4P6EA

Crystal structure of human cathepsin s bound to a non-covalent inhibitor
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
219
structure length
219
Chain Sequence
ILPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of Cathepsin S Inhibitor LY3000328 for the Treatment of Abdominal Aortic Aneurysm.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cathepsin S
total genus 69
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2014-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4p6eA00
1CTEA 1AYUA 5CVOB 1U9VA 1VSNA 2CB5A 1U9XA 1THEA 2AYOA 3LXSA 2DZZA 3C9EA 4FK5A 3N3GA 1PPDA 4FJCA 5EGWA 1YT7A 2R9CA 1VJVA 3E1ZB 3IOQA 4PP1A 4YYRA 2OZ2A 7PCKA 2AYNA 3K24A 1JQPA 4YYSA 2ARYA 1KHQA 1HUCB 1EWMA 4PP2E 4W5CA 4RY2A 4QBBA 4QRVA 1X9YA 1KHPA 2E01A 3HHAA 5CVMA 1A6RA 1MIRA 4YV8A 2CIOA 1DEUA 2IPPB 1U5IA 3QT4A 4X6IA 1ME3A 4AXMA 4QRXA 4Q8GA 3MHHA 1AU2A 1YALA 3IHPA 4K7CA 1QOLA 2DC6A 2FRQA 3D6SA 1TU6A 5PADA 2ACTA 3MHSA 3U8EA 3V6EA 2F1GA 4BQVA 1CSBB 4BPVA 5F02A 2DCCA 2DCDA 2WBFX 2Y5BA 5CHTA 3WXEA 1ME4A 1NB5A 2O6XA 4X6HA 1KFXL 1CS8A 3O0UA 3O1GA 2F7DA 2FTDA 3DF0A 2E00A 2PREA 3S3RA 3USVA 3I3TA 3KW9A 1O0EA 5A24A 1Y08A 1EWLA 1POPA 3KX1A 1FH0A 4W4UA 2R6NA 1GCBA 2R9FA 2G6DA 1AYWA 2XU4A 4G54A 2AU1A 5J94A 1F2CA 3OVZA 2AVWA 2FYEA 1CB5A 2NQAA 1PIPA 1YVBA 2AS8A 2DZYA 2VHSA 4CZWA 2FRAA 2NQIA 4Q8HA 1ATKA 3PW3A 3H7DA 1AYVA 2E03A 2HH5A 2R9NA 2Y6EA 3OF9A 3PDFA 2YJ2A 3RVVA 4ZUXU 2PNSA 2YJ9A 3MORA 2YJ8A 1F29A 3LFYA 3BWKA 3RVXA 3N4CA 1CPJA 4YVAA 5CHVA 3B79A 2DCBA 2IBIA 4CDDB 1TLOA 4I07A 1AECA 1ZIVA 1PBHA 2ATOA 1BP4A 4XR7A 4P6GA 1QXPA 3P5UA 4MZSA 1Q6KA 1BGOA 1SNKA 4MSXA 2DC7A 1KXRA 4YYVA 4HWYA 4YYWA 2G7YA 1NB3A 4BS6A 1QDQA 2GFOA 2HHNA 4PADA 4OELA 1PE6A 2XU1A 1XKGA 4MZOA 3K8UA 2PBHA 2C0YA 2DJGB 3H6SA 4N4ZA 3WXFA 3BOWA 4P6EA 2B1NA 3IMAA 4AXLA 4I04A 2XU3A 3OF8A 2AIMA 8PCHA 3MTNA 1ITOA 3QJ3A 4X6JA 2R9OA 2JQFR 1CV8A 3M99A 3BPFA 1AIMA 1KFUL 2AUXA 2DJFB 3CH3X 3BC3A 2HD5A 1DF0A 3IV2A 3OVXA 1QMYA 1CJLA 1MEMA 1EWPA 3H8CA 3QSDA 3WXGA 2G8EA 3HD3A 2YJCA 3NHEA 3H8BA 3F75A 1SP4B 3GCBA 2NQGA 4PI3A 1MEGA 1TL9A 1BY8A 3V6CA 