4P6EA

Crystal structure of human cathepsin s bound to a non-covalent inhibitor
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
219
structure length
219
Chain Sequence
ILPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cathepsin S
publication title Discovery of Cathepsin S Inhibitor LY3000328 for the Treatment of Abdominal Aortic Aneurysm.
pubmed doi rcsb
source organism Homo sapiens
total genus 69
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2014-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4p6eA00
1EF7A 1XKGA 1AECA 3HHIA 2NQIA 3USVA 2R9CA 1YK7A 1AU4A 3OF9A 3TNXA 7PCKA 2VHFA 4CZWA 1NPZA 2OZ2A 2PREA 2NQDB 1GLOA 3N3GA 3WXEA 1BY8A 4DMYA 1O0EA 2HXZA 3KX1A 4X6JA 1QOLA 5EGWA 3BOWA 1F29A 3RVVA 3S3QA 3MORA 1PXVA 3ZUAA 1HUCB 1QMYA 3M99A 4AXMA 1U9WA 2DZYA 1CS8A 3PNRA 1PPDA 1ZIVA 3IV2A 3HD3A 2E01A 3LFYA 3P5WA 3DF0A 3P5UA 1AIMA 4MZOA 1THEA 5F02A 3KWBX 1QDQA 4I04A 2DZZA 4FK5A 2C0YA 2AVWA 2DC8A 1VJVA 2YJBA 1FH0A 1AU0A 3QSDA 3HHAA 3QJ3A 5FPWA 2HH5A 1YK8A 1F2CA 3ERVA 2DC6A 1KHPA 1U9XA 4QRGA 4G54A 1M6DA 1ITOA 4AXLA 4YYSA 2P7UA 1CTEA 5PADA 2OP3A 4MSXA 3OF8A 3C9EA 1BGOA 1GMYA 4Q8HA 3IMAA 2FUDA 4KLBA 1F2AA 3NHEA 2PNSA 3F75A 5CVMA 3WXFA 3N4CA 1NL6A 4ZUXU 4MZSA 4Q8GA 1KHQA 4W4UA 4PADA 1Q6KA 2XU3A 1U5IA 4CDEB 1YT7A 2FQ9A 3N3KA 5CHTA 1U9VA 3QT4A 1X9YA 3PDFA 2YJ2A 1ZCMA 2DC7A 4YV8A 2IPPB 1CV8A 3E1ZB 1EWLA 3OVZA 1ME4A 3BWKA 1NB3A 2PBHA 1MIRA 1K3BB 1CJLA 2G8EA 3K8UA 8PCHA 2R9NA 3O0UA 2E03A 3IHPA 6PADA 1AYWA 2R9OA 2NQGA 1EWPA 1MS6A 1VSNA 1YALA 3K9MA 3CBKA 4QH6A 4QRXA 2AIMA 1SP4B 4HWYA 1NB5A 2P0RA 3OVXA 2JQFR 5CVOB 3CBJA 4PP1A 4XUIA 4RY2A 3GCBA 4I07A 2AU1A 4OELA 4N8WA 4W5CA 1YVBA 1ATKA 4QRVA 1S4VA 2E02A 3I3TA 3OISA 1POPA 3MHSA 2O6XA 4OEMA 3HWNA 2G6DA 3LXSA 3BPMA 2P86A 2VHSA 2DCCA 3IOQA 4X6HA 2AYNA 4PI3A 1MDWA 1CB5A 1SNKA 2DJGB 4P6EA 1PPNA 1KXRA 1CSBB 2GFOA 4W5BA 2ATOA 4YYQA 3CH2X 4BSQA 2E00A 3BC3A 2XU4A 2AYOA 2Y6EA 1ME3A 3H8BA 3O1GA 4X6IA 2HD5A 3K24A 1NLJA 1TL9A 4YYRA 5K16A 5JH3A 4YVAA 1AYUA 2FRQA 1KFUL 3S3RA 1IWDA 2WBFX 4FJCA 3P5XA 1DEUA 3IEJA 2CB5A 2JQGR 4DMXA 3P5VA 5CHVA 1BQIA 4N4ZA 4YYWA 4YYVA 1PCIA 5CVNB 3BCNA 4WA6A 3D6SA 4CDCB 3CH3X 3KKUA 1NQCA 3V6EA 1GCBA 1MEGA 2AUZA 3H89A 2R6NA 3I06A 3IUTA 4K7CA 2ACTA 2F1GA 3F5VA 3RVXA 5EF4A 2DCDA 3MHHA 1CPJA 2XU5A 3B79A 2R9MA 1PPOA 2YJ8A 4CDDB 3KW9A 2OULA 2FO5A 1ICFA 4CDFB 2NQAA 2FRAA 1AU3A 2GHUA 3BPFA 1AU2A 2F7DA 3V6CA 2B1NA 1CVZA 5A24A 3PW3A 2AS8A 2H7JA 1GECE 2Y5BA 2B1MA 1MEMA 4P6GA 2CIOA 2YJ9A 2PADA 5JA7A 2XU1A 