3QSDA

Structure of cathepsin b1 from schistosoma mansoni in complex with ca074 inhibitor
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
253
structure length
253
Chain Sequence
EIPSSFDSRKKWPRCKSIATIRDQSRCGSCWAFGAVEAMSDRSCIQSGGKQNVELSAVDLLSCCESCGLGCEGGILGPAWDYWVKEGIVTGSSKENHAGCEPYPFPKCEHHTKGKYPPCGSKIYKTPRCKQTCQKKYKTPYTQDKHRGKSSYNVKNDEKAIQKEIMKYGPVEAGFTVYEDFLNYKSGIYKHITGETLGGHAIRIIGWGVENKAPYWLIANSWNEDWGENGYFRIVRGRDECSIESEVTAGRIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Inhibition of Cathepsin B Drug Target from the Human Blood Fluke, Schistosoma mansoni.
pubmed doi rcsb
source organism Schistosoma mansoni
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cathepsin B-like peptidase (C01 family)
total genus 87
structure length 253
sequence length 253
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2011-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3qsdA00
1QXPA 2B1MA 1ICFA 3CH3X 1PADA 3IEJA 1KHQA 2XU5A 1PPOA 4W4UA 3IOQA 2E01A 1U9QX 5A24A 1EWPA 3S3RA 3KW9A 3BCNA 3H7DA 1AU2A 2HD5A 4CDDB 2P0RA 2AYNA 3PBHA 3LFYA 1NB3A 2BDLA 1AECA 3MTNA 1F2BA 4BS5A 5CHVA 1DEUA 5PADA 4CDFB 1AYWA 3BWKA 3N3GA 1F2AA 1CV8A 2HXZA 4HWYA 4P6GA 5CHTA 3OVZA 3N4CA 1ATKA 3OISA 1F29A 1U9XA 3PDFA 4X6IA 1FH0A 3F5VA 1CB5A 2OZ2A 4YVAA 3KWBX 2FRAA 3MHHA 3ERVA 3E1ZB 2F1GA 2F7DA 1PXVA 2R9CA 3LXSA 4PP2E 2E00A 5K16A 2H7JA 3V6CA 2DCCA 4XUIA 1GLOA 4BPVA 4CDCB 4YYWA 4DMYA 2R6NA 3H8CA 3PNRA 2DC8A 4I05A 4PI3A 7PCKA 2AUZA 3K8UA 4YYQA 1PE6A 3OF9A 3USVA 1KXRA 1NLJA 1AU3A 1CPJA 2JQFR 3MHSA 4N79A 2O6XA 2NQIA 2VHFA 4KLBA 2NQAA 4G54A 4FIPA 1S4VA 1A6RA 4FK5A 4MSXA 2GFOA 3P5WA 5J94A 1TL9A 1AIMA 3I06A 2E03A 1NL6A 4YYRA 1U5IA 1PPPA 5FPWA 1ME3A 3P5VA 3CBKA 4BSQA 1PPNA 2DZZA 1GMYA 1MS6A 1Y4HA 3RVWA 1EWMA 1M6DA 1BP4A 2BDZA 2XU3A 3F75A 2DC6A 3O0UA 1ITOA 4YV8A 1MDWA 6PADA 4I07A 4YYSA 1KFXL 3GCBA 1QDQA 4CDEB 1AU4A 4W5BA 1GECE 1MEGA 2HHNA 3H8BA 1CQDA 4BS6A 3V6EA 4N4ZA 2AVWA 2OP3A 4Q8HA 1GCBA 2XU1A 2DZYA 1AYVA 1NB5A 1VJVA 2DJGB 4RY2A 1QMYA 3PW3A 2FTDA 3DF0A 2IPPB 5CVNB 4CZWA 1CTEA 2YJBA 2C0YA 4P6EA 2CIOA 2R9FA 1YT7A 1TU6A 1YK7A 1BGOA 3D6SA 4W5CA 1YVBA 1CS8A 1THEA 3P5UA 4AXMA 5CVMA 1MEMA 2HH5A 1DF0A 4YYVA 2FYEA 4YYUA 1Q6KA 4MZOA 2YJ8A 1JQPA 1U9VA 3K24A 1KHPA 2DC9A 1ZIVA 2G8JA 5EGWA 3BOWA 4QRGA 9PAPA 1EF7A 1KFUL 1PCIA 2XU4A 4QRXA 4Q8GA 3IMAA 2B1NA 2PREA 2DCDA 3S3QA 2G6DA 1YALA 2AYOA 4PADA 4WA6A 4QBBA 3WXGA 2P86A 3WXEA 4BQVA 3U8EA 3P5XA 2YJCA 3KX1A 1EWOA 5CVOB 1STFE 2FRQA 3WXFA 1NQCA 3HHIA 1Y08A 3B79A 3O1GA 4FJCA 2CB5A 2OULA 2P7UA 2AIMA 2R9OA 