3QSDA

Structure of cathepsin b1 from schistosoma mansoni in complex with ca074 inhibitor
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
253
structure length
253
Chain Sequence
b'EIPSSFDSRKKWPRCKSIATIRDQSRCGSCWAFGAVEAMSDRSCIQSGGKQNVELSAVDLLSCCESCGLGCEGGILGPAWDYWVKEGIVTGSSKENHAGCEPYPFPKCEHHTKGKYPPCGSKIYKTPRCKQTCQKKYKTPYTQDKHRGKSSYNVKNDEKAIQKEIMKYGPVEAGFTVYEDFLNYKSGIYKHITGETLGGHAIRIIGWGVENKAPYWLIANSWNEDWGENGYFRIVRGRDECSIESEVTAGRIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin B-like peptidase (C01 family)
publication title Structural Basis for Inhibition of Cathepsin B Drug Target from the Human Blood Fluke, Schistosoma mansoni.
pubmed doi rcsb
source organism Schistosoma mansoni
molecule tags Hydrolase/hydrolase inhibitor
total genus 87
structure length 253
sequence length 253
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2011-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3qsdA00
1YK8A 3MHHA 3OF8A 3P5UA 2G8EA 1FH0A 2YJBA 1CJLA 1F2BA 4FK5A 3TNXA 1QOLA 4CDFB 2DZYA 5JA7A 3USVA 1BY8A 2AS8A 5F02A 3GCBA 1BGOA 2JQGR 1GLOA 3H6SA 4YYUA 2JQFR 5FPWA 4YV8A 1PCIA 2GFOA 2P7UA 2B1NA 3BC3A 1CPJA 2R9FA 3C9EA 2BDLA 4RY2A 1MIRA 3H8BA 1Q6KA 3LFYA 2DCDA 3K8UA 4DMYA 4I05A 1PPNA 4MSXA 3NHEA 3HWNA 3BPFA 1MHWA 3WXGA 1PXVA 1F2CA 3CH2X 1MEMA 2Y6EA 2CIOA 4BQVA 2HH5A 3IHPA 3KWBX 4YYQA 1BQIA 1EWOA 3OF9A 1YK7A 1S4VA 3BWKA 4PADA 2DC7A 2ATOA 4OELA 2E02A 4OEMA 3BOWA 1GMYA 3MHSA 3B79A 2FYEA 7PCKA 1O0EA 1X9YA 3U8EA 4ZUXU 1XKGA 2OP3A 5J94A 1F2AA 2FRQA 3I3TA 1CV8A 1KHPA 4CZWA 1BP4A 4XR7A 3RVWA 4N4ZA 3KKUA 4Q8HA 2O6XA 1CQDA 3IV2A 2HXZA 4BSQA 1U9QX 8PCHA 1YT7A 2AU1A 4W5BA 5CVMA 4CDEB 2OULA 2FRAA 3AI8A 3IMAA 1TU6A 2R6NA 2DCCA 4YYRA 3PNRA 2F1GA 5CHVA 2FO5A 1PPPA 1ME4A 3QT4A 2DCAA 1NL6A 1PE6A 1AECA 5CVOB 4PP2E 4YYVA 1SP4B 1CVZA 1DEUA 3D6SA 1VSNA 2DC6A 2XU1A 3OVZA 3BPMA 4QBBA 1TLOA 1AIMA 1Y4HA 1U9WA 1GECE 4X6JA 2DCBA 2ACTA 3KW9A 1ME3A 3RVVA 1KXRA 3H8CA 1JQPA 2AIMA 2R9NA 1KHQA 1CB5A 1KFUL 1PPOA 2XU3A 4QRVA 2HHNA 2PREA 2ARYA 2YJ8A 4CDDB 1Y08A 1PIPA 2Y5BA 3K24A 1A6RA 1YVBA 4PI3A 3KWZA 1AU2A 3CH3X 1POPA 4AXLA 2AYNA 3ZUAA 1STFE 2PADA 3O0UA 1MS6A 1U9XA 3HHIA 1IWDA 3ERVA 2NQGA 4K7CA 5A24A 2VHFA 1MEGA 3E1ZB 2FTDA 2YJCA 1U9VA 1GCBA 4I07A 3LXSA 3IUTA 1QMYA 3HD3A 5EGWA 3V6EA 3BCNA 3QSDA 3H89A 1EWMA 2XU5A 3F75A 4KLBA 3KX1A 4HWYA 1AYUA 2R9CA 2OZ2A 1ZCMA 4WA6A 2NQDB 1NPZA 4G54A 4N79A 1CTEA 3S3QA 1ATKA 1F29A 3RVXA 5EF4A 4P6EA 2E00A 3F5VA 4I04A 3K9MA 1ICFA 1PPDA 4QH6A 4BS5A 3CBJA 2VHSA 1MDWA 1M6DA 2DJGB 4YVAA 5K16A 3IOQA 3QJ3A 2NQAA 