DF0A 5FPWA 4RF1A 2XU4A 3BWKA 4HXDB 3IOQA 2DJFB 1CQDA 2G6DA 2R9NA 3P5XA 4D8EA 3PW3A 1YVBA 3OVZA 3MP2A 1FH0A 5K16A 1YZBA 4CDEB 4G54A 1YALA 5EZSA 1NPZA 1PPOA 2BDZA 3KX1A 5JA7A 3ZNHA 2VHSA 2AYOA 4QBBA 4QRXA 2XU1A 2FYEA 5CVNB 1M6DA 3B79A 4X6IA 1YK8A 6PADA 2R9FA 2AYNA 2G8JA 3TRKA 1BGOA 1EWPA 4D8IA 1EWLA 1QXPA 4MZOA 1YT7A 2IPPB 4I07A 2PNSA 3O0UA 2DC9A 4BS5A 2FUDA 5F02A 1Q6KA 2XU5A 4HWYA 4YYRA 5A24A 4RY2A 4FIPA 5EGWA 2ACTA 1ZIVA 4DMXA 2B1MA 1KFUL 2DOSA 3WXEA 3CBJA 2AS8A 4P6GA 3NHEA 3W31A 2E03A 3H8BA 2FRAA 1ATKA 4YYVA 4I05A 2OULA 4PP2E 1ZCMA 1BP4A 4MSXA 2DCBA 2PADA 3PHXA 4REZA 4IP3A 4YV8A 2J7QC 5KO3A 3H89A 1PPNA 2R9MA 1GCBA 2Z84A 3IMAA 3MJ5A 4DMYA 5JH3A 3BCNA 2AUZA 2F7DA 1PVJA 1AYVA 3PRPA 3USVA 1F2AA 4X6HA 1POPA 2E01A 3B21A 4RF0A 4BQVA 1THEA 1VSNA 4YVAA 1BQIA 2DC7A 4BOZA 1AU3A 3KSEA 1CB5A 1O0EA 2JRIA 4XZXA 1QMYA 2DCDA 2G7YA 1Y08A 4W5BA 3I3TA 2FT2A 4BSQA 2BU3A 3LFYA 3C9EA 3IUTA 2YJCA 3E1ZB 1MDWA 2NQIA 1CPJA 1VJVA 3MTVA 4OELA 4Q8HA 2NQDB 3MORA 1NLJA 3WXGA 3CH2X 4QRGA 1CTEA 1ME4A 2GFOA 3U8EA 1X9YA 4XR7A 2BDLA 1AIMA 1PPPA 5CHTA 3IEJA 1NB5A 2XU3A 1DEUA 3S3RA 3HHIA 5CHVA 3KW9A 3PNRA 1F2CA 3K8UA 2Y5BA 3BB7A 3HD3A 3OVXA 3IHPA 3PDFA 5E6JA 4CDFB 1U9WA 5EF4A 4AXMA 2JTCA 3BC3A 1DKIA 3PBHA 3DF0A 4P6EA 3CH3X 4GUAA 2FQ9A 2HD5A 4K7CA 1MS6A 8PCHA 2HXZA 1U9VA 1IWDA 2P7UA 1MEGA 1AYWA 3PHWA 1EWOA 1YK7A 3MHSA 3QT4A 2R9CA 4PI3A 4N8WA 1CJLA 3RVVA 1PBHA 3OQCA 4KLBA 3KKUA 1Y4HA 3O65A 1TL9A 4FK5A 4AXLA 4XUIA 3K24A 1ME3A 2H7JA 4RKXA 5J94A 3HHAA 1SP4B 2AU1A 3PRMA 4MI7A 1PE6A 3E9SA 3AI8A 1BY8A 2E00A 4BOPA 3V6EA 2AGAA 3RVWA 3RVXA 3IFUA 3ZUAA 2HHNA 3WXFA 5PADA 3QJ3A 4CDCB 1TU6A 1EWMA 3N3GA 4MZSA 4YYSA 1MHWA 3F75A 1NL6A 3CBKA 5CVOB 1CV8A 1AYUA 3BOWA 2YJ2A 3P5UA 2ATOA 1QOLA 4OVZB 3P5WA 1NB3A 1AECA 4PP1A 1AU0A 4OW0A 2P86A 3PT2A 1CS8A 1U9QX 4RNAA 2UZJA 3P5VA 4YYUA 4OEMA 3C0RA 1PADA 3KWZA 3O1GA 1SNKA 5CVMA 4FJCA 4BS6A 4X6JA 4BOQA 3ERVA 2G8EA 2YJ9A 3W30A 4BPVA 1U9XA 3GCBA 2FRQA 3OF9A 3M99A 4QRVA 1XKGA 2OZ2A 2YJ8A 1NQCA 3N4CA 1PPDA 3KWBX 4WA6A 2DC8A 2C0YA 2DC6A 2CB5A 4IUMA 1PXVA 1AU2A 3D6SA 1ICFA 2Y6EA 4BOUA 3H6SA 1MIRA 