3BCNA 2DC8A 1YK8A 2FUDA 2P7UA 3I06A 1PXVA 1F2AA 3CBKA 1M6DA 2XU5A 3P5VA 3OISA 4CDEB 4I05A 1F2BA 5JA7A 4DMYA 4N8WA 3TNXA 2JQGR 2E02A 4XUIA 1U9WA 3KSEA 1PPOA 1GMYA 3CH2X 1S4VA 3PBHA 1NL6A 3CBJA 1EWOA 3IEJA 3HHIA 3IUTA 1NPZA 2B1MA 1MHWA 4FIPA 4CDFB 2R9MA 2BDLA 2HXZA 2P0RA 4OEMA 4YYQA 3ZUAA 1AU3A 5FPWA 3PNRA 5EF4A 1K3BB 3KWBX 2BDZA 2G8JA 5CVNB 3S3QA 4KLBA 1PADA 1PCIA 3F5VA 3HWNA 2FT2A 3KWZA 2YJBA 4WA6A 1MS6A 1CVZA 2NQDB 4DMXA 3ERVA 2P86A 1GECE 4CDCB 1AU0A 5JH3A 1ZCMA 1MDWA 4W5BA 2H7JA 4YYUA 1PPNA 3KKUA 1GLOA 2OULA 5K16A 1EF7A 3K9MA 2DCAA 3BPMA 1BQIA 1U9QX 2VHFA 1Y4HA 2FQ9A 3KFQA 1PPPA 1IWDA 4QH6A 1NQCA 2AUZA 1AU4A 4QRGA 3H89A 3P5XA 1ICFA 4N79A 9PAPA 2DC9A 3RVWA 2OP3A 3P5WA 1NLJA 2PADA 6PADA 4BSQA 3N3KA 1CQDA 3AI8A 1STFE 2FO5A 1YK7A 2GHUA 4BS5A
chains in the Genus database with same CATH superfamily
1CTEA 1AYUA 5CVOB 1U9VA 1VSNA 2CB5A 1U9XA 1THEA 2AYOA 4GUAA 3LXSA 2DZZA 3C9EA 4FK5A 3N3GA 4MI7A 1PPDA 4FJCA 5EGWA 1YT7A 2R9CA 3PT2A 1VJVA 3E1ZB 3IOQA 4PP1A 4YYRA 2OZ2A 7PCKA 2AYNA 3K24A 1JQPA 4YYSA 2ARYA 1KHQA 1HUCB 1EWMA 4PP2E 4BOSA 4W5CA 4RY2A 2FE8A 4QBBA 3B21A 4QRVA 1X9YA 1KHPA 2E01A 3PHXA 3HHAA 4BOQA 5CVMA 1A6RA 1MIRA 4YV8A 2CIOA 1DEUA 3W30A 2IPPB 1U5IA 3QT4A 4X6IA 1ME3A 4AXMA 4QRXA 4Q8GA 3MHHA 1AU2A 1YALA 3IHPA 4K7CA 1QOLA 2DC6A 4ZTBA 2FRQA 2BTWA 3D6SA 1TU6A 5PADA 2ACTA 4OVZA 3MHSA 3U8EA 3V6EA 2F1GA 4BQVA 1CSBB 4BPVA 5F02A 2UZJA 2DCCA 2DCDA 2WBFX 2Y5BA 5CHTA 4R3DA 1ME4A 3WXEA 1NB5A 2O6XA 4X6HA 1KFXL 1CS8A 3O0UA 3O1GA 2F7DA 2FTDA 3DF0A 2E00A 2PREA 3S3RA 3USVA 3I3TA 4REZA 3KW9A 3BB7A 1O0EA 5A24A 1Y08A 1EWLA 1POPA 3KX1A 1FH0A 4W4UA 2R6NA 1GCBA 2R9FA 3PRPA 2G6DA 1AYWA 2XU4A 4G54A 2AU1A 5J94A 1F2CA 3OVZA 2AVWA 4RNAA 2FYEA 1CB5A 2NQAA 4RKXA 3PHUA 1PIPA 1YVBA 2AS8A 2DZYA 2VHSA 4CZWA 2FRAA 2NQIA 4Q8HA 3ZNHA 1ATKA 3PW3A 3H7DA 1AYVA 2E03A 2HH5A 2R9NA 2Y6EA 2BU3A 3OF9A 3PDFA 4A5UA 4BOUA 2YJ2A 3RVVA 4ZUXU 2PNSA 2YJ9A 3MORA 2YJ8A 1F29A 3RNVA 3LFYA 3BWKA 3RVXA 3MJ5A 3BY4A 3N4CA 1CPJA 4YVAA 5CHVA 3B79A 2DCBA 2IBIA 4CDDB 1TLOA 4I07A 4XZXA 1AECA 1ZIVA 1PBHA 3MP2A 2ATOA 1BP4A 4XR7A 4D8BA 4BOPA 4P6GA 1QXPA 