1EF7A 3P5XA 2NQIA 4Q8GA 4QRGA 1AU4A 3IEJA 2IPPB 4MZSA 2E03A 2P86A 4BPVA 4XUIA 2B1MA 5PADA 2WBFX 1HUCB 4QRXA 1SNKA 4YYWA 1PBHA 3PW3A 2YJ9A 3WXFA 1QDQA 1AYVA 1EWPA 3P5VA 3DF0A 1NLJA 3H7DA 3PBHA 3M99A 1YALA 2FT2A 4P6GA 2IBIA 1ZIVA 2DC9A 2AUXA 4FIPA 2PNSA 3S3RA 1KFXL 4AXMA 1CSBB 3KFQA 1ITOA 1CS8A 4X6HA 1NB5A 1DF0A 3I06A 1AU0A 4W4UA 4X6IA 5CVNB 1K3BB 2PBHA 3N3KA 6PADA 2DZZA 3MORA 3KSEA 4N8WA 2DC8A 2R9OA 4BS6A 3PDFA 1TL9A 2AYOA 2AUZA 2YJ2A 2H7JA 4YYSA 1AYWA 9PAPA 4CDCB 1EWLA 4DMXA 2FQ9A 1U5IA 4W5CA 2R9MA 2DJFB 5JH3A 4FJCA 1NQCA 3N4CA 2G7YA 2XU4A 3N3GA 2G6DA 1THEA 2GHUA 2HD5A 3MTNA 2P0RA 4MZOA 1VJVA 3V6CA 3OVXA 3OISA 3O1GA 2FUDA 2G8JA 4PP1A 1AU3A 2AVWA 2CB5A 2F7DA 2BDZA 3P5WA 1PADA 3CBKA 1NB3A 3HHAA 3WXEA 5CHTA 1QXPA 2E01A 2C0YA
chains in the Genus database with same CATH superfamily
1YK8A 2UZJA 3MHHA 3OF8A 3P5UA 4OW0A 2G8EA 4OVZA 3MTVA 4IP3A 1FH0A 2YJBA 1CJLA 1F2BA 4FK5A 3TNXA 1QOLA 4CDFB 2DZYA 5JA7A 3USVA 3TMPA 1BY8A 2AS8A 5F02A 1DKIA 3GCBA 1BGOA 2JQGR 4D8BA 1GLOA 3H6SA 4YYUA 2JQFR 5FPWA 4YV8A 1PCIA 2GFOA 2P7UA 4HXDB 2B1NA 3BC3A 1CPJA 2R9FA 3C9EA 2BDLA 4RY2A 1MIRA 3H8BA 1Q6KA 3LFYA 2DCDA 3K8UA 4DMYA 4I05A 1PPNA 4MSXA 3NHEA 3HWNA 3BPFA 1MHWA 4XZXA 3WXGA 1PXVA 1F2CA 3CH2X 1MEMA 3BY4A 2Y6EA 3BB7A 2CIOA 4BQVA 4GUAA 2HH5A 3IHPA 3KWBX 4YYQA 1BQIA 2AGAA 1EWOA 3MJ5A 3OF9A 1YK7A 1S4VA 4D8IA 3BWKA 4PADA 2DC7A 2ATOA 4OELA 4RF0A 2E02A 4OEMA 3BOWA 1GMYA 3MHSA 3B79A 2FYEA 7PCKA 1O0EA 1X9YA 3U8EA 4ZUXU 1XKGA 2OP3A 5J94A 3PRMA 1F2AA 2FRQA 3I3TA 1CV8A 1KHPA 3B21A 4CZWA 1BP4A 4XR7A 3RVWA 4N4ZA 3KKUA 4Q8HA 2O6XA 1CQDA 3IV2A 2HXZA 4RNAA 4BSQA 1U9QX 8PCHA 1YT7A 2AU1A 4W5BA 4MI7A 5CVMA 4CDEB 4BOZA 2OULA 2FRAA 4BOUA 3AI8A 3IMAA 1TU6A 2R6NA 4BOSA 2DCCA 4YYRA 3PNRA 2F1GA 5CHVA 2FO5A 1PPPA 1ME4A 3PHUA 3QT4A 2DCAA 1NL6A 1PE6A 1AECA 5CVOB 4PP2E 4YYVA 1SP4B 1CVZA 1DEUA 3D6SA 1VSNA 2JRIA 2DC6A 2XU1A 3OVZA 3BPMA 4QBBA 1TLOA 1AIMA 1Y4HA 1U9WA 1GECE 4X6JA 2DCBA 2ACTA 3KW9A 1ME3A 3RVVA 1KXRA 3H8CA 1JQPA 2AIMA 2R9NA 4PT5A 2HWKA 1KHQA 1CB5A 1KFUL 1PPOA 2XU3A 4QRVA 2HHNA 2PREA 4REZA 2ARYA 2YJ8A 4OVZB 4CDDB 1Y08A 1PIPA 4D8EA 2Y5BA 3K24A 1A6RA 1YVBA 3OQCA 4PI3A 3KWZA 1AU2A 3CH3X 1POPA 4AXLA 3RNVA 1PVJA 2AYNA 3ZUAA 1STFE 4R3DA 2PADA 3O0UA 5JZEA 1MS6A 1U9XA 3HHIA 1IWDA 3ERVA 3W30A 2NQGA 4K7CA 5A24A 2VHFA 1MEGA 3E1ZB 2FTDA 2YJCA 1U9VA 1GCBA 2JTCA 4I07A 3LXSA 4IUMA 3IUTA 2J7QC 1QMYA 3HD3A 1YZBA 5EGWA 3V6EA 3BCNA 3QSDA 3H89A 3O65A 1EWMA 2XU5A 3F75A 2DOSA 4P16A 4KLBA 3KX1A 4HWYA 1AYUA 2R9CA 4BOPA 2OZ2A 1ZCMA 4WA6A 2NQDB 1NPZA 4G54A 4N79A 1CTEA 3S3QA 