3KKUA 2G7YA 1MIRA 2FQ9A 3TNXA 1ZCMA 3RVVA 2DCAA 4I04A 3KWZA 4MZSA 1ME4A 2YJ9A 4DMXA 2FT2A 4ZUXU 1IWDA 3CBJA 3H6SA 2Y6EA 2NQDB 1MHWA 3I3TA 3NHEA 3QJ3A 4PP1A 1NPZA 3C9EA 2VHSA 3IV2A 1U9WA 4AXLA 3N3KA 2FUDA 4QH6A 3CH2X 5JA7A 2Y5BA 3HHAA 4N8WA 3RVXA 2G8EA 2NQGA 3H89A 1VSNA 3AI8A 4OEMA 8PCHA 4X6HA 2ARYA 2R9MA 1O0EA 2AU1A 3MORA 2ATOA 1K3BB 2AS8A 1EWLA 2DJFB 1PIPA 2PNSA 3K9MA 1POPA 3BC3A 3QT4A 1XKGA 3BPFA 3KFQA 1X9YA 1BQIA 1CJLA 2AUXA 3OF8A 1SP4B 2WBFX 3KSEA 1TLOA 5EF4A 2PADA 2PBHA 1PBHA 3IUTA 3ZUAA 1CVZA 1AYUA 3BPMA 3HD3A 5F02A 1F2CA 2GHUA 1PPDA 1HUCB 3QSDA 4QRVA 2ACTA 5JH3A 1CSBB 2E02A 1YK8A 3OVXA 4OELA 3M99A 3IHPA 4X6JA 2R9NA 2YJ2A 4XR7A 1BY8A 1QOLA 2FO5A 2DC7A 4K7CA 2IBIA 2DCBA 1AU0A 3HWNA 1SNKA 2JQGR
chains in the Genus database with same CATH superfamily
1QXPA 2B1MA 4RKXA 5EZSA 1ICFA 4RF1A 3CH3X 1PADA 3IEJA 1KHQA 2XU5A 1PPOA 4HXDB 4W4UA 3IOQA 2E01A 1U9QX 4BOPA 5A24A 1EWPA 3S3RA 3KW9A 3BCNA 3H7DA 1AU2A 2HD5A 4CDDB 2P0RA 2AYNA 3PBHA 3LFYA 1NB3A 2BDLA 1AECA 3MTNA 1F2BA 4BS5A 5CHVA 1DEUA 5PADA 4CDFB 1AYWA 3BWKA 3N3GA 1F2AA 1CV8A 2HXZA 4HWYA 3MJ5A 4P6GA 5CHTA 3OVZA 3PRPA 3N4CA 4MI7A 5KO3A 1ATKA 3PHXA 3OISA 1F29A 1DKIA 1U9XA 3PDFA 4X6IA 1FH0A 3F5VA 1CB5A 3BB7A 2OZ2A 4YVAA 3KWBX 2FRAA 3MHHA 3ERVA 3E1ZB 2F1GA 2F7DA 1PXVA 2R9CA 3LXSA 4PP2E 2E00A 5K16A 1PVJA 2H7JA 3V6CA 2DCCA 4XZXA 1GLOA 4XUIA 3ZNHA 4BPVA 4CDCB 4YYWA 4DMYA 1UKFA 2R6NA 3H8CA 3PNRA 2DC8A 4I05A 4PI3A 7PCKA 2AUZA 3K8UA 4YYQA 2JRIA 1PE6A 3OF9A 3USVA 1KXRA 1NLJA 1AU3A 1CPJA 2JQFR 3MHSA 4N79A 4GUAA 2O6XA 2NQIA 2VHFA 4KLBA 2NQAA 4G54A 4FIPA 1S4VA 1A6RA 4FK5A 4MSXA 2GFOA 3P5WA 5J94A 1TL9A 1AIMA 3I06A 4IUMA 2E03A 1NL6A 4YYRA 4OW0A 1U5IA 1PPPA 5FPWA 1ME3A 3P5VA 3CBKA 3BBAA 4BSQA 3B21A 4R3DA 1PPNA 4BOQA 2DZZA 1GMYA 1MS6A 1Y4HA 3RVWA 1EWMA 1M6DA 1BP4A 2BDZA 2DOSA 2XU3A 3F75A 2DC6A 3O0UA 3PSEA 1ITOA 4D8IA 4YV8A 1MDWA 6PADA 4I07A 4YYSA 1KFXL 3GCBA 1QDQA 4CDEB 1AU4A 4W5BA 1GECE 1MEGA 4RF0A 2BTWB 1YZBA 2HHNA 1CQDA 3H8BA 2HWKA 2J7QC 4BS6A 3V6EA 4N4ZA 2AVWA 2BU3A 2OP3A 4Q8HA 1GCBA 2XU1A 2DZYA 1AYVA 1NB5A 1VJVA 2DJGB 4RY2A 1QMYA 3PW3A 2FTDA 3DF0A 3RNVA 2JTCA 2IPPB 5CVNB 4CZWA 1CTEA 2YJBA 3C0RA 2C0YA 4P6EA 3BY4A 2CIOA 2R9FA 1YT7A 1TU6A 1YK7A 4OVZB 1BGOA 3D6SA 4W5CA 1YVBA 1CS8A 1THEA 3P5UA 4AXMA 5CVMA 1MEMA 2HH5A 1DF0A 4YYVA 2FYEA 4YYUA 1Q6KA 4MZOA 2YJ8A 1JQPA 1U9VA 3K24A 1KHPA 2DC9A 1ZIVA 4IP3A 2G8JA 5EGWA 3BOWA 3IFUA 4D8EA 4QRGA 9PAPA 3PHWA 1EF7A 1KFUL 1PCIA 2XU4A 4QRXA 4Q8GA 4A5UA 3OQCA 4RNAA 3IMAA 2B1NA 2PREA 2DCDA 3S3QA 4BOUA 2G6DA 5E6JA 1YALA 2AYOA 4PADA 