4P6EA

Crystal structure of human cathepsin s bound to a non-covalent inhibitor
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
219
structure length
219
Chain Sequence
ILPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin S
publication title Discovery of Cathepsin S Inhibitor LY3000328 for the Treatment of Abdominal Aortic Aneurysm.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 69
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2014-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4p6eA00
2DCDA 3V6CA 2FUDA 3CBJA 2DC8A 4Q8GA 3V6EA 1MDWA 2NQDB 4AXLA 3S3RA 3P5VA 4XUIA 1FH0A 3BC3A 4WA6A 1U9QX 3OISA 1KFUL 2R6NA 1QMYA 1CTEA 3AI8A 1U5IA 2HHNA 2P0RA 2R9CA 3PNRA 2CIOA 5JA7A 1Y4HA 4YYQA 3IUTA 4YV8A 1YK7A 1MEMA 1GECE 4CDEB 1QOLA 3F75A 3WXFA 2FO5A 1DF0A 4I07A 4I04A 1MEGA 2G7YA 2BDLA 1BY8A 3RVWA 2E01A 2OZ2A 3I3TA 1YT7A 3OVZA 1ME3A 1U9WA 1YK8A 1MHWA 3K24A 3N3GA 4P6EA 1PPOA 1AIMA 1CB5A 3KWZA 4K7CA 4PADA 4QBBA 1TL9A 4QRVA 1PIPA 3HHAA 2DC6A 3KSEA 3PDFA 1PE6A 3PBHA 1GMYA 3GCBA 2PREA 2GHUA 2YJCA 5JH3A 3P5XA 2F7DA 4YYRA 1U9XA 2DC7A 2AYNA 1KHPA 3NHEA 2WBFX 2NQAA 1NQCA 1BP4A 1SP4B 1BQIA 5EF4A 3BOWA 1F2AA 3WXEA 4QRGA 5CHTA 1PPNA 4X6IA 1AU4A 2E02A 3HHIA 2FTDA 1NB5A 4CDFB 4BS6A 2HD5A 4X6JA 2PBHA 2AUZA 4CZWA 5A24A 1AYWA 2DC9A 1O0EA 2B1MA 4XR7A 2DCBA 3I06A 2P86A 4OELA 1PPDA 2VHFA 4CDCB 1CSBB 4Q8HA 1AYUA 3IV2A 1NPZA 4YYSA 1F29A 1PCIA 5EGWA 3OF8A 3F5VA 5CVMA 4AXMA 4W4UA 1PADA 2YJ8A 1BGOA 1EWMA 1MIRA 4BPVA 2R9NA 2E03A 1VSNA 2ACTA 2ARYA 2CB5A 2FRQA 2FRAA 3TNXA 3WXGA 1NB3A 1NLJA 2IPPB 3IMAA 3BPMA 4HWYA 4PP2E 3BPFA 1Y08A 2XU5A 2AVWA 2GFOA 2FT2A 1IWDA 1ZIVA 4QH6A 1XKGA 3N3KA 4RY2A 3H89A 5CHVA 1DEUA 1ICFA 1QXPA 2DJGB 3MHHA 1S4VA 1EWLA 1GCBA 7PCKA 2HH5A 2G8EA 4I05A 3IEJA 4YYUA 2XU1A 4OEMA 2JQFR 4MZOA 3BCNA 3N4CA 3USVA 1KXRA 2AIMA 1CS8A 3ZUAA 4YYWA 3QSDA 1EWPA 3CH3X 3KKUA 1KFXL 2AU1A 4YYVA 1GLOA 2AS8A 3K8UA 1ATKA 1CV8A 4P6GA 2XU4A 1TU6A 1PBHA 4YVAA 3H7DA 2NQGA 2JQGR 3B79A 4W5CA 3O0UA 3KWBX 3LFYA 2R9OA 4MSXA 3KW9A 4BSQA 3CH2X 3MTNA 4X6HA 5CVNB 2G8JA 3MHSA 2NQIA 1YVBA 3M99A 3S3QA 3C9EA 4G54A 2R9MA 5PADA 3H8BA 3HD3A 8PCHA 1ITOA 5F02A 2Y6EA 1AYVA 4CDDB 1AU3A 1SNKA 4DMYA 9PAPA 1A6RA 2DZZA 2YJ9A 2PADA 4KLBA 1M6DA 1U9VA 3BWKA 1AU0A 4QRXA 6PADA 4N4ZA 1TLOA 1ZCMA 3DF0A 2YJ2A 2DJFB 2OULA 1KHQA 3H6SA 2E00A 3KFQA 2ATOA 2PNSA 1EF7A 2HXZA 2DCCA 1NL6A 1MS6A 3RVVA 1STFE 3O1GA 4FIPA 2R9FA 2XU3A 1QDQA 2DCAA 5K16A 2B1NA 2AYOA 1K3BB 1AECA 2AUXA 3ERVA 4N8WA 3IHPA 3OF9A 1CPJA 4ZUXU 