3P5UA 4MZSA 1Q6KA 1BGOA 1SNKA 4MSXA 2DC7A 1KXRA 4YYVA 4HWYA 4YYWA 2G7YA 1NB3A 4BS6A 1QDQA 2GFOA 2HHNA 4OW0A 4PADA 4OELA 1PE6A 2XU1A 1XKGA 4MZOA 5E6JA 3K8UA 2PBHA 4PT5A 2HWKA 2C0YA 4D8IA 4RF0A 2DJGB 3H6SA 4N4ZA 3WXFA 3BOWA 4M0WA 4P6EA 2B1NA 3IFUA 5EZQA 3W31A 1DKIA 3BBAA 3IMAA 3PSEA 4AXLA 3PRMA 2Z84A 4I04A 2AGAA 2XU3A 3OF8A 2AIMA 8PCHA 3MTNA 1ITOA 5KO3A 3QJ3A 4X6JA 2R9OA 2JQFR 1CV8A 3M99A 3BPFA 1AIMA 3PHWA 1KFUL 2AUXA 2DJFB 3CH3X 3TRKA 3BC3A 2HD5A 1DF0A 3IV2A 3OVXA 1QMYA 1CJLA 1MEMA 1EWPA 4RF1A 3H8CA 4WURA 3QSDA 3WXGA 2G8EA 3HD3A 2YJCA 3NHEA 3H8BA 3F75A 1SP4B 3GCBA 2NQGA 4PI3A 1MEGA 2DOSA 1TL9A 1YZBA 1BY8A 3V6CA 4HXDB 3BCNA 2DC8A 1YK8A 2FUDA 2J7QA 2P7UA 3I06A 1PXVA 3E9SA 1F2AA 3CBKA 1M6DA 2XU5A 3P5VA 3OISA 4CDEB 1PVJA 4I05A 1F2BA 5JA7A 4DMYA 4N8WA 3TNXA 2JQGR 2E02A 4XUIA 3C0RA 1U9WA 4IP3A 3KSEA 1PPOA 1GMYA 3CH2X 1S4VA 3PBHA 1NL6A 3CBJA 1EWOA 3IEJA 3HHIA 3IUTA 1NPZA 2B1MA 1MHWA 4FIPA 4CDFB 2R9MA 2BDLA 2HXZA 2P0RA 4OEMA 4YYQA 3ZUAA 1AU3A 5FPWA 3PNRA 5EF4A 1K3BB 3KWBX 2BDZA 4BOZA 2G8JA 5CVNB 5EZSA 4KLBA 3S3QA 4MM3B 1PADA 4P16A 1PCIA 3F5VA 3HWNA 2FT2A 3KWZA 2YJBA 4WA6A 1MS6A 1CVZA 2NQDB 3O65A 4DMXA 3ERVA 2P86A 1GECE 4CDCB 1AU0A 5JH3A 1ZCMA 2JRIA 1MDWA 4W5BA 2H7JA 5JZEA 4YYUA 1PPNA 3KKUA 1GLOA 2OULA 5K16A 1EF7A 3K9MA 2DCAA 3BPMA 3OQCA 1BQIA 1U9QX 2VHFA 1Y4HA 2FQ9A 3TMPA 3KFQA 1PPPA 1IWDA 4QH6A 1NQCA 2AUZA 1AU4A 2BTWB 4QRGA 4IUMA 4D8EA 4OVZB 3H89A 3P5XA 1ICFA 4N79A 2J7QC 9PAPA 2DC9A 3MTVA 3RVWA 2JTCA 2OP3A 1UKFA 3P5WA 1NLJA 2PADA 6PADA 4BSQA 3N3KA 1CQDA 3AI8A 1STFE 2FO5A 1YK7A 2GHUA 4BS5A
chains in the Genus database with same CATH topology
1CTEA 1AYUA 5CVOB 1U9VA 1VSNA 2CB5A 1U9XA 1THEA 2AYOA 3LXSA 2DZZA 3C9EA 4FK5A 3N3GA 1PPDA 4FJCA 5EGWA 1YT7A 2R9CA 1VJVA 3E1ZB 3IOQA 4PP1A 2BSZA 1W6FA 4YYRA 2OZ2A 7PCKA 2AYNA 3K24A 1JQPA 4YYSA 4C5PA 2ARYA 1KHQA 1HUCB 1EWMA 4PP2E 4W5CA 4RY2A 4QBBA 4QRVA 1X9YA 1KHPA 2E01A 3HHAA 5CVMA 1A6RA 1MIRA 4YV8A 2CIOA 1DEUA 4B55A 2IPPB 1U5IA 3QT4A 4X6IA 1ME3A 4AXMA 4QRXA 4Q8GA 3MHHA 1AU2A 1YALA 3IHPA 4K7CA 1QOLA 2DC6A 2FRQA 3D6SA 1TU6A 3D9WA 5PADA 2ACTA 3MHSA 3U8EA 