4WA6A 4QBBA 3WXGA 4OVZA 2P86A 3WXEA 4BQVA 3U8EA 3P5XA 2YJCA 3KX1A 1EWOA 5CVOB 1STFE 2FRQA 3WXFA 1NQCA 3HHIA 4BOSA 1Y08A 2UZJA 3B79A 3O1GA 4FJCA 2CB5A 3MTVA 2OULA 2P7UA 2AIMA 2R9OA 3KKUA 2AGAA 4D8BA 2G7YA 1MIRA 2FQ9A 3TNXA 1ZCMA 2BTWA 3RVVA 2DCAA 4I04A 3KWZA 4M0WA 4MZSA 1ME4A 3PHUA 2YJ9A 4DMXA 4BOZA 2FT2A 4ZUXU 1IWDA 5EZQA 3CBJA 3H6SA 2Y6EA 2NQDB 1MHWA 3MP2A 4P16A 3TMPA 3I3TA 3NHEA 3QJ3A 4PP1A 1NPZA 3C9EA 2VHSA 3IV2A 1U9WA 3E9SA 4AXLA 3N3KA 2FUDA 4QH6A 3CH2X 5JA7A 2Y5BA 3HHAA 3O65A 4N8WA 3RVXA 2G8EA 2NQGA 3H89A 1VSNA 3AI8A 4OEMA 8PCHA 4ZTBA 4X6HA 2ARYA 2R9MA 1O0EA 2AU1A 2FE8A 3MORA 3PT2A 2ATOA 3PRMA 2J7QA 1K3BB 2AS8A 1EWLA 3TRKA 2DJFB 1PIPA 4REZA 2PNSA 3K9MA 1POPA 2Z84A 3BC3A 3QT4A 1XKGA 3BPFA 3KFQA 1X9YA 1BQIA 1CJLA 2AUXA 3OF8A 1SP4B 4WURA 2WBFX 3KSEA 1TLOA 5EF4A 2PADA 2PBHA 1PBHA 3IUTA 3ZUAA 1CVZA 1AYUA 3BPMA 3HD3A 5F02A 1F2CA 4MM3B 3W30A 2GHUA 5JZEA 3W31A 1PPDA 1HUCB 3QSDA 4QRVA 2ACTA 5JH3A 1CSBB 2E02A 1YK8A 3OVXA 4OELA 3M99A 3IHPA 4X6JA 2R9NA 2YJ2A 4XR7A 1BY8A 1QOLA 2FO5A 4PT5A 2DC7A 4K7CA 2IBIA 2DCBA 1AU0A 3HWNA 1SNKA 2JQGR
chains in the Genus database with same CATH topology
1QXPA 2B1MA 1ICFA 3CH3X 1PADA 1W5RA 3IEJA 1KHQA 2XU5A 1PPOA 4W4UA 3IOQA 2E01A 1U9QX 5A24A 1EWPA 3S3RA 3KW9A 3BCNA 3H7DA 1AU2A 2HD5A 4CDDB 2P0RA 2AYNA 3PBHA 3LFYA 1NB3A 2BDLA 1AECA 3MTNA 1F2BA 4BS5A 5CHVA 1DEUA 5PADA 4CDFB 1AYWA 3BWKA 3N3GA 1F2AA 1CV8A 2HXZA 4HWYA 4P6GA 5CHTA 3OVZA 3N4CA 4BGFA 1ATKA 3OISA 4B55A 3D9WA 1F29A 1U9XA 3PDFA 4X6IA 1FH0A 3F5VA 1CB5A 2OZ2A 4YVAA 3KWBX 2FRAA 3MHHA 3ERVA 3E1ZB 2F1GA 2F7DA 1PXVA 2R9CA 3LXSA 4PP2E 2E00A 5K16A 2H7JA 3V6CA 3LTWA 2DCCA 4XUIA 1GLOA 4BPVA 4CDCB 2VFCA 4YYWA 4DMYA 2R6NA 3H8CA 3PNRA 2DC8A 4I05A 4PI3A 7PCKA 2AUZA 3K8UA 4YYQA 1PE6A 3OF9A 3USVA 1KXRA 1NLJA 1AU3A 1CPJA 2JQFR 3MHSA 4N79A 2O6XA 2NQIA 2VHFA 4KLBA 2NQAA 4G54A 4FIPA 1S4VA 1A6RA 4FK5A 4MSXA 2GFOA 3P5WA 5J94A 1TL9A 1AIMA 3I06A 2E03A 1NL6A 4YYRA 1U5IA 1PPPA 5FPWA 1ME3A 3P5VA 3CBKA 4BSQA 1PPNA 2DZZA 1GMYA 1MS6A 4GUZA 1Y4HA 3RVWA 1EWMA 1M6DA 1BP4A 2BDZA 2XU3A 3F75A 2DC6A 3O0UA 1ITOA 4YV8A 4C5PA 1MDWA 6PADA 4I07A 4YYSA 1KFXL 3GCBA 1QDQA 4CDEB 1AU4A 4W5BA 1GECE 1MEGA 2HHNA 3H8BA 1CQDA 4BS6A 3V6EA 4N4ZA 2AVWA 2OP3A 4Q8HA 1GCBA 2XU1A 2DZYA 1AYVA 1NB5A 1VJVA 2DJGB 4RY2A 1GX3A 1QMYA 3PW3A 2FTDA 3DF0A 2IPPB 5CVNB 4CZWA 1CTEA 2YJBA 2C0YA 4P6EA 2CIOA 2R9FA 1YT7A 1TU6A 1YK7A 1BGOA 3D6SA 4W5CA 1YVBA 1CS8A 1THEA 3P5UA 4AXMA 5CVMA 1MEMA 2HH5A 1DF0A 4YYVA 2FYEA 4YYUA 1Q6KA 4MZOA 2YJ8A 1JQPA 1U9VA 3K24A 1KHPA 2DC9A 1ZIVA 2G8JA 5EGWA 3BOWA 