1F2BA 3D6SA 3H8CA 3E1ZB 2Y5BA 2FYEA 1HUCB 2FQ9A 5CVOB 3RVXA 3P5WA 5FPWA 4W5BA 4BQVA 1CQDA 1EWOA 4PI3A 3K9MA 4PP1A 2O6XA 4FK5A 1F2CA 3CBKA 1PXVA 4DMXA 1AU2A 3P5UA 2VHSA 1ME4A 5J94A 2C0YA 4FJCA 1X9YA 2OP3A 4BS5A 2BDZA 2P7UA 2DZYA 2IBIA 3HWNA 1YALA 3PW3A 2F1GA 1JQPA 3IOQA 1VJVA 4MZSA 3KX1A 3MORA 1Q6KA 2YJBA 3LXSA 2G6DA 1CVZA 1THEA 3U8EA 1CJLA 1POPA 3QJ3A 4N79A 1PPPA 3OVXA 3QT4A 2H7JA
chains in the Genus database with same CATH superfamily
2DCDA 4XZXA 3V6CA 2FUDA 4R3DA 3TMPA 3CBJA 2DC8A 4Q8GA 3V6EA 4BOPA 4MI7A 3C0RA 1MDWA 2NQDB 4AXLA 3S3RA 3P5VA 4XUIA 1FH0A 3BC3A 4WA6A 1U9QX 3OISA 1KFUL 2R6NA 1QMYA 1CTEA 3AI8A 1U5IA 2HHNA 2P0RA 2R9CA 3PNRA 2CIOA 5JA7A 1Y4HA 4YYQA 3IUTA 3W30A 4YV8A 4BOQA 1YK7A 2BU3A 1MEMA 1PVJA 1GECE 4CDEB 1QOLA 3F75A 4P16A 3WXFA 2FO5A 1DF0A 3MP2A 4I07A 4I04A 1MEGA 1YZBA 2G7YA 2BTWB 2BDLA 1BY8A 3RVWA 2E01A 2OZ2A 3I3TA 1YT7A 3OVZA 1ME3A 1U9WA 1YK8A 1MHWA 1UKFA 3K24A 3N3GA 4P6EA 1PPOA 1AIMA 1CB5A 3KWZA 4K7CA 4PADA 4QBBA 1TL9A 4QRVA 4D8EA 1PIPA 3HHAA 2DC6A 4WURA 3KSEA 3E9SA 3PDFA 1PE6A 3PBHA 1GMYA 3GCBA 2PREA 2GHUA 2YJCA 5JH3A 3P5XA 4RF1A 4BOSA 2F7DA 4YYRA 1U9XA 2DC7A 2AYNA 1KHPA 3NHEA 2WBFX 2NQAA 1NQCA 1BP4A 1SP4B 1BQIA 5EF4A 4RNAA 3BOWA 1F2AA 3WXEA 4QRGA 5CHTA 3TRKA 4BOUA 1PPNA 4X6IA 1AU4A 2E02A 3HHIA 2FTDA 3PHXA 1NB5A 4CDFB 4BS6A 2HD5A 4X6JA 2PBHA 2AUZA 4CZWA 5A24A 2DOSA 1AYWA 2DC9A 1O0EA 2B1MA 4XR7A 2DCBA 3I06A 2P86A 4OELA 1PPDA 2VHFA 4REZA 4CDCB 5KO3A 4MM3B 3PRMA 1CSBB 4Q8HA 1AYUA 5EZSA 3IV2A 1NPZA 4YYSA 1F29A 1PCIA 5EGWA 3OF8A 3F5VA 5CVMA 4AXMA 4W4UA 1PADA 2YJ8A 1BGOA 1EWMA 1MIRA 4BPVA 2R9NA 3PT2A 2E03A 1VSNA 2ACTA 2ARYA 2CB5A 2FRQA 2FRAA 3TNXA 3WXGA 1NB3A 1NLJA 4HXDB 2IPPB 3IMAA 3BPMA 4M0WA 4HWYA 4PP2E 3BPFA 1Y08A 2XU5A 2AVWA 2GFOA 2FT2A 2HWKA 1IWDA 1ZIVA 4D8IA 4IUMA 4QH6A 1XKGA 3N3KA 4RY2A 3H89A 3O65A 5CHVA 1DEUA 1ICFA 1QXPA 2DJGB 2UZJA 3MHHA 3ZNHA 1S4VA 1EWLA 1GCBA 7PCKA 2HH5A 2G8EA 4I05A 3IEJA 4YYUA 2XU1A 4OEMA 2JQFR 4MZOA 3BCNA 3N4CA 4OVZA 3USVA 1KXRA 2AIMA 1CS8A 3ZUAA 4YYWA 3RNVA 3QSDA 1EWPA 3CH3X 3KKUA 1KFXL 1DKIA 2AU1A 4YYVA 1GLOA 2AS8A 4GUAA 3K8UA 1ATKA 5JZEA 1CV8A 4P6GA 2XU4A 1TU6A 1PBHA 4YVAA 3H7DA 2NQGA 2JQGR 3B79A 4W5CA 3O0UA 3KWBX 3LFYA 3BB7A 2R9OA 4MSXA 2JRIA 3KW9A 4BSQA 4OW0A 3CH2X 3MTNA 4X6HA 3MJ5A 5CVNB 2G8JA 3MHSA 2NQIA 1YVBA 3M99A 3S3QA 3C9EA 4G54A 4D8BA 2R9MA 3PHWA 3BBAA 5EZQA 3IFUA 2J7QC 5PADA 2J7QA 3PRPA 3H8BA 3HD3A 3OQCA 8PCHA 1ITOA 3B21A 5F02A 4OVZB 2Y6EA 1AYVA 4CDDB 1AU3A 1SNKA 4DMYA 9PAPA 1A6RA 2DZZA 2YJ9A 2PADA 