1ATKA 5EZQA 1F29A 3RVXA 2J7QA 5EF4A 4P6EA 2E00A 3F5VA 4I04A 3K9MA 1ICFA 1PPDA 4QH6A 4BS5A 3CBJA 2VHSA 1MDWA 1M6DA 2DJGB 4YVAA 5K16A 3IOQA 3QJ3A 2NQAA 5EZSA 5KO3A 1EF7A 3P5XA 2NQIA 4Q8GA 4QRGA 1AU4A 3IEJA 3TRKA 2IPPB 3E9SA 4MZSA 2E03A 2P86A 4BPVA 4XUIA 2B1MA 5PADA 2WBFX 1HUCB 4QRXA 1SNKA 4YYWA 2BTWA 1PBHA 3PW3A 2YJ9A 3WXFA 3ZNHA 1QDQA 1AYVA 1EWPA 3P5VA 3DF0A 1NLJA 3H7DA 3PBHA 3M99A 1YALA 4A5UA 2FT2A 4P6GA 2IBIA 1ZIVA 5E6JA 2DC9A 4WURA 2AUXA 2FE8A 4FIPA 2PNSA 3S3RA 3IFUA 1KFXL 4AXMA 1CSBB 3KFQA 1ITOA 1CS8A 4X6HA 1NB5A 1DF0A 3I06A 1AU0A 4W4UA 4X6IA 5CVNB 4ZTBA 1K3BB 3PRPA 2PBHA 2BTWB 3N3KA 6PADA 2DZZA 3MORA 3KSEA 3PT2A 3PHXA 4N8WA 2DC8A 2R9OA 4BS6A 3PDFA 1TL9A 2AYOA 2AUZA 2YJ2A 2H7JA 4YYSA 3PHWA 1AYWA 9PAPA 4CDCB 2BU3A 1EWLA 4DMXA 2FQ9A 1U5IA 3MP2A 4W5CA 4M0WA 2R9MA 2DJFB 1UKFA 5JH3A 4FJCA 1NQCA 3C0RA 4MM3B 3N4CA 3W31A 2G7YA 4RKXA 2XU4A 3N3GA 2G6DA 1THEA 2GHUA 2Z84A 2HD5A 3MTNA 2P0RA 4MZOA 1VJVA 3V6CA 3OVXA 3PSEA 3OISA 3O1GA 2FUDA 2G8JA 4PP1A 4BOQA 1AU3A 2AVWA 2CB5A 2F7DA 2BDZA 3P5WA 4RF1A 1PADA 3CBKA 1NB3A 3BBAA 3HHAA 3WXEA 5CHTA 1QXPA 2E01A 2C0YA
chains in the Genus database with same CATH topology
1YK8A 3MHHA 3OF8A 3P5UA 2G8EA 1FH0A 2YJBA 1CJLA 1F2BA 4FK5A 3TNXA 1QOLA 4CDFB 2DZYA 5JA7A 3USVA 1BY8A 2AS8A 5F02A 3GCBA 1BGOA 2JQGR 1GLOA 3H6SA 4YYUA 2JQFR 5FPWA 4YV8A 1PCIA 2GFOA 2P7UA 2B1NA 3BC3A 1CPJA 2R9FA 3C9EA 2BDLA 4RY2A 1MIRA 3H8BA 1Q6KA 3LFYA 2DCDA 3K8UA 4DMYA 4I05A 1PPNA 4MSXA 3NHEA 3HWNA 3BPFA 1MHWA 3WXGA 1PXVA 1F2CA 3CH2X 1MEMA 2Y6EA 1W5RA 2CIOA 4BQVA 2HH5A 3IHPA 3KWBX 4YYQA 1BQIA 1EWOA 3OF9A 1YK7A 1S4VA 3BWKA 4PADA 2DC7A 2ATOA 4OELA 2E02A 4OEMA 3BOWA 1GMYA 3MHSA 3B79A 2FYEA 7PCKA 1O0EA 1X9YA 3U8EA 4ZUXU 1XKGA 2OP3A 5J94A 1F2AA 2VFBA 2FRQA 3I3TA 1CV8A 1KHPA 4CZWA 1BP4A 4XR7A 3RVWA 4N4ZA 3KKUA 4Q8HA 2O6XA 1CQDA 3IV2A 2HXZA 4BSQA 1U9QX 8PCHA 1YT7A 2AU1A 4W5BA 5CVMA 4CDEB 2OULA 2FRAA 3AI8A 3IMAA 1TU6A 2R6NA 2DCCA 4YYRA 3PNRA 2F1GA 5CHVA 2FO5A 1PPPA 4GUZA 1ME4A 3QT4A 2DCAA 1NL6A 1PE6A 1AECA 5CVOB 4PP2E 4YYVA 1SP4B 1CVZA 1DEUA 3D6SA 1VSNA 2DC6A 2XU1A 3OVZA 3BPMA 4QBBA 1TLOA 1AIMA 1Y4HA 1U9WA 1GECE 4X6JA 2DCBA 2ACTA 3KW9A 1ME3A 3RVVA 1KXRA 3H8CA 1JQPA 2AIMA 2R9NA 1KHQA 1CB5A 1KFUL 1PPOA 2XU3A 4QRVA 2HHNA 2PREA 4NV7A 2ARYA 2YJ8A 4CDDB 1Y08A 1PIPA 2Y5BA 3K24A 1A6RA 2BSZA 1YVBA 4PI3A 3KWZA 1AU2A 3CH3X 1POPA 4AXLA 1W4TA 2AYNA 1E2TA 3ZUAA 1STFE 2PADA 3O0UA 1MS6A 1U9XA 3HHIA 1IWDA 3ERVA 2NQGA 4K7CA 5A24A 2VHFA 1MEGA 3E1ZB 2FTDA 2YJCA 1U9VA 1GCBA 4I07A 3LXSA 3IUTA 1QMYA 3HD3A 5EGWA 3V6EA 3BCNA 3QSDA 3H89A 1EWMA 