4QRGA 9PAPA 1EF7A 1KFUL 1PCIA 2XU4A 4QRXA 4Q8GA 3IMAA 2B1NA 1W4TA 2PREA 2DCDA 3S3QA 2G6DA 1YALA 2AYOA 4PADA 4WA6A 4QBBA 3WXGA 2VFBA 2P86A 3WXEA 4BQVA 3U8EA 3P5XA 2YJCA 3KX1A 1EWOA 5CVOB 1STFE 2FRQA 3WXFA 1NQCA 3HHIA 1Y08A 3B79A 3O1GA 4FJCA 2CB5A 2OULA 2P7UA 2AIMA 2R9OA 3KKUA 2G7YA 1E2TA 1MIRA 2FQ9A 3TNXA 1ZCMA 3RVVA 2DCAA 4I04A 3KWZA 4MZSA 1ME4A 2YJ9A 4DMXA 2FT2A 4ZUXU 1IWDA 3CBJA 3H6SA 2Y6EA 2NQDB 1MHWA 4NV7A 3I3TA 3NHEA 3QJ3A 4PP1A 1NPZA 3C9EA 2VHSA 3IV2A 1U9WA 4AXLA 3N3KA 2FUDA 4QH6A 3CH2X 5JA7A 2Y5BA 3HHAA 4N8WA 3RVXA 2G8EA 2NQGA 3H89A 1VSNA 3AI8A 4OEMA 8PCHA 4X6HA 2ARYA 2R9MA 1O0EA 2AU1A 3MORA 2BSZA 2ATOA 1K3BB 2AS8A 1EWLA 2DJFB 1PIPA 2PNSA 3K9MA 1POPA 3BC3A 3QT4A 1XKGA 3BPFA 3KFQA 1X9YA 1BQIA 1CJLA 2AUXA 3OF8A 1SP4B 2WBFX 3KSEA 1TLOA 5EF4A 2PADA 2PBHA 1PBHA 3IUTA 3ZUAA 1CVZA 1AYUA 3BPMA 3HD3A 5F02A 1F2CA 2GHUA 1PPDA 1HUCB 3QSDA 4QRVA 2ACTA 5JH3A 1CSBB 2E02A 1YK8A 3OVXA 1W6FA 4OELA 3M99A 3IHPA 4X6JA 2R9NA 4NV8A 2YJ2A 4XR7A 1BY8A 1QOLA 2FO5A 2DC7A 4K7CA 2IBIA 2DCBA 1AU0A 3HWNA 1SNKA 2JQGR
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QXP A;  2B1M A;  1ICF A;  3CH3 X;  1PAD A;  3IEJ A;  1KHQ A;  2XU5 A;  1PPO A;  4W4U A;  3IOQ A;  2E01 A;  1U9Q X;  5A24 A;  1EWP A;  3S3R A;  3KW9 A;  3BCN A;  3H7D A;  1AU2 A;  2HD5 A;  4CDD B;  2P0R A;  2AYN A;  3PBH A;  3LFY A;  1NB3 A;  2BDL A;  1AEC A;  3MTN A;  1F2B A;  4BS5 A;  5CHV A;  1DEU A;  5PAD A;  4CDF B;  1AYW A;  3BWK A;  3N3G A;  1F2A A;  1CV8 A;  2HXZ A;  4HWY A;  4P6G A;  5CHT A;  3OVZ A;  3N4C A;  1ATK A;  3OIS A;  1F29 A;  1U9X A;  3PDF A;  4X6I A;  1FH0 A;  3F5V A;  1CB5 A;  2OZ2 A;  4YVA A;  3KWB X;  2FRA A;  3MHH A;  3ERV A;  3E1Z B;  2F1G A;  2F7D A;  1PXV A;  2R9C A;  3LXS A;  4PP2 E;  2E00 A;  5K16 A;  2H7J A;  3V6C A;  2DCC A;  4XUI A;  1GLO A;  4BPV A;  4CDC B;  4YYW A;  4DMY A;  2R6N A;  3H8C A;  3PNR A;  2DC8 A;  4I05 A;  4PI3 A;  7PCK A;  2AUZ A;  3K8U A;  4YYQ A;  1PE6 A;  3OF9 A;  3USV A;  1KXR A;  1NLJ A;  1AU3 A;  1CPJ A;  2JQF R;  3MHS A;  4N79 A;  2O6X A;  2NQI A;  2VHF A;  4KLB A;  2NQA A;  4G54 A;  4FIP A;  1S4V A;  1A6R A;  4FK5 A;  4MSX A;  2GFO A;  3P5W A;  5J94 A;  1TL9 A;  1AIM A;  3I06 A;  2E03 A;  1NL6 A;  4YYR A;  1U5I A;  1PPP A;  5FPW A;  1ME3 A;  3P5V A;  3CBK A;  4BSQ A;  1PPN A;  2DZZ A;  1GMY A;  1MS6 A;  1Y4H A;  3RVW A;  1EWM A;  1M6D A;  1BP4 A;  2BDZ A;  2XU3 A;  3F75 A;  2DC6 A;  3O0U A;  1ITO A;  4YV8 A;  1MDW A;  6PAD A;  4I07 A;  4YYS A;  1KFX L;  3GCB A;  1QDQ A;  4CDE B;  1AU4 A;  4W5B A;  1GEC E;  