4KLBA 4PT5A 4BOZA 1M6DA 1U9VA 3BWKA 1AU0A 4QRXA 6PADA 4N4ZA 3MTVA 1TLOA 1ZCMA 3DF0A 2YJ2A 2DJFB 2Z84A 2OULA 1KHQA 3H6SA 2E00A 3KFQA 4RKXA 2ATOA 2PNSA 1EF7A 3PHUA 2HXZA 4IP3A 4RF0A 2DCCA 1NL6A 1MS6A 3RVVA 1STFE 3O1GA 4FIPA 2R9FA 2XU3A 2AGAA 1QDQA 2DCAA 5K16A 2B1NA 2AYOA 1K3BB 1AECA 2AUXA 3ERVA 4N8WA 3BY4A 3W31A 3IHPA 3OF9A 1CPJA 4ZUXU 1F2BA 3D6SA 3H8CA 4A5UA 3E1ZB 2Y5BA 2FYEA 1HUCB 2FQ9A 5CVOB 3RVXA 3P5WA 5FPWA 4W5BA 4BQVA 1CQDA 1EWOA 4PI3A 3K9MA 4PP1A 2O6XA 4FK5A 1F2CA 3CBKA 1PXVA 4DMXA 1AU2A 3P5UA 2VHSA 1ME4A 5J94A 2C0YA 4FJCA 1X9YA 2OP3A 4BS5A 4ZTBA 2BDZA 2P7UA 2DZYA 2IBIA 3HWNA 1YALA 3PW3A 2F1GA 1JQPA 3IOQA 5E6JA 1VJVA 4MZSA 3KX1A 3MORA 2FE8A 1Q6KA 2YJBA 3LXSA 3PSEA 2G6DA 1CVZA 1THEA 2BTWA 3U8EA 1CJLA 1POPA 2JTCA 3QJ3A 4N79A 1PPPA 3OVXA 3QT4A 2H7JA
chains in the Genus database with same CATH topology
2DCDA 3V6CA 2FUDA 3CBJA 2DC8A 4Q8GA 3V6EA 1MDWA 2NQDB 4AXLA 3S3RA 3P5VA 4XUIA 1FH0A 3BC3A 4WA6A 1U9QX 3OISA 1KFUL 2R6NA 1QMYA 1CTEA 3AI8A 1U5IA 2HHNA 2P0RA 2R9CA 3PNRA 2CIOA 5JA7A 1Y4HA 4YYQA 3IUTA 4YV8A 1YK7A 1MEMA 1GECE 4CDEB 1QOLA 3F75A 3WXFA 2FO5A 1DF0A 4I07A 4I04A 1MEGA 2G7YA 2BDLA 1BY8A 3RVWA 2E01A 2OZ2A 3I3TA 1YT7A 3OVZA 1ME3A 1U9WA 1YK8A 1MHWA 3K24A 3N3GA 4P6EA 1PPOA 1AIMA 1CB5A 3KWZA 4K7CA 4PADA 4QBBA 1TL9A 4QRVA 1PIPA 3HHAA 2DC6A 3KSEA 3PDFA 1PE6A 3PBHA 1GMYA 3GCBA 2PREA 2GHUA 1GX3A 2YJCA 5JH3A 3P5XA 2F7DA 1W5RA 4YYRA 1U9XA 2DC7A 2AYNA 1KHPA 3NHEA 2WBFX 2NQAA 1NQCA 1BP4A 1SP4B 1BQIA 5EF4A 3BOWA 1F2AA 3WXEA 4QRGA 5CHTA 1PPNA 4X6IA 1AU4A 2E02A 3HHIA 2FTDA 1NB5A 4CDFB 4BS6A 2HD5A 4X6JA 2PBHA 2AUZA 4CZWA 5A24A 1AYWA 2DC9A 1O0EA 2B1MA 4XR7A 2DCBA 3I06A 2P86A 4OELA 1PPDA 2VHFA 4CDCB 1CSBB 4Q8HA 1AYUA 3IV2A 1NPZA 4YYSA 1F29A 1PCIA 5EGWA 3OF8A 3F5VA 5CVMA 4AXMA 1W4TA 4W4UA 1PADA 2YJ8A 1BGOA 1EWMA 1MIRA 4BPVA 2R9NA 2E03A 1VSNA 2ACTA 2ARYA 2CB5A 2FRQA 2FRAA 3TNXA 3WXGA 1NB3A 1NLJA 2IPPB 3IMAA 3BPMA 4HWYA 4PP2E 3BPFA 1Y08A 2XU5A 2AVWA 2GFOA 2FT2A 1IWDA 1ZIVA 4QH6A 1XKGA 3N3KA 4RY2A 3H89A 5CHVA 1DEUA 1ICFA 1QXPA 2DJGB 1W6FA 3MHHA 1S4VA 1EWLA 1GCBA 7PCKA 2HH5A 2G8EA 4I05A 3IEJA 4YYUA 2XU1A 4OEMA 3D9WA 2JQFR 4NV7A 4MZOA 3BCNA 4C5PA 3N4CA 3USVA 1KXRA 2VFCA 2AIMA 1CS8A 3ZUAA 4YYWA 3QSDA 1EWPA 3CH3X 3KKUA 1KFXL 2AU1A 4YYVA 1GLOA 2AS8A 3K8UA 1ATKA 1CV8A 4P6GA 2XU4A 1TU6A 1PBHA 4YVAA 3H7DA 2NQGA 2JQGR 3B79A 4W5CA 3O0UA 3KWBX 3LFYA 2R9OA 4MSXA 3KW9A 4BSQA 3CH2X 3MTNA 2BSZA 4X6HA 5CVNB 2G8JA 3MHSA 2NQIA 1YVBA 3M99A 3S3QA 4BGFA 3C9EA 4G54A 2R9MA 5PADA 3H8BA 1E2TA 