4I05A 1A6RA 1TLOA 2FTDA 2G7YA 1AYVA 2BDZA 1PBHA 4YYUA 1F2BA 9PAPA 1DF0A 2ARYA 3MTNA 1MHWA 1PPPA 1STFE 2R9FA 1KFXL 2AUXA 2DCAA 4XR7A 3H7DA 2FT2A 1Y08A 2IBIA 4BS6A 5J94A 3U8EA 3H6SA 1EWMA 1PE6A 2G8JA 4FIPA 1BP4A 1EWOA 1QXPA 1PIPA 3AI8A 2HHNA 3PBHA 1TU6A 3WXGA 3KWZA 4BQVA 1PADA 2DJFB 2YJCA 2FYEA 4N79A 2DC9A 4PP2E 3H8CA 4BPVA 2BDLA 1CQDA 1Y4HA 3RVWA 2DCBA 3KSEA 4BS5A 3KFQA 1JQPA 1U9QX 4QBBA
chains in the Genus database with same CATH superfamily
4MI7A 1EF7A 3PHUA 1XKGA 1AECA 3HHIA 2NQIA 3USVA 2R9CA 1YK7A 1AU4A 2FE8A 3OF9A 3OQCA 3TNXA 7PCKA 4OW0A 2VHFA 4CZWA 1NPZA 2OZ2A 2PREA 2NQDB 1GLOA 3N3GA 3WXEA 1BY8A 4DMYA 1O0EA 2HXZA 3KX1A 4X6JA 1QOLA 5EGWA 3BOWA 1F29A 3RVVA 3S3QA 3MORA 1PXVA 3ZUAA 1HUCB 4WURA 1QMYA 4A5UA 3M99A 4AXMA 1U9WA 2DZYA 5E6JA 1CS8A 3PNRA 1PPDA 4BOPA 1ZIVA 3IV2A 3HD3A 2E01A 3LFYA 4PT5A 3E9SA 3P5WA 3DF0A 3P5UA 1AIMA 4MZOA 1THEA 3PRMA 3KWBX 5F02A 1QDQA 3PSEA 4I04A 2DZZA 4FK5A 2C0YA 4IP3A 2AVWA 2DC8A 1VJVA 4M0WA 3MJ5A 2YJBA 1FH0A 1AU0A 3QSDA 3BB7A 3HHAA 3QJ3A 5FPWA 1PVJA 2HH5A 1YK8A 2J7QA 1F2CA 3ERVA 2UZJA 4RNAA 2DC6A 1KHPA 1U9XA 3MTVA 4QRGA 4R3DA 4G54A 1M6DA 4D8IA 4XZXA 1ITOA 4AXLA 4YYSA 2P7UA 2HWKA 1CTEA 5PADA 2OP3A 4MSXA 3OF8A 4OVZB 3C9EA 1BGOA 1GMYA 4Q8HA 3IMAA 4D8EA 2FUDA 4KLBA 1F2AA 4GUAA 3NHEA 2PNSA 3F75A 5CVMA 3WXFA 3N4CA 1NL6A 4ZUXU 4MZSA 4Q8GA 1KHQA 2BTWB 4W4UA 4PADA 1Q6KA 2XU3A 1U5IA 4CDEB 1YT7A 2FQ9A 3N3KA 3PT2A 5CHTA 1U9VA 3QT4A 1X9YA 3PDFA 2YJ2A 1ZCMA 5EZQA 5EZSA 2DC7A 4YV8A 1YZBA 2IPPB 1CV8A 3E1ZB 1EWLA 2BTWA 3OVZA 1ME4A 3BWKA 1NB3A 2PBHA 3ZNHA 1MIRA 1K3BB 1CJLA 2G8EA 3K8UA 8PCHA 2R9NA 2Z84A 3O0UA 2E03A 3IHPA 6PADA 1AYWA 2R9OA 3C0RA 2NQGA 1EWPA 1MS6A 1VSNA 1YALA 3K9MA 4REZA 3CBKA 4QH6A 4BOUA 4QRXA 2AIMA 3BY4A 1SP4B 4HWYA 1NB5A 2P0RA 3MP2A 3OVXA 2JQFR 3TMPA 5CVOB 3CBJA 4PP1A 4XUIA 4RY2A 3GCBA 4I07A 2AU1A 4OELA 4N8WA 4W5CA 1YVBA 1ATKA 2JRIA 4QRVA 1S4VA 2E02A 3I3TA 3OISA 1POPA 3MHSA 2O6XA 4OEMA 3HWNA 2G6DA 4HXDB 3LXSA 3BPMA 2P86A 2VHSA 2DCCA 3IOQA 4IUMA 4X6HA 3PHXA 3IFUA 2AYNA 4PI3A 1MDWA 1CB5A 1SNKA 2DJGB 3PRPA 4P6EA 1PPNA 1KXRA 4BOZA 1CSBB 2GFOA 4W5BA 2ATOA 4YYQA 3CH2X 4BSQA 2E00A 4MM3B 3BC3A 2XU4A 2AYOA 2Y6EA 1ME3A 3H8BA 3O1GA 4X6IA 2HD5A 3K24A 1NLJA 4RF1A 4BOSA 1TL9A 4YYRA 5K16A 5JH3A 4YVAA 1AYUA 2FRQA 1KFUL 3BBAA 3S3RA 1IWDA 2WBFX 4OVZA 4FJCA 3P5XA 1DEUA 3IEJA 2CB5A 2JQGR 4DMXA 3P5VA 5CHVA 1BQIA 4N4ZA 4YYWA 4YYVA 1PCIA 5CVNB 3BCNA 4WA6A 3B21A 3D6SA 4CDCB 3CH3X 3KKUA 1NQCA 3V6EA 1GCBA 1MEGA 2AUZA 3H89A 2R6NA 3I06A 3PHWA 3IUTA 4K7CA 