2XU5A 4B55A 3F75A 4KLBA 3KX1A 4HWYA 1AYUA 2R9CA 2OZ2A 1ZCMA 4WA6A 2NQDB 1NPZA 4G54A 4N79A 1CTEA 3S3QA 1ATKA 1F29A 3RVXA 5EF4A 4P6EA 2E00A 3F5VA 4I04A 3K9MA 1ICFA 1PPDA 4QH6A 4BS5A 3CBJA 2VHSA 1MDWA 1M6DA 2DJGB 4YVAA 5K16A 3IOQA 3QJ3A 2NQAA 1EF7A 3P5XA 4C5PA 2NQIA 4Q8GA 4QRGA 1AU4A 3IEJA 2IPPB 4MZSA 2E03A 2P86A 4BPVA 4XUIA 2B1MA 5PADA 2WBFX 1HUCB 4QRXA 1SNKA 4YYWA 1PBHA 3PW3A 2YJ9A 3WXFA 1QDQA 1AYVA 1EWPA 3P5VA 3DF0A 1W6FA 1NLJA 3H7DA 3PBHA 3M99A 1YALA 3D9WA 2FT2A 4P6GA 2IBIA 1ZIVA 2DC9A 2AUXA 3LTWA 4FIPA 2PNSA 3S3RA 1KFXL 4AXMA 1CSBB 3KFQA 1ITOA 1CS8A 4X6HA 1NB5A 1DF0A 3I06A 1AU0A 4W4UA 4X6IA 5CVNB 1GX3A 1K3BB 2PBHA 3N3KA 6PADA 2DZZA 3MORA 3KSEA 4N8WA 2DC8A 2R9OA 4BS6A 3PDFA 1TL9A 2AYOA 2AUZA 2VFCA 2YJ2A 2H7JA 4YYSA 1AYWA 9PAPA 4CDCB 4BGFA 1EWLA 4DMXA 2FQ9A 1U5IA 4W5CA 2R9MA 2DJFB 5JH3A 4FJCA 1NQCA 3N4CA 2G7YA 2XU4A 3N3GA 2G6DA 1THEA 2GHUA 2HD5A 3MTNA 2P0RA 4MZOA 1VJVA 3V6CA 3OVXA 3OISA 3O1GA 2FUDA 2G8JA 4PP1A 1AU3A 2AVWA 2CB5A 2F7DA 2BDZA 3P5WA 1PADA 3CBKA 1NB3A 4NV8A 3HHAA 3WXEA 5CHTA 1QXPA 2E01A 2C0YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YK8 A;  3MHH A;  3OF8 A;  3P5U A;  2G8E A;  1FH0 A;  2YJB A;  1CJL A;  1F2B A;  4FK5 A;  3TNX A;  1QOL A;  4CDF B;  2DZY A;  5JA7 A;  3USV A;  1BY8 A;  2AS8 A;  5F02 A;  3GCB A;  1BGO A;  2JQG R;  1GLO A;  3H6S A;  4YYU A;  2JQF R;  5FPW A;  4YV8 A;  1PCI A;  2GFO A;  2P7U A;  2B1N A;  3BC3 A;  1CPJ A;  2R9F A;  3C9E A;  2BDL A;  4RY2 A;  1MIR A;  3H8B A;  1Q6K A;  3LFY A;  2DCD A;  3K8U A;  4DMY A;  4I05 A;  1PPN A;  4MSX A;  3NHE A;  3HWN A;  3BPF A;  1MHW A;  3WXG A;  1PXV A;  1F2C A;  3CH2 X;  1MEM A;  2Y6E A;  2CIO A;  4BQV A;  2HH5 A;  3IHP A;  3KWB X;  4YYQ A;  1BQI A;  1EWO A;  3OF9 A;  1YK7 A;  1S4V A;  3BWK A;  4PAD A;  2DC7 A;  2ATO A;  4OEL A;  2E02 A;  4OEM A;  3BOW A;  1GMY A;  3MHS A;  3B79 A;  2FYE A;  7PCK A;  1O0E A;  1X9Y A;  3U8E A;  4ZUX U;  1XKG A;  2OP3 A;  5J94 A;  1F2A A;  2FRQ A;  3I3T A;  1CV8 A;  1KHP A;  4CZW A;  1BP4 A;  4XR7 A;  3RVW A;  4N4Z A;  3KKU A;  4Q8H A;  2O6X A;  1CQD A;  3IV2 A;  2HXZ A;  4BSQ A;  1U9Q X;  8PCH A;  1YT7 A;  2AU1 A;  4W5B A;  5CVM A;  4CDE B;  2OUL A;  2FRA A;  3AI8 A;  3IMA A;  1TU6 A;  2R6N A;  2DCC A;  4YYR A;  3PNR A;  2F1G A;  5CHV A;  2FO5 A;  1PPP A;  1ME4 A;  3QT4 A;  2DCA A;  1NL6 A;  1PE6 A;  1AEC A;  5CVO B;  4PP2 E;  4YYV A;  1SP4 B;  1CVZ A;  1DEU A;  3D6S A;  1VSN A;  2DC6 A;  2XU1 A;  3OVZ A;  3BPM A;  4QBB A;  1TLO A;  1AIM A;  1Y4H A;  1U9W A;  1GEC E;  4X6J A;  2DCB A;  2ACT