3HD3A 8PCHA 1ITOA 5F02A 2Y6EA 1AYVA 4CDDB 1AU3A 1SNKA 4DMYA 9PAPA 1A6RA 2DZZA 2YJ9A 2PADA 4KLBA 1M6DA 1U9VA 3BWKA 1AU0A 3LTWA 4QRXA 6PADA 4N4ZA 1TLOA 1ZCMA 3DF0A 2YJ2A 2DJFB 2OULA 1KHQA 3H6SA 2VFBA 2E00A 3KFQA 2ATOA 2PNSA 1EF7A 2HXZA 2DCCA 4GUZA 1NL6A 1MS6A 3RVVA 1STFE 3O1GA 4FIPA 2R9FA 2XU3A 1QDQA 2DCAA 5K16A 2B1NA 2AYOA 1K3BB 1AECA 2AUXA 3ERVA 4N8WA 3IHPA 3OF9A 1CPJA 4ZUXU 1F2BA 3D6SA 3H8CA 3E1ZB 2Y5BA 2FYEA 1HUCB 2FQ9A 5CVOB 3RVXA 3P5WA 5FPWA 4W5BA 4BQVA 1CQDA 1EWOA 4PI3A 3K9MA 4PP1A 2O6XA 4FK5A 1F2CA 3CBKA 1PXVA 4B55A 4DMXA 1AU2A 3P5UA 2VHSA 1ME4A 5J94A 2C0YA 4FJCA 1X9YA 2OP3A 4BS5A 2BDZA 2P7UA 2DZYA 2IBIA 3HWNA 1YALA 3PW3A 2F1GA 4NV8A 1JQPA 3IOQA 1VJVA 4MZSA 3KX1A 3MORA 1Q6KA 2YJBA 3LXSA 2G6DA 1CVZA 1THEA 3U8EA 1CJLA 1POPA 3QJ3A 4N79A 1PPPA 3OVXA 3QT4A 2H7JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DCD A;  3V6C A;  2FUD A;  3CBJ A;  2DC8 A;  4Q8G A;  3V6E A;  1MDW A;  2NQD B;  4AXL A;  3S3R A;  3P5V A;  4XUI A;  1FH0 A;  3BC3 A;  4WA6 A;  1U9Q X;  3OIS A;  1KFU L;  2R6N A;  1QMY A;  1CTE A;  3AI8 A;  1U5I A;  2HHN A;  2P0R A;  2R9C A;  3PNR A;  2CIO A;  5JA7 A;  1Y4H A;  4YYQ A;  3IUT A;  4YV8 A;  1YK7 A;  1MEM A;  1GEC E;  4CDE B;  1QOL A;  3F75 A;  3WXF A;  2FO5 A;  1DF0 A;  4I07 A;  4I04 A;  1MEG A;  2G7Y A;  2BDL A;  1BY8 A;  3RVW A;  2E01 A;  2OZ2 A;  3I3T A;  1YT7 A;  3OVZ A;  1ME3 A;  1U9W A;  1YK8 A;  1MHW A;  3K24 A;  3N3G A;  4P6E A;  1PPO A;  1AIM A;  1CB5 A;  3KWZ A;  4K7C A;  4PAD A;  4QBB A;  1TL9 A;  4QRV A;  1PIP A;  3HHA A;  2DC6 A;  3KSE A;  3PDF A;  1PE6 A;  3PBH A;  1GMY A;  3GCB A;  2PRE A;  2GHU A;  2YJC A;  5JH3 A;  3P5X A;  2F7D A;  4YYR A;  1U9X A;  2DC7 A;  2AYN A;  1KHP A;  3NHE A;  2WBF X;  2NQA A;  1NQC A;  1BP4 A;  1SP4 B;  1BQI A;  5EF4 A;  3BOW A;  1F2A A;  3WXE A;  4QRG A;  5CHT A;  1PPN A;  4X6I A;  1AU4 A;  2E02 A;  3HHI A;  2FTD A;  1NB5 A;  4CDF B;  4BS6 A;  2HD5 A;  4X6J A;  2PBH A;  2AUZ A;  4CZW A;  5A24 A;  1AYW A;  2DC9 A;  1O0E A;  2B1M A;  4XR7 A;  2DCB A;  3I06 A;  2P86 A;  4OEL A;  1PPD A;  2VHF A;  4CDC B;  1CSB B;  4Q8H A;  1AYU A;  3IV2 A;  1NPZ A;  4YYS A;  1F29 A;  1PCI A;  5EGW A;  3OF8 A;  3F5V A;  5CVM A;  4AXM A;  4W4U A;  1PAD A;  2YJ8 A;  1BGO A;  1EWM A;  1MIR A;  4BPV A;  2R9N A;  2E03 A;  1VSN A;  2ACT A;  2ARY A;  2CB5 A;  2FRQ A;  2FRA A;  3TNX A;  3WXG A;  1NB3 A;  1NLJ A;  2IPP B;  3IMA A;  3BPM A;  4HWY A;  4PP2 E;  3BPF A;  1Y08 A;  2XU5 A;  2AVW A;  2GFO A;  2FT2 A;  1IWD