2ACTA 2F1GA 3F5VA 3RVXA 5EF4A 2DCDA 3MHHA 2AGAA 1CPJA 2XU5A 3B79A 2R9MA 1PPOA 2YJ8A 4CDDB 3KW9A 3W31A 2OULA 2FO5A 1ICFA 4CDFB 2NQAA 2FRAA 4RKXA 1AU3A 1UKFA 2GHUA 3BPFA 3W30A 1AU2A 2F7DA 3V6CA 2B1NA 1CVZA 5A24A 3PW3A 2AS8A 2H7JA 1GECE 2Y5BA 4D8BA 2BU3A 2B1MA 1MEMA 4P6GA 5KO3A 2CIOA 2YJ9A 2PADA 5JA7A 5JZEA 2XU1A 4I05A 1A6RA 4P16A 1TLOA 2FTDA 2G7YA 1AYVA 2BDZA 1PBHA 4YYUA 1F2BA 9PAPA 4ZTBA 4RF0A 1DF0A 2ARYA 3MTNA 1MHWA 1PPPA 1STFE 2R9FA 1KFXL 2AUXA 2DCAA 4XR7A 3H7DA 2FT2A 1Y08A 2IBIA 1DKIA 4BS6A 5J94A 4BOQA 3U8EA 3H6SA 1EWMA 3TRKA 1PE6A 2G8JA 4FIPA 1BP4A 1EWOA 3RNVA 1QXPA 2J7QC 1PIPA 3AI8A 2HHNA 3PBHA 1TU6A 3WXGA 3KWZA 4BQVA 1PADA 2DJFB 2YJCA 2FYEA 4N79A 2DC9A 3O65A 4PP2E 3H8CA 4BPVA 2BDLA 1CQDA 1Y4HA 2DOSA 3RVWA 2DCBA 3KSEA 4BS5A 3KFQA 2JTCA 1JQPA 1U9QX 4QBBA
chains in the Genus database with same CATH topology
1EF7A 1XKGA 1AECA 4BGFA 3HHIA 2NQIA 3USVA 2R9CA 1YK7A 3D9WA 1AU4A 3OF9A 3TNXA 7PCKA 2VHFA 4CZWA 1NPZA 2OZ2A 2PREA 2NQDB 1GLOA 3N3GA 3WXEA 1BY8A 4DMYA 1O0EA 2HXZA 3KX1A 4X6JA 1QOLA 5EGWA 3BOWA 1F29A 3RVVA 4NV7A 3S3QA 3MORA 1PXVA 3ZUAA 1HUCB 1QMYA 3M99A 4AXMA 1U9WA 2DZYA 1CS8A 3PNRA 1PPDA 1ZIVA 3IV2A 3HD3A 2E01A 3LFYA 3P5WA 3DF0A 3P5UA 1AIMA 4MZOA 1THEA 5F02A 3KWBX 1QDQA 4I04A 2DZZA 4FK5A 2C0YA 2AVWA 2DC8A 1VJVA 2YJBA 1FH0A 1AU0A 3QSDA 3HHAA 3QJ3A 5FPWA 2HH5A 1YK8A 1F2CA 3ERVA 2DC6A 1KHPA 1U9XA 4QRGA 4G54A 1M6DA 1ITOA 4AXLA 4YYSA 2P7UA 1CTEA 5PADA 2OP3A 4MSXA 3OF8A 3C9EA 1BGOA 1GMYA 4Q8HA 3IMAA 2FUDA 4KLBA 1F2AA 3NHEA 1W4TA 2PNSA 3F75A 5CVMA 4NV8A 3WXFA 3N4CA 1NL6A 4ZUXU 4MZSA 4Q8GA 1KHQA 4W4UA 4GUZA 1Q6KA 2XU3A 1U5IA 4PADA 1YT7A 4CDEB 2FQ9A 3N3KA 5CHTA 1U9VA 3QT4A 1X9YA 3PDFA 2YJ2A 1ZCMA 1E2TA 2DC7A 4YV8A 2IPPB 1CV8A 3E1ZB 1EWLA 3OVZA 1ME4A 3BWKA 1NB3A 2PBHA 1MIRA 1K3BB 1CJLA 2G8EA 3K8UA 8PCHA 2R9NA 3O0UA 2E03A 3IHPA 2VFBA 6PADA 1AYWA 2R9OA 2NQGA 1EWPA 1MS6A 1VSNA 1YALA 3K9MA 3CBKA 4QH6A 4QRXA 2AIMA 1SP4B 4HWYA 1NB5A 2P0RA 3OVXA 2JQFR 5CVOB 3CBJA 4PP1A 4XUIA 4RY2A 3GCBA 4I07A 2AU1A 4OELA 4N8WA 4W5CA 1YVBA 1ATKA 4QRVA 1S4VA 2E02A 3I3TA 3OISA 1POPA 3MHSA 2O6XA 4OEMA 3HWNA 2G6DA 2VFCA 3LXSA 3BPMA 2P86A 2VHSA 2DCCA 3IOQA 4X6HA 2AYNA 4PI3A 1MDWA 1W5RA 1CB5A 1SNKA 2DJGB 4P6EA 1GX3A 1KXRA 1PPNA 1CSBB 2GFOA 4W5BA 2ATOA 4YYQA 3CH2X 4BSQA 2E00A 3BC3A 2XU4A 4C5PA 2AYOA 2Y6EA 1ME3A 3H8BA 3O1GA 4X6IA 2HD5A 3K24A 1NLJA 1TL9A 4YYRA 5K16A 5JH3A 4YVAA 1AYUA 1W6FA 2FRQA 1KFUL 3S3RA 1IWDA 2WBFX 4FJCA 3P5XA 1DEUA 2BSZA 2CB5A 3IEJA 2JQGR 4DMXA 3P5VA 5CHVA 1BQIA 4N4ZA 