1K3BB 2WBFX 4A5UA 2FO5A 4YYQA 1CVZA 4D8BA 1U5IA 2VHFA 1TLOA 3LXSA 1F29A 3MHHA 2E02A 1GLOA 2GHUA 3K9MA 4N79A 1S4VA 3TMPA 4YYWA 3PSEA 2J7QA 4Q8GA 2AIMA 3IV2A 4N4ZA 1ITOA 3OF8A 2R6NA 2P0RA 1MEMA 3BPMA 2PREA 2R9OA 2BTWB 2DZZA 2IBIA 3KFQA 3OISA 2DJGB 1EF7A 1PIPA 1UKFA 1AU4A 2JQGR 3V6CA 5JZEA 4W5CA 2DZYA 3RNVA 3MTNA 3TNXA 2AVWA 1KXRA 4PT5A 3S3QA 1KFXL 2PBHA 1GECE 2NQGA 4I04A 3F5VA 1STFE 1JQPA 2B1NA 4CZWA 2F1GA 3BBAA 4WURA 5EZQA 3QSDA 2O6XA
chains in the Genus database with same CATH topology
1PCIA 2CIOA 4ZUXU 1GMYA 1CSBB 1KHPA 2FTDA 3H8CA 2HH5A 3I06A 1A6RA 1KHQA 2ARYA 3BPFA 3H7DA 2JQFR 3N3KA 3HWNA 4PADA 1F2BA 2YJBA 4CDDB 2DCAA 1QDQA 2AUXA 1HUCB 2DCCA 2OP3A 4QH6A 7PCKA 2NQAA 9PAPA 4W4UA 1DF0A 5FPWA 2XU4A 3BWKA 3IOQA 2DJFB 1CQDA 2G6DA 2R9NA 3P5XA 3PW3A 1YVBA 3OVZA 1FH0A 5K16A 4CDEB 4G54A 1YALA 1NPZA 1PPOA 2BDZA 3KX1A 5JA7A 2VHSA 2AYOA 4QBBA 4QRXA 2XU1A 2FYEA 5CVNB 1M6DA 3B79A 4X6IA 1YK8A 4C5PA 6PADA 2R9FA 2AYNA 2G8JA 1BGOA 1EWPA 1EWLA 1QXPA 4MZOA 1YT7A 3LTWA 4I07A 2IPPB 2PNSA 3O0UA 2DC9A 4BS5A 2FUDA 5F02A 1Q6KA 2XU5A 4HWYA 4YYRA 5A24A 4RY2A 4FIPA 5EGWA 2ACTA 1ZIVA 4DMXA 2B1MA 1KFUL 3WXEA 3CBJA 2AS8A 4P6GA 3NHEA 2E03A 3H8BA 2FRAA 1ATKA 4YYVA 4I05A 4PP2E 2OULA 1ZCMA 1BP4A 4MSXA 2DCBA 2PADA 4YV8A 3H89A 1PPNA 2R9MA 1GCBA 3IMAA 4DMYA 5JH3A 3BCNA 2AUZA 2F7DA 1AYVA 3USVA 1F2AA 4X6HA 1POPA 2E01A 4BQVA 1THEA 1VSNA 4YVAA 1BQIA 2DC7A 1AU3A 3KSEA 1GX3A 1CB5A 1O0EA 1QMYA 2DCDA 2G7YA 1Y08A 4W5BA 3I3TA 2FT2A 4NV8A 4BSQA 3LFYA 3C9EA 3IUTA 2VFCA 2YJCA 3E1ZB 1MDWA 2NQIA 1CPJA 1VJVA 4OELA 4Q8HA 2NQDB 3MORA 1NLJA 3WXGA 3CH2X 4QRGA 1CTEA 1ME4A 2GFOA 3U8EA 1X9YA 4XR7A 2BDLA 1AIMA 1PPPA 5CHTA 3IEJA 1NB5A 2XU3A 1DEUA 3S3RA 3HHIA 5CHVA 3KW9A 3PNRA 1F2CA 3K8UA 2Y5BA 3HD3A 3OVXA 3IHPA 2VFBA 3PDFA 4CDFB 5EF4A 1U9WA 4AXMA 3BC3A 3PBHA 3DF0A 4P6EA 3CH3X 2FQ9A 2HD5A 4K7CA 1MS6A 8PCHA 2HXZA 1U9VA 1IWDA 2P7UA 1W6FA 1MEGA 1AYWA 1EWOA 1YK7A 3MHSA 3QT4A 4B55A 2R9CA 4PI3A 4N8WA 1CJLA 3RVVA 1PBHA 4KLBA 3KKUA 1Y4HA 1TL9A 4FK5A 4AXLA 4XUIA 3K24A 1ME3A 2H7JA 5J94A 3HHAA 1SP4B 2AU1A 1PE6A 3AI8A 1BY8A 2E00A 3V6EA 3RVWA 