A;  1ZIV A;  4QH6 A;  1XKG A;  3N3K A;  4RY2 A;  3H89 A;  5CHV A;  1DEU A;  1ICF A;  1QXP A;  2DJG B;  3MHH A;  1S4V A;  1EWL A;  1GCB A;  7PCK A;  2HH5 A;  2G8E A;  4I05 A;  3IEJ A;  4YYU A;  2XU1 A;  4OEM A;  2JQF R;  4MZO A;  3BCN A;  3N4C A;  3USV A;  1KXR A;  2AIM A;  1CS8 A;  3ZUA A;  4YYW A;  3QSD A;  1EWP A;  3CH3 X;  3KKU A;  1KFX L;  2AU1 A;  4YYV A;  1GLO A;  2AS8 A;  3K8U A;  1ATK A;  1CV8 A;  4P6G A;  2XU4 A;  1TU6 A;  1PBH A;  4YVA A;  3H7D A;  2NQG A;  2JQG R;  3B79 A;  4W5C A;  3O0U A;  3KWB X;  3LFY A;  2R9O A;  4MSX A;  3KW9 A;  4BSQ A;  3CH2 X;  3MTN A;  4X6H A;  5CVN B;  2G8J A;  3MHS A;  2NQI A;  1YVB A;  3M99 A;  3S3Q A;  3C9E A;  4G54 A;  2R9M A;  5PAD A;  3H8B A;  3HD3 A;  8PCH A;  1ITO A;  5F02 A;  2Y6E A;  1AYV A;  4CDD B;  1AU3 A;  1SNK A;  4DMY A;  9PAP A;  1A6R A;  2DZZ A;  2YJ9 A;  2PAD A;  4KLB A;  1M6D A;  1U9V A;  3BWK A;  1AU0 A;  4QRX A;  6PAD A;  4N4Z A;  1TLO A;  1ZCM A;  3DF0 A;  2YJ2 A;  2DJF B;  2OUL A;  1KHQ A;  3H6S A;  2E00 A;  3KFQ A;  2ATO A;  2PNS A;  1EF7 A;  2HXZ A;  2DCC A;  1NL6 A;  1MS6 A;  3RVV A;  1STF E;  3O1G A;  4FIP A;  2R9F A;  2XU3 A;  1QDQ A;  2DCA A;  5K16 A;  2B1N A;  2AYO A;  1K3B B;  1AEC A;  2AUX A;  3ERV A;  4N8W A;  3IHP A;  3OF9 A;  1CPJ A;  4ZUX U;  1F2B A;  3D6S A;  3H8C A;  3E1Z B;  2Y5B A;  2FYE A;  1HUC B;  2FQ9 A;  5CVO B;  3RVX A;  3P5W A;  5FPW A;  4W5B A;  4BQV A;  1CQD A;  1EWO A;  4PI3 A;  3K9M A;  4PP1 A;  2O6X A;  4FK5 A;  1F2C A;  3CBK A;  1PXV A;  4DMX A;  1AU2 A;  3P5U A;  2VHS A;  1ME4 A;  5J94 A;  2C0Y A;  4FJC A;  1X9Y A;  2OP3 A;  4BS5 A;  2BDZ A;  2P7U A;  2DZY A;  2IBI A;  3HWN A;  1YAL A;  3PW3 A;  2F1G A;  1JQP A;  3IOQ A;  1VJV A;  4MZS A;  3KX1 A;  3MOR A;  1Q6K A;  2YJB A;  3LXS A;  2G6D A;  1CVZ A;  1THE A;  3U8E A;  1CJL A;  1POP A;  3QJ3 A;  4N79 A;  1PPP A;  3OVX A;  3QT4 A;  2H7J A; 
#chains in the Genus database with same CATH topology
 2DCD A;  4XZX A;  3V6C A;  2FUD A;  4R3D A;  3TMP A;  3CBJ A;  2DC8 A;  4Q8G A;  3V6E A;  4BOP A;  4MI7 A;  3C0R A;  1MDW A;  2NQD B;  4AXL A;  3S3R A;  3P5V A;  4XUI A;  1FH0 A;  3BC3 A;  4WA6 A;  1U9Q X;  3OIS A;  1KFU L;  2R6N A;  1QMY A;  1CTE A;  3AI8 A;  1U5I A;  2HHN A;  2P0R A;  2R9C A;  3PNR A;  2CIO A;  5JA7 A;  1Y4H A;  4YYQ A;  3IUT A;  3W30 A;  4YV8 A;  4BOQ A;  1YK7 A;  2BU3 A;  1MEM A;  1PVJ A;  1GEC E;  4CDE B;  1QOL A;  3F75 A;  4P16 A;  3WXF A;  2FO5 A;  1DF0 A;  3MP2 A;  4I07 A;  4I04 A;  1MEG A;  1YZB