4YYWA 4YYVA 1PCIA 5CVNB 3BCNA 4WA6A 3D6SA 4CDCB 3CH3X 3KKUA 1NQCA 3V6EA 1GCBA 1MEGA 2AUZA 3H89A 2R6NA 3I06A 3IUTA 4K7CA 2ACTA 2F1GA 3F5VA 3RVXA 5EF4A 2DCDA 3MHHA 1CPJA 2XU5A 3B79A 2R9MA 1PPOA 2YJ8A 4CDDB 3KW9A 2OULA 2FO5A 1ICFA 4CDFB 2NQAA 2FRAA 1AU3A 2GHUA 3BPFA 1AU2A 2F7DA 3V6CA 2B1NA 1CVZA 5A24A 3PW3A 2AS8A 2H7JA 1GECE 2Y5BA 2B1MA 1MEMA 4P6GA 2CIOA 2YJ9A 2PADA 5JA7A 2XU1A 4I05A 1A6RA 1TLOA 2FTDA 2G7YA 1AYVA 2BDZA 1PBHA 4YYUA 1F2BA 9PAPA 3LTWA 1DF0A 2ARYA 3MTNA 1MHWA 1PPPA 1STFE 2R9FA 1KFXL 2AUXA 2DCAA 4XR7A 3H7DA 2FT2A 1Y08A 2IBIA 4BS6A 5J94A 3U8EA 3H6SA 1EWMA 1PE6A 2G8JA 4FIPA 1BP4A 1EWOA 1QXPA 1PIPA 3AI8A 2HHNA 3PBHA 1TU6A 3WXGA 3KWZA 4BQVA 1PADA 2DJFB 2YJCA 2FYEA 4N79A 2DC9A 4PP2E 3H8CA 4BPVA 2BDLA 4B55A 1CQDA 1Y4HA 3RVWA 2DCBA 3KSEA 4BS5A 3KFQA 1JQPA 1U9QX 4QBBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EF7 A;  1XKG A;  1AEC A;  3HHI A;  2NQI A;  3USV A;  2R9C A;  1YK7 A;  1AU4 A;  3OF9 A;  3TNX A;  7PCK A;  2VHF A;  4CZW A;  1NPZ A;  2OZ2 A;  2PRE A;  2NQD B;  1GLO A;  3N3G A;  3WXE A;  1BY8 A;  4DMY A;  1O0E A;  2HXZ A;  3KX1 A;  4X6J A;  1QOL A;  5EGW A;  3BOW A;  1F29 A;  3RVV A;  3S3Q A;  3MOR A;  1PXV A;  3ZUA A;  1HUC B;  1QMY A;  3M99 A;  4AXM A;  1U9W A;  2DZY A;  1CS8 A;  3PNR A;  1PPD A;  1ZIV A;  3IV2 A;  3HD3 A;  2E01 A;  3LFY A;  3P5W A;  3DF0 A;  3P5U A;  1AIM A;  4MZO A;  1THE A;  5F02 A;  3KWB X;  1QDQ A;  4I04 A;  2DZZ A;  4FK5 A;  2C0Y A;  2AVW A;  2DC8 A;  1VJV A;  2YJB A;  1FH0 A;  1AU0 A;  3QSD A;  3HHA A;  3QJ3 A;  5FPW A;  2HH5 A;  1YK8 A;  1F2C A;  3ERV A;  2DC6 A;  1KHP A;  1U9X A;  4QRG A;  4G54 A;  1M6D A;  1ITO A;  4AXL A;  4YYS A;  2P7U A;  1CTE A;  5PAD A;  2OP3 A;  4MSX A;  3OF8 A;  3C9E A;  1BGO A;  1GMY A;  4Q8H A;  3IMA A;  2FUD A;  4KLB A;  1F2A A;  3NHE A;  2PNS A;  3F75 A;  5CVM A;  3WXF A;  3N4C A;  1NL6 A;  4ZUX U;  4MZS A;  4Q8G A;  1KHQ A;  4W4U A;  4PAD A;  1Q6K A;  2XU3 A;  1U5I A;  4CDE B;  1YT7 A;  2FQ9 A;  3N3K A;  5CHT A;  1U9V A;  3QT4 A;  1X9Y A;  3PDF A;  2YJ2 A;  1ZCM A;  2DC7 A;  4YV8 A;  2IPP B;  1CV8 A;  3E1Z B;  1EWL A;  3OVZ A;  1ME4 A;  3BWK A;  1NB3 A;  2PBH A;  1MIR A;  1K3B B;  1CJL A;  2G8E A;  3K8U A;  8PCH A;  2R9N A;  3O0U A;  2E03 A;  3IHP A;  6PAD A;  1AYW A;  2R9O A;  2NQG A;  1EWP A;  1MS6 A;  1VSN A;  1YAL A;  3K9M A;  3CBK A;  4QH6 A;  4QRX A;  2AIM A;  1SP4 B;  4HWY A;  1NB5 A;  2P0R A;  3OVX A;  2JQF R;  5CVO B;  3CBJ A;  4PP1 A;  4XUI A;  4RY2 A;  3GCB A;  4I07 A;  