3RVXA 3ZUAA 2HHNA 3WXFA 5PADA 3QJ3A 4CDCB 1W5RA 1TU6A 1EWMA 3N3GA 4MZSA 4YYSA 1MHWA 3F75A 1NL6A 3CBKA 5CVOB 1CV8A 1AYUA 3BOWA 2YJ2A 3P5UA 2ATOA 1QOLA 3P5WA 1NB3A 1AECA 4PP1A 1AU0A 1E2TA 2P86A 1CS8A 1U9QX 3P5VA 4YYUA 4GUZA 4OEMA 1PADA 3KWZA 3O1GA 1SNKA 5CVMA 4FJCA 4BS6A 4X6JA 4NV7A 3ERVA 2G8EA 2YJ9A 4BPVA 1U9XA 3GCBA 2FRQA 3OF9A 3M99A 4QRVA 1XKGA 2OZ2A 2YJ8A 1NQCA 3N4CA 1PPDA 3KWBX 4WA6A 2DC8A 2C0YA 2DC6A 2CB5A 1PXVA 3D9WA 1AU2A 3D6SA 1ICFA 2Y6EA 3H6SA 1MIRA 1K3BB 2WBFX 2FO5A 4YYQA 1CVZA 1U5IA 2VHFA 1TLOA 3LXSA 1F29A 3MHHA 2E02A 1GLOA 2GHUA 3K9MA 4N79A 1S4VA 4YYWA 4Q8GA 2AIMA 3IV2A 4N4ZA 1ITOA 3OF8A 2R6NA 2P0RA 1MEMA 3BPMA 2PREA 2R9OA 2DZZA 2IBIA 3KFQA 3OISA 2DJGB 1EF7A 1PIPA 1AU4A 2JQGR 3V6CA 4W5CA 2DZYA 3MTNA 3TNXA 2AVWA 1KXRA 1W4TA 3S3QA 1KFXL 2PBHA 1GECE 2NQGA 4I04A 3F5VA 1STFE 1JQPA 2B1NA 4CZWA 2F1GA 3QSDA 2BSZA 4BGFA 2O6XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PCI A;  2CIO A;  4ZUX U;  1GMY A;  1CSB B;  1KHP A;  2FTD A;  3H8C A;  2HH5 A;  3I06 A;  1A6R A;  1KHQ A;  2ARY A;  3BPF A;  3H7D A;  2JQF R;  3N3K A;  3HWN A;  4PAD A;  1F2B A;  2YJB A;  4CDD B;  2DCA A;  1QDQ A;  2AUX A;  1HUC B;  2DCC A;  2OP3 A;  4QH6 A;  7PCK A;  2NQA A;  9PAP A;  4W4U A;  1DF0 A;  5FPW A;  2XU4 A;  3BWK A;  3IOQ A;  2DJF B;  1CQD A;  2G6D A;  2R9N A;  3P5X A;  3PW3 A;  1YVB A;  3OVZ A;  1FH0 A;  5K16 A;  4CDE B;  4G54 A;  1YAL A;  1NPZ A;  1PPO A;  2BDZ A;  3KX1 A;  5JA7 A;  2VHS A;  2AYO A;  4QBB A;  4QRX A;  2XU1 A;  2FYE A;  5CVN B;  1M6D A;  3B79 A;  4X6I A;  1YK8 A;  6PAD A;  2R9F A;  2AYN A;  2G8J A;  1BGO A;  1EWP A;  1EWL A;  1QXP A;  4MZO A;  1YT7 A;  2IPP B;  4I07 A;  2PNS A;  3O0U A;  2DC9 A;  4BS5 A;  2FUD A;  5F02 A;  1Q6K A;  2XU5 A;  4HWY A;  4YYR A;  5A24 A;  4RY2 A;  4FIP A;  5EGW A;  2ACT A;  1ZIV A;  4DMX A;  2B1M A;  1KFU L;  3WXE A;  3CBJ A;  2AS8 A;  4P6G A;  3NHE A;  2E03 A;  3H8B A;  2FRA A;  1ATK A;  4YYV A;  4I05 A;  4PP2 E;  2OUL A;  1ZCM A;  1BP4 A;  4MSX A;  2DCB A;  2PAD A;  4YV8 A;  3H89 A;  1PPN A;  2R9M A;  1GCB A;  3IMA A;  4DMY A;  5JH3 A;  