A;  3KW9 A;  1ME3 A;  3RVV A;  1KXR A;  3H8C A;  1JQP A;  2AIM A;  2R9N A;  1KHQ A;  1CB5 A;  1KFU L;  1PPO A;  2XU3 A;  4QRV A;  2HHN A;  2PRE A;  2ARY A;  2YJ8 A;  4CDD B;  1Y08 A;  1PIP A;  2Y5B A;  3K24 A;  1A6R A;  1YVB A;  4PI3 A;  3KWZ A;  1AU2 A;  3CH3 X;  1POP A;  4AXL A;  2AYN A;  3ZUA A;  1STF E;  2PAD A;  3O0U A;  1MS6 A;  1U9X A;  3HHI A;  1IWD A;  3ERV A;  2NQG A;  4K7C A;  5A24 A;  2VHF A;  1MEG A;  3E1Z B;  2FTD A;  2YJC A;  1U9V A;  1GCB A;  4I07 A;  3LXS A;  3IUT A;  1QMY A;  3HD3 A;  5EGW A;  3V6E A;  3BCN A;  3QSD A;  3H89 A;  1EWM A;  2XU5 A;  3F75 A;  4KLB A;  3KX1 A;  4HWY A;  1AYU A;  2R9C A;  2OZ2 A;  1ZCM A;  4WA6 A;  2NQD B;  1NPZ A;  4G54 A;  4N79 A;  1CTE A;  3S3Q A;  1ATK A;  1F29 A;  3RVX A;  5EF4 A;  4P6E A;  2E00 A;  3F5V A;  4I04 A;  3K9M A;  1ICF A;  1PPD A;  4QH6 A;  4BS5 A;  3CBJ A;  2VHS A;  1MDW A;  1M6D A;  2DJG B;  4YVA A;  5K16 A;  3IOQ A;  3QJ3 A;  2NQA A;  1EF7 A;  3P5X A;  2NQI A;  4Q8G A;  4QRG A;  1AU4 A;  3IEJ A;  2IPP B;  4MZS A;  2E03 A;  2P86 A;  4BPV A;  4XUI A;  2B1M A;  5PAD A;  2WBF X;  1HUC B;  4QRX A;  1SNK A;  4YYW A;  1PBH A;  3PW3 A;  2YJ9 A;  3WXF A;  1QDQ A;  1AYV A;  1EWP A;  3P5V A;  3DF0 A;  1NLJ A;  3H7D A;  3PBH A;  3M99 A;  1YAL A;  2FT2 A;  4P6G A;  2IBI A;  1ZIV A;  2DC9 A;  2AUX A;  4FIP A;  2PNS A;  3S3R A;  1KFX L;  4AXM A;  1CSB B;  3KFQ A;  1ITO A;  1CS8 A;  4X6H A;  1NB5 A;  1DF0 A;  3I06 A;  1AU0 A;  4W4U A;  4X6I A;  5CVN B;  1K3B B;  2PBH A;  3N3K A;  6PAD A;  2DZZ A;  3MOR A;  3KSE A;  4N8W A;  2DC8 A;  2R9O A;  4BS6 A;  3PDF A;  1TL9 A;  2AYO A;  2AUZ A;  2YJ2 A;  2H7J A;  4YYS A;  1AYW A;  9PAP A;  4CDC B;  1EWL A;  4DMX A;  2FQ9 A;  1U5I A;  4W5C A;  2R9M A;  2DJF B;  5JH3 A;  4FJC A;  1NQC A;  3N4C A;  2G7Y A;  2XU4 A;  3N3G A;  2G6D A;  1THE A;  2GHU A;  2HD5 A;  3MTN A;  2P0R A;  4MZO A;  1VJV A;  3V6C A;  3OVX A;  3OIS A;  3O1G A;  2FUD A;  2G8J A;  4PP1 A;  1AU3 A;  2AVW A;  2CB5 A;  2F7D A;  2BDZ A;  3P5W A;  1PAD A;  3CBK A;  1NB3 A;  3HHA A;  3WXE A;  5CHT A;  1QXP A;  2E01 A;  2C0Y A; 
#chains in the Genus database with same CATH topology
 1YK8 A;  2UZJ A;  3MHH A;  3OF8 A;  3P5U A;  4OW0 A;  2G8E A;  4OVZ A;  3MTV A;  4IP3 A;  1FH0 A;  2YJB A;  1CJL A;  1F2B A;  4FK5 A;  3TNX A;  1QOL A;  4CDF B;  2DZY A;  5JA7 A;  3USV A;  3TMP A;  1BY8 A;  2AS8 A;  5F02 A;  1DKI A;  3GCB A;  1BGO A;  2JQG R;  4D8B A;  1GLO A;  3H6S A;  4YYU A;  2JQF R;  5FPW A;  4YV8 A;  1PCI A;  2GFO A;  2P7U A;  4HXD B;  2B1N A;  3BC3 A;  