3V6EA 2F1GA 4BQVA 1CSBB 4BPVA 5F02A 2DCCA 2DCDA 2WBFX 2Y5BA 5CHTA 3WXEA 1ME4A 1NB5A 2O6XA 4X6HA 1KFXL 1CS8A 3O0UA 3O1GA 2F7DA 2FTDA 3DF0A 2E00A 2PREA 3S3RA 3USVA 3I3TA 3KW9A 1O0EA 5A24A 1Y08A 1EWLA 1POPA 3KX1A 1FH0A 4W4UA 2R6NA 1GCBA 2R9FA 2G6DA 1W5RA 1AYWA 2XU4A 4G54A 2AU1A 5J94A 1F2CA 3OVZA 2AVWA 2FYEA 1CB5A 2NQAA 1PIPA 1YVBA 2AS8A 2DZYA 2VHSA 4CZWA 2FRAA 2VFBA 2NQIA 4Q8HA 1ATKA 3PW3A 3H7DA 1AYVA 3LTWA 2E03A 2HH5A 2R9NA 2Y6EA 3OF9A 3PDFA 2YJ2A 3RVVA 4ZUXU 2PNSA 2YJ9A 3MORA 2YJ8A 1F29A 3LFYA 3BWKA 3RVXA 3N4CA 1CPJA 4YVAA 5CHVA 3B79A 2DCBA 2IBIA 4CDDB 1TLOA 4I07A 4NV7A 1AECA 1ZIVA 1PBHA 2ATOA 1E2TA 1BP4A 4XR7A 4P6GA 1QXPA 3P5UA 4MZSA 1Q6KA 1W4TA 1BGOA 1GX3A 1SNKA 4MSXA 2DC7A 1KXRA 4YYVA 4HWYA 4YYWA 2G7YA 1NB3A 4BS6A 1QDQA 2GFOA 2HHNA 4PADA 4OELA 1PE6A 2XU1A 1XKGA 4MZOA 3K8UA 2PBHA 2C0YA 2DJGB 3H6SA 4N4ZA 3WXFA 3BOWA 4P6EA 2B1NA 3IMAA 4AXLA 4I04A 2XU3A 3OF8A 2AIMA 8PCHA 3MTNA 1ITOA 3QJ3A 4X6JA 2R9OA 2JQFR 1CV8A 3M99A 3BPFA 1AIMA 1KFUL 2AUXA 2DJFB 3CH3X 3BC3A 2HD5A 1DF0A 3IV2A 3OVXA 1QMYA 1CJLA 1MEMA 1EWPA 3H8CA 3QSDA 3WXGA 2G8EA 3HD3A 2YJCA 3NHEA 3H8BA 3F75A 1SP4B 3GCBA 2NQGA 4PI3A 1MEGA 1TL9A 1BY8A 3V6CA 2VFCA 3BCNA 2DC8A 1YK8A 2FUDA 2P7UA 3I06A 4BGFA 1PXVA 1F2AA 3CBKA 1M6DA 2XU5A 4NV8A 3P5VA 3OISA 4CDEB 4I05A 1F2BA 5JA7A 4DMYA 4N8WA 3TNXA 2JQGR 2E02A 4XUIA 1U9WA 3KSEA 1PPOA 1GMYA 3CH2X 1S4VA 3PBHA 1NL6A 3CBJA 1EWOA 3IEJA 3HHIA 3IUTA 1NPZA 2B1MA 1MHWA 4FIPA 4CDFB 2R9MA 2BDLA 2HXZA 2P0RA 4OEMA 4YYQA 3ZUAA 1AU3A 5FPWA 3PNRA 5EF4A 1K3BB 3KWBX 2BDZA 2G8JA 5CVNB 3S3QA 4KLBA 1PADA 1PCIA 3F5VA 3HWNA 2FT2A 3KWZA 2YJBA 4WA6A 1MS6A 1CVZA 2NQDB 4DMXA 3ERVA 2P86A 1GECE 4CDCB 1AU0A 5JH3A 1ZCMA 1MDWA 4W5BA 2H7JA 4YYUA 1PPNA 3KKUA 1GLOA 2OULA 5K16A 1EF7A 3K9MA 2DCAA 3BPMA 1BQIA 4GUZA 1U9QX 2VHFA 1Y4HA 2FQ9A 3KFQA 1PPPA 1IWDA 4QH6A 1NQCA 2AUZA 1AU4A 4QRGA 3H89A 3P5XA 1ICFA 4N79A 9PAPA 2DC9A 3RVWA 2OP3A 3P5WA 1NLJA 2PADA 6PADA 4BSQA 3N3KA 1CQDA 3AI8A 1STFE 2FO5A 1YK7A 2GHUA 4BS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CTE A;  1AYU A;  5CVO B;  1U9V A;  1VSN A;  2CB5 A;  1U9X A;  1THE A;  2AYO