3BCN A;  2AUZ A;  2F7D A;  1AYV A;  3USV A;  1F2A A;  4X6H A;  1POP A;  2E01 A;  4BQV A;  1THE A;  1VSN A;  4YVA A;  1BQI A;  2DC7 A;  1AU3 A;  3KSE A;  1CB5 A;  1O0E A;  1QMY A;  2DCD A;  2G7Y A;  1Y08 A;  4W5B A;  3I3T A;  2FT2 A;  4BSQ A;  3LFY A;  3C9E A;  3IUT A;  2YJC A;  3E1Z B;  1MDW A;  2NQI A;  1CPJ A;  1VJV A;  4OEL A;  4Q8H A;  2NQD B;  3MOR A;  1NLJ A;  3WXG A;  3CH2 X;  4QRG A;  1CTE A;  1ME4 A;  2GFO A;  3U8E A;  1X9Y A;  4XR7 A;  2BDL A;  1AIM A;  1PPP A;  5CHT A;  3IEJ A;  1NB5 A;  2XU3 A;  1DEU A;  3S3R A;  3HHI A;  5CHV A;  3KW9 A;  3PNR A;  1F2C A;  3K8U A;  2Y5B A;  3HD3 A;  3OVX A;  3IHP A;  3PDF A;  4CDF B;  5EF4 A;  1U9W A;  4AXM A;  3BC3 A;  3PBH A;  3DF0 A;  4P6E A;  3CH3 X;  2FQ9 A;  2HD5 A;  4K7C A;  1MS6 A;  8PCH A;  2HXZ A;  1U9V A;  1IWD A;  2P7U A;  1MEG A;  1AYW A;  1EWO A;  1YK7 A;  3MHS A;  3QT4 A;  2R9C A;  4PI3 A;  4N8W A;  1CJL A;  3RVV A;  1PBH A;  4KLB A;  3KKU A;  1Y4H A;  1TL9 A;  4FK5 A;  4AXL A;  4XUI A;  3K24 A;  1ME3 A;  2H7J A;  5J94 A;  3HHA A;  1SP4 B;  2AU1 A;  1PE6 A;  3AI8 A;  1BY8 A;  2E00 A;  3V6E A;  3RVW A;  3RVX A;  3ZUA A;  2HHN A;  3WXF A;  5PAD A;  3QJ3 A;  4CDC B;  1TU6 A;  1EWM A;  3N3G A;  4MZS A;  4YYS A;  1MHW A;  3F75 A;  1NL6 A;  3CBK A;  5CVO B;  1CV8 A;  1AYU A;  3BOW A;  2YJ2 A;  3P5U A;  2ATO A;  1QOL A;  3P5W A;  1NB3 A;  1AEC A;  4PP1 A;  1AU0 A;  2P86 A;  1CS8 A;  1U9Q X;  3P5V A;  4YYU A;  4OEM A;  1PAD A;  3KWZ A;  3O1G A;  1SNK A;  5CVM A;  4FJC A;  4BS6 A;  4X6J A;  3ERV A;  2G8E A;  2YJ9 A;  4BPV A;  1U9X A;  3GCB A;  2FRQ A;  3OF9 A;  3M99 A;  4QRV A;  1XKG A;  2OZ2 A;  2YJ8 A;  1NQC A;  3N4C A;  1PPD A;  3KWB X;  4WA6 A;  2DC8 A;  2C0Y A;  2DC6 A;  2CB5 A;  1PXV A;  1AU2 A;  3D6S A;  1ICF A;  2Y6E A;  3H6S A;  1MIR A;  1K3B B;  2WBF X;  2FO5 A;  4YYQ A;  1CVZ A;  1U5I A;  2VHF A;  1TLO A;  3LXS A;  1F29 A;  3MHH A;  2E02 A;  1GLO A;  2GHU A;  3K9M A;  4N79 A;  1S4V A;  4YYW A;  4Q8G A;  2AIM A;  3IV2 A;  4N4Z A;  1ITO A;  3OF8 A;  2R6N A;  2P0R A;  1MEM A;  3BPM A;  2PRE A;  2R9O A;  2DZZ A;  2IBI A;  3KFQ A;  3OIS A;  2DJG B;  1EF7 A;  1PIP A;  1AU4 A;  2JQG R;  3V6C A;  4W5C A;  2DZY A;  3MTN A;  3TNX A;  2AVW A;  1KXR A;  3S3Q A;  1KFX L;  2PBH A;  1GEC E;  2NQG A;  4I04 A;  3F5V A;  1STF E;  1JQP A;  2B1N A;  4CZW A;  2F1G A;  3QSD A;  2O6X A; 