2AU1 A;  4OEL A;  4N8W A;  4W5C A;  1YVB A;  1ATK A;  4QRV A;  1S4V A;  2E02 A;  3I3T A;  3OIS A;  1POP A;  3MHS A;  2O6X A;  4OEM A;  3HWN A;  2G6D A;  3LXS A;  3BPM A;  2P86 A;  2VHS A;  2DCC A;  3IOQ A;  4X6H A;  2AYN A;  4PI3 A;  1MDW A;  1CB5 A;  1SNK A;  2DJG B;  4P6E A;  1PPN A;  1KXR A;  1CSB B;  2GFO A;  4W5B A;  2ATO A;  4YYQ A;  3CH2 X;  4BSQ A;  2E00 A;  3BC3 A;  2XU4 A;  2AYO A;  2Y6E A;  1ME3 A;  3H8B A;  3O1G A;  4X6I A;  2HD5 A;  3K24 A;  1NLJ A;  1TL9 A;  4YYR A;  5K16 A;  5JH3 A;  4YVA A;  1AYU A;  2FRQ A;  1KFU L;  3S3R A;  1IWD A;  2WBF X;  4FJC A;  3P5X A;  1DEU A;  3IEJ A;  2CB5 A;  2JQG R;  4DMX A;  3P5V A;  5CHV A;  1BQI A;  4N4Z A;  4YYW A;  4YYV A;  1PCI A;  5CVN B;  3BCN A;  4WA6 A;  3D6S A;  4CDC B;  3CH3 X;  3KKU A;  1NQC A;  3V6E A;  1GCB A;  1MEG A;  2AUZ A;  3H89 A;  2R6N A;  3I06 A;  3IUT A;  4K7C A;  2ACT A;  2F1G A;  3F5V A;  3RVX A;  5EF4 A;  2DCD A;  3MHH A;  1CPJ A;  2XU5 A;  3B79 A;  2R9M A;  1PPO A;  2YJ8 A;  4CDD B;  3KW9 A;  2OUL A;  2FO5 A;  1ICF A;  4CDF B;  2NQA A;  2FRA A;  1AU3 A;  2GHU A;  3BPF A;  1AU2 A;  2F7D A;  3V6C A;  2B1N A;  1CVZ A;  5A24 A;  3PW3 A;  2AS8 A;  2H7J A;  1GEC E;  2Y5B A;  2B1M A;  1MEM A;  4P6G A;  2CIO A;  2YJ9 A;  2PAD A;  5JA7 A;  2XU1 A;  4I05 A;  1A6R A;  1TLO A;  2FTD A;  2G7Y A;  1AYV A;  2BDZ A;  1PBH A;  4YYU A;  1F2B A;  9PAP A;  1DF0 A;  2ARY A;  3MTN A;  1MHW A;  1PPP A;  1STF E;  2R9F A;  1KFX L;  2AUX A;  2DCA A;  4XR7 A;  3H7D A;  2FT2 A;  1Y08 A;  2IBI A;  4BS6 A;  5J94 A;  3U8E A;  3H6S A;  1EWM A;  1PE6 A;  2G8J A;  4FIP A;  1BP4 A;  1EWO A;  1QXP A;  1PIP A;  3AI8 A;  2HHN A;  3PBH A;  1TU6 A;  3WXG A;  3KWZ A;  4BQV A;  1PAD A;  2DJF B;  2YJC A;  2FYE A;  4N79 A;  2DC9 A;  4PP2 E;  3H8C A;  4BPV A;  2BDL A;  1CQD A;  1Y4H A;  3RVW A;  2DCB A;  3KSE A;  4BS5 A;  3KFQ A;  1JQP A;  1U9Q X;  4QBB A; 
#chains in the Genus database with same CATH topology
 4MI7 A;  1EF7 A;  3PHU A;  1XKG A;  1AEC A;  3HHI A;  2NQI A;  3USV A;  2R9C A;  1YK7 A;  1AU4 A;  2FE8 A;  3OF9 A;  3OQC A;  3TNX A;  7PCK A;  4OW0 A;  2VHF A;  4CZW A;  1NPZ A;  2OZ2 A;  2PRE A;  2NQD B;  1GLO A;  3N3G A;  3WXE A;  1BY8 A;  4DMY A;  1O0E A;  2HXZ A;  3KX1 A;  4X6J A;  1QOL A;  5EGW A;  3BOW A;  1F29 A;  3RVV A;  3S3Q A;  3MOR A;  1PXV A;  3ZUA A;  1HUC B;  4WUR A;  1QMY A;  4A5U A;  3M99 A;  4AXM A;  1U9W A;  2DZY A;  5E6J A;  1CS8 A;  3PNR A;  1PPD A;  4BOP A;  1ZIV A;  3IV2 A;  3HD3 A;  2E01 A;  