1CPJ A;  2R9F A;  3C9E A;  2BDL A;  4RY2 A;  1MIR A;  3H8B A;  1Q6K A;  3LFY A;  2DCD A;  3K8U A;  4DMY A;  4I05 A;  1PPN A;  4MSX A;  3NHE A;  3HWN A;  3BPF A;  1MHW A;  4XZX A;  3WXG A;  1PXV A;  1F2C A;  3CH2 X;  1MEM A;  3BY4 A;  2Y6E A;  3BB7 A;  2CIO A;  4BQV A;  4GUA A;  2HH5 A;  3IHP A;  3KWB X;  4YYQ A;  1BQI A;  2AGA A;  1EWO A;  3MJ5 A;  3OF9 A;  1YK7 A;  1S4V A;  4D8I A;  3BWK A;  4PAD A;  2DC7 A;  2ATO A;  4OEL A;  4RF0 A;  2E02 A;  4OEM A;  3BOW A;  1GMY A;  3MHS A;  3B79 A;  2FYE A;  7PCK A;  1O0E A;  1X9Y A;  3U8E A;  4ZUX U;  1XKG A;  2OP3 A;  5J94 A;  3PRM A;  1F2A A;  2FRQ A;  3I3T A;  1CV8 A;  1KHP A;  3B21 A;  4CZW A;  1BP4 A;  4XR7 A;  3RVW A;  4N4Z A;  3KKU A;  4Q8H A;  2O6X A;  1CQD A;  3IV2 A;  2HXZ A;  4RNA A;  4BSQ A;  1U9Q X;  8PCH A;  1YT7 A;  2AU1 A;  4W5B A;  4MI7 A;  5CVM A;  4CDE B;  4BOZ A;  2OUL A;  2FRA A;  4BOU A;  3AI8 A;  3IMA A;  1TU6 A;  2R6N A;  4BOS A;  2DCC A;  4YYR A;  3PNR A;  2F1G A;  5CHV A;  2FO5 A;  1PPP A;  1ME4 A;  3PHU A;  3QT4 A;  2DCA A;  1NL6 A;  1PE6 A;  1AEC A;  5CVO B;  4PP2 E;  4YYV A;  1SP4 B;  1CVZ A;  1DEU A;  3D6S A;  1VSN A;  2JRI A;  2DC6 A;  2XU1 A;  3OVZ A;  3BPM A;  4QBB A;  1TLO A;  1AIM A;  1Y4H A;  1U9W A;  1GEC E;  4X6J A;  2DCB A;  2ACT A;  3KW9 A;  1ME3 A;  3RVV A;  1KXR A;  3H8C A;  1JQP A;  2AIM A;  2R9N A;  4PT5 A;  2HWK A;  1KHQ A;  1CB5 A;  1KFU L;  1PPO A;  2XU3 A;  4QRV A;  2HHN A;  2PRE A;  4REZ A;  2ARY A;  2YJ8 A;  4OVZ B;  4CDD B;  1Y08 A;  1PIP A;  4D8E A;  2Y5B A;  3K24 A;  1A6R A;  1YVB A;  3OQC A;  4PI3 A;  3KWZ A;  1AU2 A;  3CH3 X;  1POP A;  4AXL A;  3RNV A;  1PVJ A;  2AYN A;  3ZUA A;  1STF E;  4R3D A;  2PAD A;  3O0U A;  5JZE A;  1MS6 A;  1U9X A;  3HHI A;  1IWD A;  3ERV A;  3W30 A;  2NQG A;  4K7C A;  5A24 A;  2VHF A;  1MEG A;  3E1Z B;  2FTD A;  2YJC A;  1U9V A;  1GCB A;  2JTC A;  4I07 A;  3LXS A;  4IUM A;  3IUT A;  2J7Q C;  1QMY A;  3HD3 A;  1YZB A;  5EGW A;  3V6E A;  3BCN A;  3QSD A;  3H89 A;  3O65 A;  1EWM A;  2XU5 A;  3F75 A;  2DOS A;  4P16 A;  4KLB A;  3KX1 A;  4HWY A;  1AYU A;  2R9C A;  4BOP A;  2OZ2 A;  1ZCM A;  4WA6 A;  2NQD B;  1NPZ A;  4G54 A;  4N79 A;  1CTE A;  3S3Q A;  1ATK A;  5EZQ A;  1F29 A;  3RVX A;  2J7Q A;  5EF4 A;  4P6E A;  2E00 A;  3F5V A;  4I04 A;  3K9M A;  1ICF A;  1PPD A;  4QH6 A;  4BS5 A;  3CBJ A;  2VHS A;  1MDW A;  1M6D A;  2DJG B;  4YVA A;  5K16 A;  3IOQ A;  3QJ3 A;  2NQA A;  5EZS A;  5KO3 A;  1EF7 A;  3P5X A;  2NQI A;  4Q8G A;  4QRG A;  1AU4 A;  3IEJ A;  3TRK A;  2IPP B;  3E9S A;  4MZS