#chains in the Genus database with same CATH topology
 4R3D A;  1PCI A;  2CIO A;  4ZUX U;  1GMY A;  1CSB B;  1KHP A;  2FTD A;  4MM3 B;  3H8C A;  2HH5 A;  3I06 A;  1A6R A;  4M0W A;  4ZTB A;  1KHQ A;  2BTW A;  2ARY A;  2FE8 A;  3BPF A;  3H7D A;  2JQF R;  3N3K A;  3HWN A;  4BOS A;  4PAD A;  1F2B A;  2YJB A;  3BY4 A;  2HWK A;  4CDD B;  2DCA A;  1QDQ A;  3PHU A;  4P16 A;  2AUX A;  1HUC B;  2DCC A;  2OP3 A;  4QH6 A;  7PCK A;  2NQA A;  9PAP A;  4W4U A;  4OVZ A;  1DF0 A;  5FPW A;  4RF1 A;  2XU4 A;  3BWK A;  4HXD B;  3IOQ A;  2DJF B;  1CQD A;  2G6D A;  2R9N A;  3P5X A;  4D8E A;  3PW3 A;  1YVB A;  3OVZ A;  3MP2 A;  1FH0 A;  5K16 A;  1YZB A;  4CDE B;  4G54 A;  1YAL A;  5EZS A;  1NPZ A;  1PPO A;  2BDZ A;  3KX1 A;  5JA7 A;  3ZNH A;  2VHS A;  2AYO A;  4QBB A;  4QRX A;  2XU1 A;  2FYE A;  5CVN B;  1M6D A;  3B79 A;  4X6I A;  1YK8 A;  6PAD A;  2R9F A;  2AYN A;  2G8J A;  3TRK A;  1BGO A;  1EWP A;  4D8I A;  1EWL A;  1QXP A;  4MZO A;  1YT7 A;  2IPP B;  4I07 A;  2PNS A;  3O0U A;  2DC9 A;  4BS5 A;  2FUD A;  5F02 A;  1Q6K A;  2XU5 A;  4HWY A;  4YYR A;  5A24 A;  4RY2 A;  4FIP A;  5EGW A;  2ACT A;  1ZIV A;  4DMX A;  2B1M A;  1KFU L;  2DOS A;  3WXE A;  3CBJ A;  2AS8 A;  4P6G A;  3NHE A;  3W31 A;  2E03 A;  3H8B A;  2FRA A;  1ATK A;  4YYV A;  4I05 A;  2OUL A;  4PP2 E;  1ZCM A;  1BP4 A;  4MSX A;  2DCB A;  2PAD A;  3PHX A;  4REZ A;  4IP3 A;  4YV8 A;  2J7Q C;  5KO3 A;  3H89 A;  1PPN A;  2R9M A;  1GCB A;  2Z84 A;  3IMA A;  3MJ5 A;  4DMY A;  5JH3 A;  3BCN A;  2AUZ A;  2F7D A;  1PVJ A;  1AYV A;  3PRP A;  3USV A;  1F2A A;  4X6H A;  1POP A;  2E01 A;  3B21 A;  4RF0 A;  4BQV A;  1THE A;  1VSN A;  4YVA A;  1BQI A;  2DC7 A;  4BOZ A;  1AU3 A;  3KSE A;  1CB5 A;  1O0E A;  2JRI A;  4XZX A;  1QMY A;  2DCD A;  2G7Y A;  1Y08 A;  4W5B A;  3I3T A;  2FT2 A;  4BSQ A;  