1MEG A;  2HHN A;  3H8B A;  1CQD A;  4BS6 A;  3V6E A;  4N4Z A;  2AVW A;  2OP3 A;  4Q8H A;  1GCB A;  2XU1 A;  2DZY A;  1AYV A;  1NB5 A;  1VJV A;  2DJG B;  4RY2 A;  1QMY A;  3PW3 A;  2FTD A;  3DF0 A;  2IPP B;  5CVN B;  4CZW A;  1CTE A;  2YJB A;  2C0Y A;  4P6E A;  2CIO A;  2R9F A;  1YT7 A;  1TU6 A;  1YK7 A;  1BGO A;  3D6S A;  4W5C A;  1YVB A;  1CS8 A;  1THE A;  3P5U A;  4AXM A;  5CVM A;  1MEM A;  2HH5 A;  1DF0 A;  4YYV A;  2FYE A;  4YYU A;  1Q6K A;  4MZO A;  2YJ8 A;  1JQP A;  1U9V A;  3K24 A;  1KHP A;  2DC9 A;  1ZIV A;  2G8J A;  5EGW A;  3BOW A;  4QRG A;  9PAP A;  1EF7 A;  1KFU L;  1PCI A;  2XU4 A;  4QRX A;  4Q8G A;  3IMA A;  2B1N A;  2PRE A;  2DCD A;  3S3Q A;  2G6D A;  1YAL A;  2AYO A;  4PAD A;  4WA6 A;  4QBB A;  3WXG A;  2P86 A;  3WXE A;  4BQV A;  3U8E A;  3P5X A;  2YJC A;  3KX1 A;  1EWO A;  5CVO B;  1STF E;  2FRQ A;  3WXF A;  1NQC A;  3HHI A;  1Y08 A;  3B79 A;  3O1G A;  4FJC A;  2CB5 A;  2OUL A;  2P7U A;  2AIM A;  2R9O A;  3KKU A;  2G7Y A;  1MIR A;  2FQ9 A;  3TNX A;  1ZCM A;  3RVV A;  2DCA A;  4I04 A;  3KWZ A;  4MZS A;  1ME4 A;  2YJ9 A;  4DMX A;  2FT2 A;  4ZUX U;  1IWD A;  3CBJ A;  3H6S A;  2Y6E A;  2NQD B;  1MHW A;  3I3T A;  3NHE A;  3QJ3 A;  4PP1 A;  1NPZ A;  3C9E A;  2VHS A;  3IV2 A;  1U9W A;  4AXL A;  3N3K A;  2FUD A;  4QH6 A;  3CH2 X;  5JA7 A;  2Y5B A;  3HHA A;  4N8W A;  3RVX A;  2G8E A;  2NQG A;  3H89 A;  1VSN A;  3AI8 A;  4OEM A;  8PCH A;  4X6H A;  2ARY A;  2R9M A;  1O0E A;  2AU1 A;  3MOR A;  2ATO A;  1K3B B;  2AS8 A;  1EWL A;  2DJF B;  1PIP A;  2PNS A;  3K9M A;  1POP A;  3BC3 A;  3QT4 A;  1XKG A;  3BPF A;  3KFQ A;  1X9Y A;  1BQI A;  1CJL A;  2AUX A;  3OF8 A;  1SP4 B;  2WBF X;  3KSE A;  1TLO A;  5EF4 A;  2PAD A;  2PBH A;  1PBH A;  3IUT A;  3ZUA A;  1CVZ A;  1AYU A;  3BPM A;  3HD3 A;  5F02 A;  1F2C A;  2GHU A;  1PPD A;  1HUC B;  3QSD A;  4QRV A;  2ACT A;  5JH3 A;  1CSB B;  2E02 A;  1YK8 A;  3OVX A;  4OEL A;  3M99 A;  3IHP A;  4X6J A;  2R9N A;  2YJ2 A;  4XR7 A;  1BY8 A;  1QOL A;  2FO5 A;  2DC7 A;  4K7C A;  2IBI A;  2DCB A;  1AU0 A;  3HWN A;  1SNK A;  2JQG R; 
#chains in the Genus database with same CATH topology
 1QXP A;  2B1M A;  4RKX A;  5EZS A;  1ICF A;  4RF1 A;  3CH3 X;  1PAD A;  3IEJ A;  1KHQ A;  2XU5 A;  1PPO A;  4HXD B;  4W4U A;  3IOQ A;  2E01 A;  1U9Q X;  4BOP A;  5A24 A;  1EWP A;  3S3R A;  3KW9 A;  3BCN A;  3H7D A;  1AU2 A;  2HD5 A;  4CDD B;  2P0R A;  2AYN A;  3PBH A;  3LFY A;  1NB3 A;  2BDL A;  1AEC A;  3MTN A;  1F2B A;  4BS5 A;  5CHV A;  1DEU A;  5PAD A;  4CDF B;  1AYW A;  3BWK A;  