3LFY A;  4PT5 A;  3E9S A;  3P5W A;  3DF0 A;  3P5U A;  1AIM A;  4MZO A;  1THE A;  3PRM A;  3KWB X;  5F02 A;  1QDQ A;  3PSE A;  4I04 A;  2DZZ A;  4FK5 A;  2C0Y A;  4IP3 A;  2AVW A;  2DC8 A;  1VJV A;  4M0W A;  3MJ5 A;  2YJB A;  1FH0 A;  1AU0 A;  3QSD A;  3BB7 A;  3HHA A;  3QJ3 A;  5FPW A;  1PVJ A;  2HH5 A;  1YK8 A;  2J7Q A;  1F2C A;  3ERV A;  2UZJ A;  4RNA A;  2DC6 A;  1KHP A;  1U9X A;  3MTV A;  4QRG A;  4R3D A;  4G54 A;  1M6D A;  4D8I A;  4XZX A;  1ITO A;  4AXL A;  4YYS A;  2P7U A;  2HWK A;  1CTE A;  5PAD A;  2OP3 A;  4MSX A;  3OF8 A;  4OVZ B;  3C9E A;  1BGO A;  1GMY A;  4Q8H A;  3IMA A;  4D8E A;  2FUD A;  4KLB A;  1F2A A;  4GUA A;  3NHE A;  2PNS A;  3F75 A;  5CVM A;  3WXF A;  3N4C A;  1NL6 A;  4ZUX U;  4MZS A;  4Q8G A;  1KHQ A;  2BTW B;  4W4U A;  4PAD A;  1Q6K A;  2XU3 A;  1U5I A;  4CDE B;  1YT7 A;  2FQ9 A;  3N3K A;  3PT2 A;  5CHT A;  1U9V A;  3QT4 A;  1X9Y A;  3PDF A;  2YJ2 A;  1ZCM A;  5EZQ A;  5EZS A;  2DC7 A;  4YV8 A;  1YZB A;  2IPP B;  1CV8 A;  3E1Z B;  1EWL A;  2BTW A;  3OVZ A;  1ME4 A;  3BWK A;  1NB3 A;  2PBH A;  3ZNH A;  1MIR A;  1K3B B;  1CJL A;  2G8E A;  3K8U A;  8PCH A;  2R9N A;  2Z84 A;  3O0U A;  2E03 A;  3IHP A;  6PAD A;  1AYW A;  2R9O A;  3C0R A;  2NQG A;  1EWP A;  1MS6 A;  1VSN A;  1YAL A;  3K9M A;  4REZ A;  3CBK A;  4QH6 A;  4BOU A;  4QRX A;  2AIM A;  3BY4 A;  1SP4 B;  4HWY A;  1NB5 A;  2P0R A;  3MP2 A;  3OVX A;  2JQF R;  3TMP A;  5CVO B;  3CBJ A;  4PP1 A;  4XUI A;  4RY2 A;  3GCB A;  4I07 A;  2AU1 A;  4OEL A;  4N8W A;  4W5C A;  1YVB A;  1ATK A;  2JRI A;  4QRV A;  1S4V A;  2E02 A;  3I3T A;  3OIS A;  1POP A;  3MHS A;  2O6X A;  4OEM A;  3HWN A;  2G6D A;  4HXD B;  3LXS A;  3BPM A;  2P86 A;  2VHS A;  2DCC A;  3IOQ A;  4IUM A;  4X6H A;  3PHX A;  3IFU A;  2AYN A;  4PI3 A;  1MDW A;  1CB5 A;  1SNK A;  2DJG B;  3PRP A;  4P6E A;  1PPN A;  1KXR A;  4BOZ A;  1CSB B;  2GFO A;  4W5B A;  2ATO A;  4YYQ A;  3CH2 X;  4BSQ A;  2E00 A;  4MM3 B;  3BC3 A;  2XU4 A;  2AYO A;  2Y6E A;  1ME3 A;  3H8B A;  3O1G A;  4X6I A;  2HD5 A;  3K24 A;  1NLJ A;  4RF1 A;  4BOS A;  1TL9 A;  4YYR A;  5K16 A;  5JH3 A;  4YVA A;  1AYU A;  2FRQ A;  1KFU L;  3BBA A;  3S3R A;  1IWD A;  2WBF X;  4OVZ A;  4FJC A;  3P5X A;  1DEU A;  3IEJ A;  2CB5 A;  2JQG R;  4DMX A;  3P5V A;  5CHV A;  1BQI A;  4N4Z A;  4YYW A;  4YYV A;  1PCI A;  5CVN B;  3BCN A;  4WA6 A;  3B21 A;  3D6S A;  4CDC B;  3CH3 X;  3KKU A;  1NQC A;  3V6E A;  1GCB A;  1MEG A;  2AUZ A;  3H89 A;  2R6N A;  3I06 A;  3PHW A;  3IUT A;  4K7C