2BU3 A;  3LFY A;  3C9E A;  3IUT A;  2YJC A;  3E1Z B;  1MDW A;  2NQI A;  1CPJ A;  1VJV A;  3MTV A;  4OEL A;  4Q8H A;  2NQD B;  3MOR A;  1NLJ A;  3WXG A;  3CH2 X;  4QRG A;  1CTE A;  1ME4 A;  2GFO A;  3U8E A;  1X9Y A;  4XR7 A;  2BDL A;  1AIM A;  1PPP A;  5CHT A;  3IEJ A;  1NB5 A;  2XU3 A;  1DEU A;  3S3R A;  3HHI A;  5CHV A;  3KW9 A;  3PNR A;  1F2C A;  3K8U A;  2Y5B A;  3BB7 A;  3HD3 A;  3OVX A;  3IHP A;  3PDF A;  5E6J A;  4CDF B;  1U9W A;  5EF4 A;  4AXM A;  2JTC A;  3BC3 A;  1DKI A;  3PBH A;  3DF0 A;  4P6E A;  3CH3 X;  4GUA A;  2FQ9 A;  2HD5 A;  4K7C A;  1MS6 A;  8PCH A;  2HXZ A;  1U9V A;  1IWD A;  2P7U A;  1MEG A;  1AYW A;  3PHW A;  1EWO A;  1YK7 A;  3MHS A;  3QT4 A;  2R9C A;  4PI3 A;  4N8W A;  1CJL A;  3RVV A;  1PBH A;  3OQC A;  4KLB A;  3KKU A;  1Y4H A;  3O65 A;  1TL9 A;  4FK5 A;  4AXL A;  4XUI A;  3K24 A;  1ME3 A;  2H7J A;  4RKX A;  5J94 A;  3HHA A;  1SP4 B;  2AU1 A;  3PRM A;  4MI7 A;  1PE6 A;  3E9S A;  3AI8 A;  1BY8 A;  2E00 A;  4BOP A;  3V6E A;  2AGA A;  3RVW A;  3RVX A;  3IFU A;  3ZUA A;  2HHN A;  3WXF A;  5PAD A;  3QJ3 A;  4CDC B;  1TU6 A;  1EWM A;  3N3G A;  4MZS A;  4YYS A;  1MHW A;  3F75 A;  1NL6 A;  3CBK A;  5CVO B;  1CV8 A;  1AYU A;  3BOW A;  2YJ2 A;  3P5U A;  2ATO A;  1QOL A;  4OVZ B;  3P5W A;  1NB3 A;  1AEC A;  4PP1 A;  1AU0 A;  4OW0 A;  2P86 A;  3PT2 A;  1CS8 A;  1U9Q X;  4RNA A;  2UZJ A;  3P5V A;  4YYU A;  4OEM A;  3C0R A;  1PAD A;  3KWZ A;  3O1G A;  1SNK A;  5CVM A;  4FJC A;  4BS6 A;  4X6J A;  4BOQ A;  3ERV A;  2G8E A;  2YJ9 A;  3W30 A;  4BPV A;  1U9X A;  3GCB A;  2FRQ A;  3OF9 A;  3M99 A;  4QRV A;  1XKG A;  2OZ2 A;  2YJ8 A;  1NQC A;  3N4C A;  1PPD A;  3KWB X;  4WA6 A;  2DC8 A;  2C0Y A;  2DC6 A;  2CB5 A;  4IUM A;  1PXV A;  1AU2 A;  3D6S A;  1ICF A;  2Y6E A;  4BOU A;  3H6S A;  1MIR A;  1K3B B;  2WBF X;  4A5U A;  2FO5 A;  4YYQ A;  1CVZ A;  4D8B A;  1U5I A;  2VHF A;  1TLO A;  3LXS A;  1F29 A;  3MHH A;  2E02 A;  1GLO A;  2GHU A;  3K9M A;  4N79 A;  1S4V A;  3TMP A;  4YYW A;  3PSE A;  2J7Q A;  4Q8G A;  2AIM A;  3IV2 A;  4N4Z A;  1ITO A;  3OF8 A;  2R6N A;  2P0R A;  