A;  3LXS A;  2DZZ A;  3C9E A;  4FK5 A;  3N3G A;  1PPD A;  4FJC A;  5EGW A;  1YT7 A;  2R9C A;  1VJV A;  3E1Z B;  3IOQ A;  4PP1 A;  4YYR A;  2OZ2 A;  7PCK A;  2AYN A;  3K24 A;  1JQP A;  4YYS A;  2ARY A;  1KHQ A;  1HUC B;  1EWM A;  4PP2 E;  4W5C A;  4RY2 A;  4QBB A;  4QRV A;  1X9Y A;  1KHP A;  2E01 A;  3HHA A;  5CVM A;  1A6R A;  1MIR A;  4YV8 A;  2CIO A;  1DEU A;  2IPP B;  1U5I A;  3QT4 A;  4X6I A;  1ME3 A;  4AXM A;  4QRX A;  4Q8G A;  3MHH A;  1AU2 A;  1YAL A;  3IHP A;  4K7C A;  1QOL A;  2DC6 A;  2FRQ A;  3D6S A;  1TU6 A;  5PAD A;  2ACT A;  3MHS A;  3U8E A;  3V6E A;  2F1G A;  4BQV A;  1CSB B;  4BPV A;  5F02 A;  2DCC A;  2DCD A;  2WBF X;  2Y5B A;  5CHT A;  3WXE A;  1ME4 A;  1NB5 A;  2O6X A;  4X6H A;  1KFX L;  1CS8 A;  3O0U A;  3O1G A;  2F7D A;  2FTD A;  3DF0 A;  2E00 A;  2PRE A;  3S3R A;  3USV A;  3I3T A;  3KW9 A;  1O0E A;  5A24 A;  1Y08 A;  1EWL A;  1POP A;  3KX1 A;  1FH0 A;  4W4U A;  2R6N A;  1GCB A;  2R9F A;  2G6D A;  1AYW A;  2XU4 A;  4G54 A;  2AU1 A;  5J94 A;  1F2C A;  3OVZ A;  2AVW A;  2FYE A;  1CB5 A;  2NQA A;  1PIP A;  1YVB A;  2AS8 A;  2DZY A;  2VHS A;  4CZW A;  2FRA A;  2NQI A;  4Q8H A;  1ATK A;  3PW3 A;  3H7D A;  1AYV A;  2E03 A;  2HH5 A;  2R9N A;  2Y6E A;  3OF9 A;  3PDF A;  2YJ2 A;  3RVV A;  4ZUX U;  2PNS A;  2YJ9 A;  3MOR A;  2YJ8 A;  1F29 A;  3LFY A;  3BWK A;  3RVX A;  3N4C A;  1CPJ A;  4YVA A;  5CHV A;  3B79 A;  2DCB A;  2IBI A;  4CDD B;  1TLO A;  4I07 A;  1AEC A;  1ZIV A;  1PBH A;  2ATO A;  1BP4 A;  4XR7 A;  4P6G A;  1QXP A;  3P5U A;  4MZS A;  1Q6K A;  1BGO A;  1SNK A;  4MSX A;  2DC7 A;  1KXR A;  4YYV A;  4HWY A;  4YYW A;  2G7Y A;  1NB3 A;  4BS6 A;  1QDQ A;  2GFO A;  2HHN A;  4PAD A;  4OEL A;  1PE6 A;  2XU1 A;  1XKG A;  4MZO A;  3K8U A;  2PBH A;  2C0Y A;  2DJG B;  3H6S A;  4N4Z A;  3WXF A;  3BOW A;  4P6E A;  2B1N A;  3IMA A;  4AXL A;  4I04 A;  2XU3 A;  3OF8 A;  2AIM A;  8PCH A;  3MTN A;  1ITO A;  3QJ3 A;  4X6J A;  2R9O A;  2JQF R;  1CV8 A;  3M99 A;  3BPF A;  1AIM A;  1KFU L;  2AUX A;  2DJF B;  3CH3 X;  3BC3 A;  2HD5 A;  1DF0 A;  3IV2 A;  3OVX A;  1QMY A;  1CJL A;  1MEM