A;  2G7Y A;  2BTW B;  2BDL A;  1BY8 A;  3RVW A;  2E01 A;  2OZ2 A;  3I3T A;  1YT7 A;  3OVZ A;  1ME3 A;  1U9W A;  1YK8 A;  1MHW A;  1UKF A;  3K24 A;  3N3G A;  4P6E A;  1PPO A;  1AIM A;  1CB5 A;  3KWZ A;  4K7C A;  4PAD A;  4QBB A;  1TL9 A;  4QRV A;  4D8E A;  1PIP A;  3HHA A;  2DC6 A;  4WUR A;  3KSE A;  3E9S A;  3PDF A;  1PE6 A;  3PBH A;  1GMY A;  3GCB A;  2PRE A;  2GHU A;  2YJC A;  5JH3 A;  3P5X A;  4RF1 A;  4BOS A;  2F7D A;  4YYR A;  1U9X A;  2DC7 A;  2AYN A;  1KHP A;  3NHE A;  2WBF X;  2NQA A;  1NQC A;  1BP4 A;  1SP4 B;  1BQI A;  5EF4 A;  4RNA A;  3BOW A;  1F2A A;  3WXE A;  4QRG A;  5CHT A;  3TRK A;  4BOU A;  1PPN A;  4X6I A;  1AU4 A;  2E02 A;  3HHI A;  2FTD A;  3PHX A;  1NB5 A;  4CDF B;  4BS6 A;  2HD5 A;  4X6J A;  2PBH A;  2AUZ A;  4CZW A;  5A24 A;  2DOS A;  1AYW A;  2DC9 A;  1O0E A;  2B1M A;  4XR7 A;  2DCB A;  3I06 A;  2P86 A;  4OEL A;  1PPD A;  2VHF A;  4REZ A;  4CDC B;  5KO3 A;  4MM3 B;  3PRM A;  1CSB B;  4Q8H A;  1AYU A;  5EZS A;  3IV2 A;  1NPZ A;  4YYS A;  1F29 A;  1PCI A;  5EGW A;  3OF8 A;  3F5V A;  5CVM A;  4AXM A;  4W4U A;  1PAD A;  2YJ8 A;  1BGO A;  1EWM A;  1MIR A;  4BPV A;  2R9N A;  3PT2 A;  2E03 A;  1VSN A;  2ACT A;  2ARY A;  2CB5 A;  2FRQ A;  2FRA A;  3TNX A;  3WXG A;  1NB3 A;  1NLJ A;  4HXD B;  2IPP B;  3IMA A;  3BPM A;  4M0W A;  4HWY A;  4PP2 E;  3BPF A;  1Y08 A;  2XU5 A;  2AVW A;  2GFO A;  2FT2 A;  2HWK A;  1IWD A;  1ZIV A;  4D8I A;  4IUM A;  4QH6 A;  1XKG A;  3N3K A;  4RY2 A;  3H89 A;  3O65 A;  5CHV A;  1DEU A;  1ICF A;  1QXP A;  2DJG B;  2UZJ A;  3MHH A;  3ZNH A;  1S4V A;  1EWL A;  1GCB A;  7PCK A;  2HH5 A;  2G8E A;  4I05 A;  3IEJ A;  4YYU A;  2XU1 A;  4OEM A;  2JQF R;  4MZO A;  3BCN A;  3N4C A;  4OVZ A;  3USV A;  1KXR A;  2AIM A;  1CS8 A;  3ZUA A;  4YYW A;  3RNV A;  3QSD A;  1EWP A;  3CH3 X;  3KKU A;  1KFX L;  1DKI A;  2AU1 A;  4YYV A;  1GLO A;  2AS8 A;  4GUA A;  3K8U A;  1ATK A;  5JZE A;  1CV8 A;  4P6G A;  2XU4 A;  1TU6 A;  1PBH A;  4YVA A;  3H7D A;  2NQG A;  2JQG R;  3B79 A;  4W5C A;  3O0U A;  3KWB X;  3LFY A;  3BB7 A;  2R9O A;  4MSX A;  2JRI A;  3KW9 A;  4BSQ A;  4OW0 A;  3CH2 X;  3MTN A;  4X6H A;  3MJ5 A;  5CVN B;  2G8J A;  3MHS A;  2NQI A;  1YVB A;  3M99 A;  3S3Q A;  3C9E A;  4G54 A;  4D8B A;  2R9M A;  3PHW A;  3BBA A;  5EZQ A;  3IFU A;  2J7Q C;  5PAD A;  2J7Q A;  3PRP A;  3H8B A;  3HD3 A;  3OQC A;  8PCH A;  1ITO A;  3B21 A;  5F02 A;  4OVZ B;  2Y6E A;  1AYV A;  4CDD B;  1AU3 A;  1SNK A;  4DMY A;  9PAP A;  1A6R A;  2DZZ A;  2YJ9 