A;  2E03 A;  2P86 A;  4BPV A;  4XUI A;  2B1M A;  5PAD A;  2WBF X;  1HUC B;  4QRX A;  1SNK A;  4YYW A;  2BTW A;  1PBH A;  3PW3 A;  2YJ9 A;  3WXF A;  3ZNH A;  1QDQ A;  1AYV A;  1EWP A;  3P5V A;  3DF0 A;  1NLJ A;  3H7D A;  3PBH A;  3M99 A;  1YAL A;  4A5U A;  2FT2 A;  4P6G A;  2IBI A;  1ZIV A;  5E6J A;  2DC9 A;  4WUR A;  2AUX A;  2FE8 A;  4FIP A;  2PNS A;  3S3R A;  3IFU A;  1KFX L;  4AXM A;  1CSB B;  3KFQ A;  1ITO A;  1CS8 A;  4X6H A;  1NB5 A;  1DF0 A;  3I06 A;  1AU0 A;  4W4U A;  4X6I A;  5CVN B;  4ZTB A;  1K3B B;  3PRP A;  2PBH A;  2BTW B;  3N3K A;  6PAD A;  2DZZ A;  3MOR A;  3KSE A;  3PT2 A;  3PHX A;  4N8W A;  2DC8 A;  2R9O A;  4BS6 A;  3PDF A;  1TL9 A;  2AYO A;  2AUZ A;  2YJ2 A;  2H7J A;  4YYS A;  3PHW A;  1AYW A;  9PAP A;  4CDC B;  2BU3 A;  1EWL A;  4DMX A;  2FQ9 A;  1U5I A;  3MP2 A;  4W5C A;  4M0W A;  2R9M A;  2DJF B;  1UKF A;  5JH3 A;  4FJC A;  1NQC A;  3C0R A;  4MM3 B;  3N4C A;  3W31 A;  2G7Y A;  4RKX A;  2XU4 A;  3N3G A;  2G6D A;  1THE A;  2GHU A;  2Z84 A;  2HD5 A;  3MTN A;  2P0R A;  4MZO A;  1VJV A;  3V6C A;  3OVX A;  3PSE A;  3OIS A;  3O1G A;  2FUD A;  2G8J A;  4PP1 A;  4BOQ A;  1AU3 A;  2AVW A;  2CB5 A;  2F7D A;  2BDZ A;  3P5W A;  4RF1 A;  1PAD A;  3CBK A;  1NB3 A;  3BBA A;  3HHA A;  3WXE A;  5CHT A;  1QXP A;  2E01 A;  2C0Y A; 
#chains in the Genus database with same CATH homology
 1YK8 A;  3MHH A;  3OF8 A;  3P5U A;  2G8E A;  1FH0 A;  2YJB A;  1CJL A;  1F2B A;  4FK5 A;  3TNX A;  1QOL A;  4CDF B;  2DZY A;  5JA7 A;  3USV A;  1BY8 A;  2AS8 A;  5F02 A;  3GCB A;  1BGO A;  2JQG R;  1GLO A;  3H6S A;  4YYU A;  2JQF R;  5FPW A;  4YV8 A;  1PCI A;  2GFO A;  2P7U A;  2B1N A;  3BC3 A;  1CPJ A;  2R9F A;  3C9E A;  2BDL A;  4RY2 A;  1MIR A;  3H8B A;  1Q6K A;  3LFY A;  2DCD A;  3K8U A;  4DMY A;  4I05 A;  1PPN A;  4MSX A;  3NHE A;  3HWN A;  3BPF A;  1MHW A;  3WXG A;  1PXV A;  1F2C A;  3CH2 X;  1MEM A;  2Y6E A;  1W5R A;  2CIO A;  4BQV A;  2HH5 A;  3IHP A;  3KWB X;  4YYQ A;  1BQI A;  1EWO A;  3OF9 A;  1YK7 A;  1S4V A;  3BWK A;  4PAD A;  2DC7 A;  2ATO A;  4OEL A;  2E02 A;  4OEM A;  3BOW A;  1GMY A;  3MHS A;  3B79 A;  2FYE A;  7PCK A;  1O0E A;  1X9Y A;  3U8E A;  4ZUX U;  1XKG A;  2OP3 A;  5J94 A;  1F2A A;  2VFB A;  2FRQ A;  3I3T A;  1CV8 A;  1KHP A;  4CZW A;  1BP4 A;  4XR7 A;  3RVW A;  4N4Z A;  3KKU A;  4Q8H A;  2O6X A;  1CQD A;  3IV2 A;  2HXZ A;  4BSQ A;  1U9Q X;  8PCH A;  1YT7 A;  2AU1 A;  4W5B A;  5CVM A;  4CDE B;  2OUL A;  2FRA A;  3AI8 A;  3IMA A;  1TU6 A;  2R6N A;  2DCC A;  4YYR A;  3PNR A;  2F1G A;  5CHV A;  