3N3G A;  1F2A A;  1CV8 A;  2HXZ A;  4HWY A;  3MJ5 A;  4P6G A;  5CHT A;  3OVZ A;  3PRP A;  3N4C A;  4MI7 A;  5KO3 A;  1ATK A;  3PHX A;  3OIS A;  1F29 A;  1DKI A;  1U9X A;  3PDF A;  4X6I A;  1FH0 A;  3F5V A;  1CB5 A;  3BB7 A;  2OZ2 A;  4YVA A;  3KWB X;  2FRA A;  3MHH A;  3ERV A;  3E1Z B;  2F1G A;  2F7D A;  1PXV A;  2R9C A;  3LXS A;  4PP2 E;  2E00 A;  5K16 A;  1PVJ A;  2H7J A;  3V6C A;  2DCC A;  4XZX A;  1GLO A;  4XUI A;  3ZNH A;  4BPV A;  4CDC B;  4YYW A;  4DMY A;  1UKF A;  2R6N A;  3H8C A;  3PNR A;  2DC8 A;  4I05 A;  4PI3 A;  7PCK A;  2AUZ A;  3K8U A;  4YYQ A;  2JRI A;  1PE6 A;  3OF9 A;  3USV A;  1KXR A;  1NLJ A;  1AU3 A;  1CPJ A;  2JQF R;  3MHS A;  4N79 A;  4GUA A;  2O6X A;  2NQI A;  2VHF A;  4KLB A;  2NQA A;  4G54 A;  4FIP A;  1S4V A;  1A6R A;  4FK5 A;  4MSX A;  2GFO A;  3P5W A;  5J94 A;  1TL9 A;  1AIM A;  3I06 A;  4IUM A;  2E03 A;  1NL6 A;  4YYR A;  4OW0 A;  1U5I A;  1PPP A;  5FPW A;  1ME3 A;  3P5V A;  3CBK A;  3BBA A;  4BSQ A;  3B21 A;  4R3D A;  1PPN A;  4BOQ A;  2DZZ A;  1GMY A;  1MS6 A;  1Y4H A;  3RVW A;  1EWM A;  1M6D A;  1BP4 A;  2BDZ A;  2DOS A;  2XU3 A;  3F75 A;  2DC6 A;  3O0U A;  3PSE A;  1ITO A;  4D8I A;  4YV8 A;  1MDW A;  6PAD A;  4I07 A;  4YYS A;  1KFX L;  3GCB A;  1QDQ A;  4CDE B;  1AU4 A;  4W5B A;  1GEC E;  1MEG A;  4RF0 A;  2BTW B;  1YZB A;  2HHN A;  1CQD A;  3H8B A;  2HWK A;  2J7Q C;  4BS6 A;  3V6E A;  4N4Z A;  2AVW A;  2BU3 A;  2OP3 A;  4Q8H A;  1GCB A;  2XU1 A;  2DZY A;  1AYV A;  1NB5 A;  1VJV A;  2DJG B;  4RY2 A;  1QMY A;  3PW3 A;  2FTD A;  3DF0 A;  3RNV A;  2JTC A;  2IPP B;  5CVN B;  4CZW A;  1CTE A;  2YJB A;  3C0R A;  2C0Y A;  4P6E A;  3BY4 A;  2CIO A;  2R9F A;  1YT7 A;  1TU6 A;  1YK7 A;  4OVZ B;  1BGO A;  3D6S A;  4W5C A;  1YVB A;  1CS8 A;  1THE A;  3P5U A;  4AXM A;  5CVM A;  1MEM A;  2HH5 A;  1DF0 A;  4YYV A;  2FYE A;  4YYU A;  1Q6K A;  4MZO A;  2YJ8 A;  1JQP A;  1U9V A;  3K24 A;  1KHP A;  2DC9 A;  1ZIV A;  4IP3 A;  2G8J A;  5EGW A;  3BOW A;  3IFU A;  4D8E A;  4QRG A;  9PAP A;  3PHW A;  1EF7 A;  1KFU L;  1PCI A;  2XU4 A;  4QRX A;  4Q8G A;  4A5U A;  3OQC A;  4RNA A;  3IMA A;  2B1N A;  2PRE A;  2DCD A;  3S3Q A;  4BOU A;  2G6D A;  5E6J A;  1YAL A;  2AYO A;  4PAD A;  4WA6 A;  4QBB A;  3WXG A;  4OVZ A;  2P86 A;  3WXE A;  4BQV A;  3U8E A;  3P5X A;  2YJC A;  3KX1 A;  1EWO A;  5CVO B;  1STF E;  2FRQ A;  3WXF A;  1NQC A;  3HHI A;  4BOS A;  1Y08 A;  2UZJ A;  3B79 A;  3O1G A;  4FJC A;  2CB5 A;  3MTV A;  2OUL A;  2P7U A;  2AIM A;  2R9O A;  3KKU A;  2AGA A;  4D8B A;  2G7Y A;  1MIR A;  2FQ9 