A;  2PAD A;  4KLB A;  4PT5 A;  4BOZ A;  1M6D A;  1U9V A;  3BWK A;  1AU0 A;  4QRX A;  6PAD A;  4N4Z A;  3MTV A;  1TLO A;  1ZCM A;  3DF0 A;  2YJ2 A;  2DJF B;  2Z84 A;  2OUL A;  1KHQ A;  3H6S A;  2E00 A;  3KFQ A;  4RKX A;  2ATO A;  2PNS A;  1EF7 A;  3PHU A;  2HXZ A;  4IP3 A;  4RF0 A;  2DCC A;  1NL6 A;  1MS6 A;  3RVV A;  1STF E;  3O1G A;  4FIP A;  2R9F A;  2XU3 A;  2AGA A;  1QDQ A;  2DCA A;  5K16 A;  2B1N A;  2AYO A;  1K3B B;  1AEC A;  2AUX A;  3ERV A;  4N8W A;  3BY4 A;  3W31 A;  3IHP A;  3OF9 A;  1CPJ A;  4ZUX U;  1F2B A;  3D6S A;  3H8C A;  4A5U A;  3E1Z B;  2Y5B A;  2FYE A;  1HUC B;  2FQ9 A;  5CVO B;  3RVX A;  3P5W A;  5FPW A;  4W5B A;  4BQV A;  1CQD A;  1EWO A;  4PI3 A;  3K9M A;  4PP1 A;  2O6X A;  4FK5 A;  1F2C A;  3CBK A;  1PXV A;  4DMX A;  1AU2 A;  3P5U A;  2VHS A;  1ME4 A;  5J94 A;  2C0Y A;  4FJC A;  1X9Y A;  2OP3 A;  4BS5 A;  4ZTB A;  2BDZ A;  2P7U A;  2DZY A;  2IBI A;  3HWN A;  1YAL A;  3PW3 A;  2F1G A;  1JQP A;  3IOQ A;  5E6J A;  1VJV A;  4MZS A;  3KX1 A;  3MOR A;  2FE8 A;  1Q6K A;  2YJB A;  3LXS A;  3PSE A;  2G6D A;  1CVZ A;  1THE A;  2BTW A;  3U8E A;  1CJL A;  1POP A;  2JTC A;  3QJ3 A;  4N79 A;  1PPP A;  3OVX A;  3QT4 A;  2H7J A; 
#chains in the Genus database with same CATH homology
 2DCD A;  3V6C A;  2FUD A;  3CBJ A;  2DC8 A;  4Q8G A;  3V6E A;  1MDW A;  2NQD B;  4AXL A;  3S3R A;  3P5V A;  4XUI A;  1FH0 A;  3BC3 A;  4WA6 A;  1U9Q X;  3OIS A;  1KFU L;  2R6N A;  1QMY A;  1CTE A;  3AI8 A;  1U5I A;  2HHN A;  2P0R A;  2R9C A;  3PNR A;  2CIO A;  5JA7 A;  1Y4H A;  4YYQ A;  3IUT A;  4YV8 A;  1YK7 A;  1MEM A;  1GEC E;  4CDE B;  1QOL A;  3F75 A;  3WXF A;  2FO5 A;  1DF0 A;  4I07 A;  4I04 A;  1MEG A;  2G7Y A;  2BDL A;  1BY8 A;  3RVW A;  2E01 A;  2OZ2 A;  3I3T A;  1YT7 A;  3OVZ A;  1ME3 A;  1U9W A;  1YK8 A;  1MHW A;  3K24 A;  3N3G A;  4P6E A;  1PPO A;  1AIM A;  1CB5 A;  3KWZ A;  4K7C A;  4PAD A;  4QBB A;  1TL9 A;  4QRV A;  1PIP A;  3HHA A;  2DC6 A;  3KSE A;  3PDF A;  1PE6 A;  3PBH A;  1GMY A;  3GCB A;  2PRE A;  2GHU A;  1GX3 A;  2YJC A;  5JH3 A;  3P5X A;  2F7D A;  1W5R A;  4YYR A;  1U9X A;  2DC7 A;  2AYN A;  1KHP A;  3NHE A;  2WBF X;  2NQA A;  1NQC A;  1BP4 A;  1SP4 B;  1BQI A;  5EF4 A;  3BOW A;  1F2A A;  3WXE A;  4QRG A;  5CHT A;  1PPN A;  4X6I A;  1AU4 A;  2E02 A;  3HHI A;  2FTD A;  1NB5 A;  4CDF B;  4BS6 A;  2HD5 A;  4X6J A;  2PBH A;  2AUZ A;  4CZW A;  5A24 A;  1AYW A;  2DC9 A;  1O0E A;  2B1M A;  4XR7 A;  2DCB A;  3I06 A;  2P86 A;  4OEL A;  1PPD A;  2VHF