2FO5 A;  1PPP A;  4GUZ A;  1ME4 A;  3QT4 A;  2DCA A;  1NL6 A;  1PE6 A;  1AEC A;  5CVO B;  4PP2 E;  4YYV A;  1SP4 B;  1CVZ A;  1DEU A;  3D6S A;  1VSN A;  2DC6 A;  2XU1 A;  3OVZ A;  3BPM A;  4QBB A;  1TLO A;  1AIM A;  1Y4H A;  1U9W A;  1GEC E;  4X6J A;  2DCB A;  2ACT A;  3KW9 A;  1ME3 A;  3RVV A;  1KXR A;  3H8C A;  1JQP A;  2AIM A;  2R9N A;  1KHQ A;  1CB5 A;  1KFU L;  1PPO A;  2XU3 A;  4QRV A;  2HHN A;  2PRE A;  4NV7 A;  2ARY A;  2YJ8 A;  4CDD B;  1Y08 A;  1PIP A;  2Y5B A;  3K24 A;  1A6R A;  2BSZ A;  1YVB A;  4PI3 A;  3KWZ A;  1AU2 A;  3CH3 X;  1POP A;  4AXL A;  1W4T A;  2AYN A;  1E2T A;  3ZUA A;  1STF E;  2PAD A;  3O0U A;  1MS6 A;  1U9X A;  3HHI A;  1IWD A;  3ERV A;  2NQG A;  4K7C A;  5A24 A;  2VHF A;  1MEG A;  3E1Z B;  2FTD A;  2YJC A;  1U9V A;  1GCB A;  4I07 A;  3LXS A;  3IUT A;  1QMY A;  3HD3 A;  5EGW A;  3V6E A;  3BCN A;  3QSD A;  3H89 A;  1EWM A;  2XU5 A;  4B55 A;  3F75 A;  4KLB A;  3KX1 A;  4HWY A;  1AYU A;  2R9C A;  2OZ2 A;  1ZCM A;  4WA6 A;  2NQD B;  1NPZ A;  4G54 A;  4N79 A;  1CTE A;  3S3Q A;  1ATK A;  1F29 A;  3RVX A;  5EF4 A;  4P6E A;  2E00 A;  3F5V A;  4I04 A;  3K9M A;  1ICF A;  1PPD A;  4QH6 A;  4BS5 A;  3CBJ A;  2VHS A;  1MDW A;  1M6D A;  2DJG B;  4YVA A;  5K16 A;  3IOQ A;  3QJ3 A;  2NQA A;  1EF7 A;  3P5X A;  4C5P A;  2NQI A;  4Q8G A;  4QRG A;  1AU4 A;  3IEJ A;  2IPP B;  4MZS A;  2E03 A;  2P86 A;  4BPV A;  4XUI A;  2B1M A;  5PAD A;  2WBF X;  1HUC B;  4QRX A;  1SNK A;  4YYW A;  1PBH A;  3PW3 A;  2YJ9 A;  3WXF A;  1QDQ A;  1AYV A;  1EWP A;  3P5V A;  3DF0 A;  1W6F A;  1NLJ A;  3H7D A;  3PBH A;  3M99 A;  1YAL A;  3D9W A;  2FT2 A;  4P6G A;  2IBI A;  1ZIV A;  2DC9 A;  2AUX A;  3LTW A;  4FIP A;  2PNS A;  3S3R A;  1KFX L;  4AXM A;  1CSB B;  3KFQ A;  1ITO A;  1CS8 A;  4X6H A;  1NB5 A;  1DF0 A;  3I06 A;  1AU0 A;  4W4U A;  4X6I A;  5CVN B;  1GX3 A;  1K3B B;  2PBH A;  3N3K A;  6PAD A;  2DZZ A;  3MOR A;  3KSE A;  4N8W A;  2DC8 A;  2R9O A;  4BS6 A;  3PDF A;  1TL9 A;  2AYO A;  2AUZ A;  2VFC A;  2YJ2 A;  2H7J A;  4YYS A;  1AYW A;  9PAP A;  4CDC B;  4BGF A;  1EWL A;  4DMX A;  2FQ9 A;  1U5I A;  4W5C A;  2R9M A;  2DJF B;  5JH3 A;  4FJC A;  1NQC A;  3N4C A;  2G7Y A;  2XU4 A;  3N3G A;  2G6D A;  1THE A;  2GHU A;  2HD5 A;  3MTN A;  2P0R A;  4MZO A;  1VJV A;  3V6C A;  3OVX A;  3OIS A;  3O1G A;  2FUD A;  2G8J A;  4PP1 A;  1AU3 A;  2AVW A;  2CB5 A;  2F7D A;  2BDZ A;  3P5W A;  1PAD A;  3CBK A;  1NB3 A;  4NV8 A;  3HHA A;  3WXE A;  5CHT A;  1QXP A;  2E01 A;  2C0Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...