A;  3TNX A;  1ZCM A;  2BTW A;  3RVV A;  2DCA A;  4I04 A;  3KWZ A;  4M0W A;  4MZS A;  1ME4 A;  3PHU A;  2YJ9 A;  4DMX A;  4BOZ A;  2FT2 A;  4ZUX U;  1IWD A;  5EZQ A;  3CBJ A;  3H6S A;  2Y6E A;  2NQD B;  1MHW A;  3MP2 A;  4P16 A;  3TMP A;  3I3T A;  3NHE A;  3QJ3 A;  4PP1 A;  1NPZ A;  3C9E A;  2VHS A;  3IV2 A;  1U9W A;  3E9S A;  4AXL A;  3N3K A;  2FUD A;  4QH6 A;  3CH2 X;  5JA7 A;  2Y5B A;  3HHA A;  3O65 A;  4N8W A;  3RVX A;  2G8E A;  2NQG A;  3H89 A;  1VSN A;  3AI8 A;  4OEM A;  8PCH A;  4ZTB A;  4X6H A;  2ARY A;  2R9M A;  1O0E A;  2AU1 A;  2FE8 A;  3MOR A;  3PT2 A;  2ATO A;  3PRM A;  2J7Q A;  1K3B B;  2AS8 A;  1EWL A;  3TRK A;  2DJF B;  1PIP A;  4REZ A;  2PNS A;  3K9M A;  1POP A;  2Z84 A;  3BC3 A;  3QT4 A;  1XKG A;  3BPF A;  3KFQ A;  1X9Y A;  1BQI A;  1CJL A;  2AUX A;  3OF8 A;  1SP4 B;  4WUR A;  2WBF X;  3KSE A;  1TLO A;  5EF4 A;  2PAD A;  2PBH A;  1PBH A;  3IUT A;  3ZUA A;  1CVZ A;  1AYU A;  3BPM A;  3HD3 A;  5F02 A;  1F2C A;  4MM3 B;  3W30 A;  2GHU A;  5JZE A;  3W31 A;  1PPD A;  1HUC B;  3QSD A;  4QRV A;  2ACT A;  5JH3 A;  1CSB B;  2E02 A;  1YK8 A;  3OVX A;  4OEL A;  3M99 A;  3IHP A;  4X6J A;  2R9N A;  2YJ2 A;  4XR7 A;  1BY8 A;  1QOL A;  2FO5 A;  4PT5 A;  2DC7 A;  4K7C A;  2IBI A;  2DCB A;  1AU0 A;  3HWN A;  1SNK A;  2JQG R; 
#chains in the Genus database with same CATH homology
 1QXP A;  2B1M A;  1ICF A;  3CH3 X;  1PAD A;  1W5R A;  3IEJ A;  1KHQ A;  2XU5 A;  1PPO A;  4W4U A;  3IOQ A;  2E01 A;  1U9Q X;  5A24 A;  1EWP A;  3S3R A;  3KW9 A;  3BCN A;  3H7D A;  1AU2 A;  2HD5 A;  4CDD B;  2P0R A;  2AYN A;  3PBH A;  3LFY A;  1NB3 A;  2BDL A;  1AEC A;  3MTN A;  1F2B A;  4BS5 A;  5CHV A;  1DEU A;  5PAD A;  4CDF B;  1AYW A;  3BWK A;  3N3G A;  1F2A A;  1CV8 A;  2HXZ A;  4HWY A;  4P6G A;  5CHT A;  3OVZ A;  3N4C A;  4BGF A;  1ATK A;  3OIS A;  4B55 A;  3D9W A;  1F29 A;  1U9X A;  3PDF A;  4X6I A;  1FH0 A;  3F5V A;  1CB5 A;  2OZ2 A;  4YVA A;  3KWB X;  2FRA A;  3MHH A;  3ERV A;  3E1Z B;  2F1G A;  2F7D A;  1PXV A;  2R9C A;  3LXS A;  4PP2 E;  2E00 A;  5K16 A;  2H7J A;  3V6C A;  3LTW A;  2DCC A;  4XUI A;  1GLO A;  4BPV A;  4CDC B;  2VFC A;  4YYW A;  4DMY A;  2R6N A;  3H8C A;  3PNR A;  2DC8 A;  4I05 A;  4PI3 A;  7PCK A;  2AUZ A;  3K8U A;  4YYQ A;  1PE6 A;  3OF9 A;  3USV A;  1KXR A;  1NLJ A;  1AU3 A;  1CPJ A;  2JQF R;  3MHS A;  4N79 A;  2O6X A;  2NQI A;  2VHF A;  4KLB A;  2NQA A;  4G54 A;  4FIP A;  1S4V A;  1A6R A;  4FK5 A;  4MSX A;  2GFO A;  3P5W A;  5J94 A;  1TL9 A;  1AIM A;  3I06 A;  2E03 A;  1NL6 A;  4YYR A;  1U5I