A;  2ACT A;  2F1G A;  3F5V A;  3RVX A;  5EF4 A;  2DCD A;  3MHH A;  2AGA A;  1CPJ A;  2XU5 A;  3B79 A;  2R9M A;  1PPO A;  2YJ8 A;  4CDD B;  3KW9 A;  3W31 A;  2OUL A;  2FO5 A;  1ICF A;  4CDF B;  2NQA A;  2FRA A;  4RKX A;  1AU3 A;  1UKF A;  2GHU A;  3BPF A;  3W30 A;  1AU2 A;  2F7D A;  3V6C A;  2B1N A;  1CVZ A;  5A24 A;  3PW3 A;  2AS8 A;  2H7J A;  1GEC E;  2Y5B A;  4D8B A;  2BU3 A;  2B1M A;  1MEM A;  4P6G A;  5KO3 A;  2CIO A;  2YJ9 A;  2PAD A;  5JA7 A;  5JZE A;  2XU1 A;  4I05 A;  1A6R A;  4P16 A;  1TLO A;  2FTD A;  2G7Y A;  1AYV A;  2BDZ A;  1PBH A;  4YYU A;  1F2B A;  9PAP A;  4ZTB A;  4RF0 A;  1DF0 A;  2ARY A;  3MTN A;  1MHW A;  1PPP A;  1STF E;  2R9F A;  1KFX L;  2AUX A;  2DCA A;  4XR7 A;  3H7D A;  2FT2 A;  1Y08 A;  2IBI A;  1DKI A;  4BS6 A;  5J94 A;  4BOQ A;  3U8E A;  3H6S A;  1EWM A;  3TRK A;  1PE6 A;  2G8J A;  4FIP A;  1BP4 A;  1EWO A;  3RNV A;  1QXP A;  2J7Q C;  1PIP A;  3AI8 A;  2HHN A;  3PBH A;  1TU6 A;  3WXG A;  3KWZ A;  4BQV A;  1PAD A;  2DJF B;  2YJC A;  2FYE A;  4N79 A;  2DC9 A;  3O65 A;  4PP2 E;  3H8C A;  4BPV A;  2BDL A;  1CQD A;  1Y4H A;  2DOS A;  3RVW A;  2DCB A;  3KSE A;  4BS5 A;  3KFQ A;  2JTC A;  1JQP A;  1U9Q X;  4QBB A; 
#chains in the Genus database with same CATH homology
 1EF7 A;  1XKG A;  1AEC A;  4BGF A;  3HHI A;  2NQI A;  3USV A;  2R9C A;  1YK7 A;  3D9W A;  1AU4 A;  3OF9 A;  3TNX A;  7PCK A;  2VHF A;  4CZW A;  1NPZ A;  2OZ2 A;  2PRE A;  2NQD B;  1GLO A;  3N3G A;  3WXE A;  1BY8 A;  4DMY A;  1O0E A;  2HXZ A;  3KX1 A;  4X6J A;  1QOL A;  5EGW A;  3BOW A;  1F29 A;  3RVV A;  4NV7 A;  3S3Q A;  3MOR A;  1PXV A;  3ZUA A;  1HUC B;  1QMY A;  3M99 A;  4AXM A;  1U9W A;  2DZY A;  1CS8 A;  3PNR A;  1PPD A;  1ZIV A;  3IV2 A;  3HD3 A;  2E01 A;  3LFY A;  3P5W A;  3DF0 A;  3P5U A;  1AIM A;  4MZO A;  1THE A;  5F02 A;  3KWB X;  1QDQ A;  4I04 A;  2DZZ A;  4FK5 A;  2C0Y A;  2AVW A;  2DC8 A;  1VJV A;  2YJB A;  1FH0 A;  1AU0 A;  3QSD A;  3HHA A;  3QJ3 A;  5FPW A;  2HH5 A;  1YK8 A;  1F2C A;  3ERV A;  2DC6 A;  1KHP A;  1U9X A;  4QRG A;  4G54 A;  1M6D A;  1ITO A;  4AXL A;  4YYS A;  2P7U A;  1CTE A;  5PAD A;  2OP3 A;  4MSX A;  3OF8 A;  3C9E A;  1BGO A;  1GMY A;  4Q8H A;  3IMA A;  2FUD A;  4KLB A;  1F2A A;  3NHE A;  1W4T A;  2PNS A;  3F75 A;  5CVM A;  4NV8 A;  3WXF A;  3N4C A;  1NL6 A;  4ZUX U;  4MZS A;  4Q8G A;  1KHQ A;  4W4U A;  4GUZ A;  1Q6K A;  2XU3 A;  1U5I A;  4PAD A;  1YT7 A;  4CDE B;  2FQ9 A;  3N3K A;  5CHT A;  1U9V A;  3QT4 A;  1X9Y A;  3PDF A;  2YJ2 