1MEM A;  3BPM A;  2PRE A;  2R9O A;  2BTW B;  2DZZ A;  2IBI A;  3KFQ A;  3OIS A;  2DJG B;  1EF7 A;  1PIP A;  1UKF A;  1AU4 A;  2JQG R;  3V6C A;  5JZE A;  4W5C A;  2DZY A;  3RNV A;  3MTN A;  3TNX A;  2AVW A;  1KXR A;  4PT5 A;  3S3Q A;  1KFX L;  2PBH A;  1GEC E;  2NQG A;  4I04 A;  3F5V A;  1STF E;  1JQP A;  2B1N A;  4CZW A;  2F1G A;  3BBA A;  4WUR A;  5EZQ A;  3QSD A;  2O6X A; 
#chains in the Genus database with same CATH homology
 1PCI A;  2CIO A;  4ZUX U;  1GMY A;  1CSB B;  1KHP A;  2FTD A;  3H8C A;  2HH5 A;  3I06 A;  1A6R A;  1KHQ A;  2ARY A;  3BPF A;  3H7D A;  2JQF R;  3N3K A;  3HWN A;  4PAD A;  1F2B A;  2YJB A;  4CDD B;  2DCA A;  1QDQ A;  2AUX A;  1HUC B;  2DCC A;  2OP3 A;  4QH6 A;  7PCK A;  2NQA A;  9PAP A;  4W4U A;  1DF0 A;  5FPW A;  2XU4 A;  3BWK A;  3IOQ A;  2DJF B;  1CQD A;  2G6D A;  2R9N A;  3P5X A;  3PW3 A;  1YVB A;  3OVZ A;  1FH0 A;  5K16 A;  4CDE B;  4G54 A;  1YAL A;  1NPZ A;  1PPO A;  2BDZ A;  3KX1 A;  5JA7 A;  2VHS A;  2AYO A;  4QBB A;  4QRX A;  2XU1 A;  2FYE A;  5CVN B;  1M6D A;  3B79 A;  4X6I A;  1YK8 A;  4C5P A;  6PAD A;  2R9F A;  2AYN A;  2G8J A;  1BGO A;  1EWP A;  1EWL A;  1QXP A;  4MZO A;  1YT7 A;  3LTW A;  4I07 A;  2IPP B;  2PNS A;  3O0U A;  2DC9 A;  4BS5 A;  2FUD A;  5F02 A;  1Q6K A;  2XU5 A;  4HWY A;  4YYR A;  5A24 A;  4RY2 A;  4FIP A;  5EGW A;  2ACT A;  1ZIV A;  4DMX A;  2B1M A;  1KFU L;  3WXE A;  3CBJ A;  2AS8 A;  4P6G A;  3NHE A;  2E03 A;  3H8B A;  2FRA A;  1ATK A;  4YYV A;  4I05 A;  4PP2 E;  2OUL A;  1ZCM A;  1BP4 A;  4MSX A;  2DCB A;  2PAD A;  4YV8 A;  3H89 A;  1PPN A;  2R9M A;  1GCB A;  3IMA A;  4DMY A;  5JH3 A;  3BCN A;  2AUZ A;  2F7D A;  1AYV A;  3USV A;  1F2A A;  4X6H A;  1POP A;  2E01 A;  4BQV A;  1THE A;  1VSN A;  4YVA A;  1BQI A;  2DC7 A;  1AU3 A;  3KSE A;  1GX3 A;  1CB5 A;  1O0E A;  1QMY A;  2DCD A;  2G7Y A;  1Y08 A;  4W5B A;  3I3T A;  2FT2 A;  4NV8 A;  4BSQ A;  3LFY A;  3C9E A;  3IUT A;  2VFC A;  2YJC A;  3E1Z B;  1MDW A;  2NQI A;  1CPJ A;  1VJV A;  4OEL A;  4Q8H A;  2NQD B;  3MOR A;  1NLJ A;  3WXG A;  3CH2 X;  4QRG A;  1CTE A;  1ME4 