A;  1PPP A;  5FPW A;  1ME3 A;  3P5V A;  3CBK A;  4BSQ A;  1PPN A;  2DZZ A;  1GMY A;  1MS6 A;  4GUZ A;  1Y4H A;  3RVW A;  1EWM A;  1M6D A;  1BP4 A;  2BDZ A;  2XU3 A;  3F75 A;  2DC6 A;  3O0U A;  1ITO A;  4YV8 A;  4C5P A;  1MDW A;  6PAD A;  4I07 A;  4YYS A;  1KFX L;  3GCB A;  1QDQ A;  4CDE B;  1AU4 A;  4W5B A;  1GEC E;  1MEG A;  2HHN A;  3H8B A;  1CQD A;  4BS6 A;  3V6E A;  4N4Z A;  2AVW A;  2OP3 A;  4Q8H A;  1GCB A;  2XU1 A;  2DZY A;  1AYV A;  1NB5 A;  1VJV A;  2DJG B;  4RY2 A;  1GX3 A;  1QMY A;  3PW3 A;  2FTD A;  3DF0 A;  2IPP B;  5CVN B;  4CZW A;  1CTE A;  2YJB A;  2C0Y A;  4P6E A;  2CIO A;  2R9F A;  1YT7 A;  1TU6 A;  1YK7 A;  1BGO A;  3D6S A;  4W5C A;  1YVB A;  1CS8 A;  1THE A;  3P5U A;  4AXM A;  5CVM A;  1MEM A;  2HH5 A;  1DF0 A;  4YYV A;  2FYE A;  4YYU A;  1Q6K A;  4MZO A;  2YJ8 A;  1JQP A;  1U9V A;  3K24 A;  1KHP A;  2DC9 A;  1ZIV A;  2G8J A;  5EGW A;  3BOW A;  4QRG A;  9PAP A;  1EF7 A;  1KFU L;  1PCI A;  2XU4 A;  4QRX A;  4Q8G A;  3IMA A;  2B1N A;  1W4T A;  2PRE A;  2DCD A;  3S3Q A;  2G6D A;  1YAL A;  2AYO A;  4PAD A;  4WA6 A;  4QBB A;  3WXG A;  2VFB A;  2P86 A;  3WXE A;  4BQV A;  3U8E A;  3P5X A;  2YJC A;  3KX1 A;  1EWO A;  5CVO B;  1STF E;  2FRQ A;  3WXF A;  1NQC A;  3HHI A;  1Y08 A;  3B79 A;  3O1G A;  4FJC A;  2CB5 A;  2OUL A;  2P7U A;  2AIM A;  2R9O A;  3KKU A;  2G7Y A;  1E2T A;  1MIR A;  2FQ9 A;  3TNX A;  1ZCM A;  3RVV A;  2DCA A;  4I04 A;  3KWZ A;  4MZS A;  1ME4 A;  2YJ9 A;  4DMX A;  2FT2 A;  4ZUX U;  1IWD A;  3CBJ A;  3H6S A;  2Y6E A;  2NQD B;  1MHW A;  4NV7 A;  3I3T A;  3NHE A;  3QJ3 A;  4PP1 A;  1NPZ A;  3C9E A;  2VHS A;  3IV2 A;  1U9W A;  4AXL A;  3N3K A;  2FUD A;  4QH6 A;  3CH2 X;  5JA7 A;  2Y5B A;  3HHA A;  4N8W A;  3RVX A;  2G8E A;  2NQG A;  3H89 A;  1VSN A;  3AI8 A;  4OEM A;  8PCH A;  4X6H A;  2ARY A;  2R9M A;  1O0E A;  2AU1 A;  3MOR A;  2BSZ A;  2ATO A;  1K3B B;  2AS8 A;  1EWL A;  2DJF B;  1PIP A;  2PNS A;  3K9M A;  1POP A;  3BC3 A;  3QT4 A;  1XKG A;  3BPF A;  3KFQ A;  1X9Y A;  1BQI A;  1CJL A;  2AUX A;  3OF8 A;  1SP4 B;  2WBF X;  3KSE A;  1TLO A;  5EF4 A;  2PAD A;  2PBH A;  1PBH A;  3IUT A;  3ZUA A;  1CVZ A;  1AYU A;  3BPM A;  3HD3 A;  5F02 A;  1F2C A;  2GHU A;  1PPD A;  1HUC B;  3QSD A;  4QRV A;  2ACT A;  5JH3 A;  1CSB B;  2E02 A;  1YK8 A;  3OVX A;  1W6F A;  4OEL A;  3M99 A;  3IHP A;  4X6J A;  2R9N A;  4NV8 A;  2YJ2 A;  4XR7 A;  1BY8 A;  1QOL A;  2FO5 A;  2DC7 A;  4K7C A;  2IBI A;  2DCB A;  1AU0 A;  3HWN A;  1SNK A;  2JQG R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...