A;  4CDC B;  1CSB B;  4Q8H A;  1AYU A;  3IV2 A;  1NPZ A;  4YYS A;  1F29 A;  1PCI A;  5EGW A;  3OF8 A;  3F5V A;  5CVM A;  4AXM A;  1W4T A;  4W4U A;  1PAD A;  2YJ8 A;  1BGO A;  1EWM A;  1MIR A;  4BPV A;  2R9N A;  2E03 A;  1VSN A;  2ACT A;  2ARY A;  2CB5 A;  2FRQ A;  2FRA A;  3TNX A;  3WXG A;  1NB3 A;  1NLJ A;  2IPP B;  3IMA A;  3BPM A;  4HWY A;  4PP2 E;  3BPF A;  1Y08 A;  2XU5 A;  2AVW A;  2GFO A;  2FT2 A;  1IWD A;  1ZIV A;  4QH6 A;  1XKG A;  3N3K A;  4RY2 A;  3H89 A;  5CHV A;  1DEU A;  1ICF A;  1QXP A;  2DJG B;  1W6F A;  3MHH A;  1S4V A;  1EWL A;  1GCB A;  7PCK A;  2HH5 A;  2G8E A;  4I05 A;  3IEJ A;  4YYU A;  2XU1 A;  4OEM A;  3D9W A;  2JQF R;  4NV7 A;  4MZO A;  3BCN A;  4C5P A;  3N4C A;  3USV A;  1KXR A;  2VFC A;  2AIM A;  1CS8 A;  3ZUA A;  4YYW A;  3QSD A;  1EWP A;  3CH3 X;  3KKU A;  1KFX L;  2AU1 A;  4YYV A;  1GLO A;  2AS8 A;  3K8U A;  1ATK A;  1CV8 A;  4P6G A;  2XU4 A;  1TU6 A;  1PBH A;  4YVA A;  3H7D A;  2NQG A;  2JQG R;  3B79 A;  4W5C A;  3O0U A;  3KWB X;  3LFY A;  2R9O A;  4MSX A;  3KW9 A;  4BSQ A;  3CH2 X;  3MTN A;  2BSZ A;  4X6H A;  5CVN B;  2G8J A;  3MHS A;  2NQI A;  1YVB A;  3M99 A;  3S3Q A;  4BGF A;  3C9E A;  4G54 A;  2R9M A;  5PAD A;  3H8B A;  1E2T A;  3HD3 A;  8PCH A;  1ITO A;  5F02 A;  2Y6E A;  1AYV A;  4CDD B;  1AU3 A;  1SNK A;  4DMY A;  9PAP A;  1A6R A;  2DZZ A;  2YJ9 A;  2PAD A;  4KLB A;  1M6D A;  1U9V A;  3BWK A;  1AU0 A;  3LTW A;  4QRX A;  6PAD A;  4N4Z A;  1TLO A;  1ZCM A;  3DF0 A;  2YJ2 A;  2DJF B;  2OUL A;  1KHQ A;  3H6S A;  2VFB A;  2E00 A;  3KFQ A;  2ATO A;  2PNS A;  1EF7 A;  2HXZ A;  2DCC A;  4GUZ A;  1NL6 A;  1MS6 A;  3RVV A;  1STF E;  3O1G A;  4FIP A;  2R9F A;  2XU3 A;  1QDQ A;  2DCA A;  5K16 A;  2B1N A;  2AYO A;  1K3B B;  1AEC A;  2AUX A;  3ERV A;  4N8W A;  3IHP A;  3OF9 A;  1CPJ A;  4ZUX U;  1F2B A;  3D6S A;  3H8C A;  3E1Z B;  2Y5B A;  2FYE A;  1HUC B;  2FQ9 A;  5CVO B;  3RVX A;  3P5W A;  5FPW A;  4W5B A;  4BQV A;  1CQD A;  1EWO A;  4PI3 A;  3K9M A;  4PP1 A;  2O6X A;  4FK5 A;  1F2C A;  3CBK A;  1PXV A;  4B55 A;  4DMX A;  1AU2 A;  3P5U A;  2VHS A;  1ME4 A;  5J94 A;  2C0Y A;  4FJC A;  1X9Y A;  2OP3 A;  4BS5 A;  2BDZ A;  2P7U A;  2DZY A;  2IBI A;  3HWN A;  1YAL A;  3PW3 A;  2F1G A;  4NV8 A;  1JQP A;  3IOQ A;  1VJV A;  4MZS A;  3KX1 A;  3MOR A;  1Q6K A;  2YJB A;  3LXS A;  2G6D A;  1CVZ A;  1THE A;  3U8E A;  1CJL A;  1POP A;  3QJ3 A;  4N79 A;  1PPP A;  3OVX A;  3QT4 A;  2H7J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...