A;  2GFO A;  3U8E A;  1X9Y A;  4XR7 A;  2BDL A;  1AIM A;  1PPP A;  5CHT A;  3IEJ A;  1NB5 A;  2XU3 A;  1DEU A;  3S3R A;  3HHI A;  5CHV A;  3KW9 A;  3PNR A;  1F2C A;  3K8U A;  2Y5B A;  3HD3 A;  3OVX A;  3IHP A;  2VFB A;  3PDF A;  4CDF B;  5EF4 A;  1U9W A;  4AXM A;  3BC3 A;  3PBH A;  3DF0 A;  4P6E A;  3CH3 X;  2FQ9 A;  2HD5 A;  4K7C A;  1MS6 A;  8PCH A;  2HXZ A;  1U9V A;  1IWD A;  2P7U A;  1W6F A;  1MEG A;  1AYW A;  1EWO A;  1YK7 A;  3MHS A;  3QT4 A;  4B55 A;  2R9C A;  4PI3 A;  4N8W A;  1CJL A;  3RVV A;  1PBH A;  4KLB A;  3KKU A;  1Y4H A;  1TL9 A;  4FK5 A;  4AXL A;  4XUI A;  3K24 A;  1ME3 A;  2H7J A;  5J94 A;  3HHA A;  1SP4 B;  2AU1 A;  1PE6 A;  3AI8 A;  1BY8 A;  2E00 A;  3V6E A;  3RVW A;  3RVX A;  3ZUA A;  2HHN A;  3WXF A;  5PAD A;  3QJ3 A;  4CDC B;  1W5R A;  1TU6 A;  1EWM A;  3N3G A;  4MZS A;  4YYS A;  1MHW A;  3F75 A;  1NL6 A;  3CBK A;  5CVO B;  1CV8 A;  1AYU A;  3BOW A;  2YJ2 A;  3P5U A;  2ATO A;  1QOL A;  3P5W A;  1NB3 A;  1AEC A;  4PP1 A;  1AU0 A;  1E2T A;  2P86 A;  1CS8 A;  1U9Q X;  3P5V A;  4YYU A;  4GUZ A;  4OEM A;  1PAD A;  3KWZ A;  3O1G A;  1SNK A;  5CVM A;  4FJC A;  4BS6 A;  4X6J A;  4NV7 A;  3ERV A;  2G8E A;  2YJ9 A;  4BPV A;  1U9X A;  3GCB A;  2FRQ A;  3OF9 A;  3M99 A;  4QRV A;  1XKG A;  2OZ2 A;  2YJ8 A;  1NQC A;  3N4C A;  1PPD A;  3KWB X;  4WA6 A;  2DC8 A;  2C0Y A;  2DC6 A;  2CB5 A;  1PXV A;  3D9W A;  1AU2 A;  3D6S A;  1ICF A;  2Y6E A;  3H6S A;  1MIR A;  1K3B B;  2WBF X;  2FO5 A;  4YYQ A;  1CVZ A;  1U5I A;  2VHF A;  1TLO A;  3LXS A;  1F29 A;  3MHH A;  2E02 A;  1GLO A;  2GHU A;  3K9M A;  4N79 A;  1S4V A;  4YYW A;  4Q8G A;  2AIM A;  3IV2 A;  4N4Z A;  1ITO A;  3OF8 A;  2R6N A;  2P0R A;  1MEM A;  3BPM A;  2PRE A;  2R9O A;  2DZZ A;  2IBI A;  3KFQ A;  3OIS A;  2DJG B;  1EF7 A;  1PIP A;  1AU4 A;  2JQG R;  3V6C A;  4W5C A;  2DZY A;  3MTN A;  3TNX A;  2AVW A;  1KXR A;  1W4T A;  3S3Q A;  1KFX L;  2PBH A;  1GEC E;  2NQG A;  4I04 A;  3F5V A;  1STF E;  1JQP A;  2B1N A;  4CZW A;  2F1G A;  3QSD A;  2BSZ A;  4BGF A;  2O6X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...