A;  1ZCM A;  1E2T A;  2DC7 A;  4YV8 A;  2IPP B;  1CV8 A;  3E1Z B;  1EWL A;  3OVZ A;  1ME4 A;  3BWK A;  1NB3 A;  2PBH A;  1MIR A;  1K3B B;  1CJL A;  2G8E A;  3K8U A;  8PCH A;  2R9N A;  3O0U A;  2E03 A;  3IHP A;  2VFB A;  6PAD A;  1AYW A;  2R9O A;  2NQG A;  1EWP A;  1MS6 A;  1VSN A;  1YAL A;  3K9M A;  3CBK A;  4QH6 A;  4QRX A;  2AIM A;  1SP4 B;  4HWY A;  1NB5 A;  2P0R A;  3OVX A;  2JQF R;  5CVO B;  3CBJ A;  4PP1 A;  4XUI A;  4RY2 A;  3GCB A;  4I07 A;  2AU1 A;  4OEL A;  4N8W A;  4W5C A;  1YVB A;  1ATK A;  4QRV A;  1S4V A;  2E02 A;  3I3T A;  3OIS A;  1POP A;  3MHS A;  2O6X A;  4OEM A;  3HWN A;  2G6D A;  2VFC A;  3LXS A;  3BPM A;  2P86 A;  2VHS A;  2DCC A;  3IOQ A;  4X6H A;  2AYN A;  4PI3 A;  1MDW A;  1W5R A;  1CB5 A;  1SNK A;  2DJG B;  4P6E A;  1GX3 A;  1KXR A;  1PPN A;  1CSB B;  2GFO A;  4W5B A;  2ATO A;  4YYQ A;  3CH2 X;  4BSQ A;  2E00 A;  3BC3 A;  2XU4 A;  4C5P A;  2AYO A;  2Y6E A;  1ME3 A;  3H8B A;  3O1G A;  4X6I A;  2HD5 A;  3K24 A;  1NLJ A;  1TL9 A;  4YYR A;  5K16 A;  5JH3 A;  4YVA A;  1AYU A;  1W6F A;  2FRQ A;  1KFU L;  3S3R A;  1IWD A;  2WBF X;  4FJC A;  3P5X A;  1DEU A;  2BSZ A;  2CB5 A;  3IEJ A;  2JQG R;  4DMX A;  3P5V A;  5CHV A;  1BQI A;  4N4Z A;  4YYW A;  4YYV A;  1PCI A;  5CVN B;  3BCN A;  4WA6 A;  3D6S A;  4CDC B;  3CH3 X;  3KKU A;  1NQC A;  3V6E A;  1GCB A;  1MEG A;  2AUZ A;  3H89 A;  2R6N A;  3I06 A;  3IUT A;  4K7C A;  2ACT A;  2F1G A;  3F5V A;  3RVX A;  5EF4 A;  2DCD A;  3MHH A;  1CPJ A;  2XU5 A;  3B79 A;  2R9M A;  1PPO A;  2YJ8 A;  4CDD B;  3KW9 A;  2OUL A;  2FO5 A;  1ICF A;  4CDF B;  2NQA A;  2FRA A;  1AU3 A;  2GHU A;  3BPF A;  1AU2 A;  2F7D A;  3V6C A;  2B1N A;  1CVZ A;  5A24 A;  3PW3 A;  2AS8 A;  2H7J A;  1GEC E;  2Y5B A;  2B1M A;  1MEM A;  4P6G A;  2CIO A;  2YJ9 A;  2PAD A;  5JA7 A;  2XU1 A;  4I05 A;  1A6R A;  1TLO A;  2FTD A;  2G7Y A;  1AYV A;  2BDZ A;  1PBH A;  4YYU A;  1F2B A;  9PAP A;  3LTW A;  1DF0 A;  2ARY A;  3MTN A;  1MHW A;  1PPP A;  1STF E;  2R9F A;  1KFX L;  2AUX A;  2DCA A;  4XR7 A;  3H7D A;  2FT2 A;  1Y08 A;  2IBI A;  4BS6 A;  5J94 A;  3U8E A;  3H6S A;  1EWM A;  1PE6 A;  2G8J A;  4FIP A;  1BP4 A;  1EWO A;  1QXP A;  1PIP A;  3AI8 A;  2HHN A;  3PBH A;  1TU6 A;  3WXG A;  3KWZ A;  4BQV A;  1PAD A;  2DJF B;  2YJC A;  2FYE A;  4N79 A;  2DC9 A;  4PP2 E;  3H8C A;  4BPV A;  2BDL A;  4B55 A;  1CQD A;  1Y4H A;  3RVW A;  2DCB A;  3KSE A;  4BS5 A;  3KFQ A;  1JQP A;  1U9Q X;  4QBB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...