A;  1EWP A;  3H8C A;  3QSD A;  3WXG A;  2G8E A;  3HD3 A;  2YJC A;  3NHE A;  3H8B A;  3F75 A;  1SP4 B;  3GCB A;  2NQG A;  4PI3 A;  1MEG A;  1TL9 A;  1BY8 A;  3V6C A;  3BCN A;  2DC8 A;  1YK8 A;  2FUD A;  2P7U A;  3I06 A;  1PXV A;  1F2A A;  3CBK A;  1M6D A;  2XU5 A;  3P5V A;  3OIS A;  4CDE B;  4I05 A;  1F2B A;  5JA7 A;  4DMY A;  4N8W A;  3TNX A;  2JQG R;  2E02 A;  4XUI A;  1U9W A;  3KSE A;  1PPO A;  1GMY A;  3CH2 X;  1S4V A;  3PBH A;  1NL6 A;  3CBJ A;  1EWO A;  3IEJ A;  3HHI A;  3IUT A;  1NPZ A;  2B1M A;  1MHW A;  4FIP A;  4CDF B;  2R9M A;  2BDL A;  2HXZ A;  2P0R A;  4OEM A;  4YYQ A;  3ZUA A;  1AU3 A;  5FPW A;  3PNR A;  5EF4 A;  1K3B B;  3KWB X;  2BDZ A;  2G8J A;  5CVN B;  3S3Q A;  4KLB A;  1PAD A;  1PCI A;  3F5V A;  3HWN A;  2FT2 A;  3KWZ A;  2YJB A;  4WA6 A;  1MS6 A;  1CVZ A;  2NQD B;  4DMX A;  3ERV A;  2P86 A;  1GEC E;  4CDC B;  1AU0 A;  5JH3 A;  1ZCM A;  1MDW A;  4W5B A;  2H7J A;  4YYU A;  1PPN A;  3KKU A;  1GLO A;  2OUL A;  5K16 A;  1EF7 A;  3K9M A;  2DCA A;  3BPM A;  1BQI A;  1U9Q X;  2VHF A;  1Y4H A;  2FQ9 A;  3KFQ A;  1PPP A;  1IWD A;  4QH6 A;  1NQC A;  2AUZ A;  1AU4 A;  4QRG A;  3H89 A;  3P5X A;  1ICF A;  4N79 A;  9PAP A;  2DC9 A;  3RVW A;  2OP3 A;  3P5W A;  1NLJ A;  2PAD A;  6PAD A;  4BSQ A;  3N3K A;  1CQD A;  3AI8 A;  1STF E;  2FO5 A;  1YK7 A;  2GHU A;  4BS5 A; 
#chains in the Genus database with same CATH topology
 1CTE A;  1AYU A;  5CVO B;  1U9V A;  1VSN A;  2CB5 A;  1U9X A;  1THE A;  2AYO A;  4GUA A;  3LXS A;  2DZZ A;  3C9E A;  4FK5 A;  3N3G A;  4MI7 A;  1PPD A;  4FJC A;  5EGW A;  1YT7 A;  2R9C A;  3PT2 A;  1VJV A;  3E1Z B;  3IOQ A;  4PP1 A;  4YYR A;  2OZ2 A;  7PCK A;  2AYN A;  3K24 A;  1JQP A;  4YYS A;  2ARY A;  1KHQ A;  1HUC B;  1EWM A;  4PP2 E;  4BOS A;  4W5C A;  4RY2 A;  2FE8 A;  4QBB A;  3B21 A;  4QRV A;  1X9Y A;  1KHP A;  2E01 A;  3PHX A;  3HHA A;  4BOQ A;  5CVM A;  1A6R A;  1MIR A;  4YV8 A;  2CIO A;  1DEU A;  3W30 A;  2IPP B;  1U5I A;  3QT4 A;  4X6I A;  1ME3 A;  4AXM A;  4QRX A;  4Q8G A;  3MHH A;  1AU2 A;  1YAL A;  3IHP A;  4K7C A;  1QOL A;  2DC6 A;  4ZTB A;  2FRQ A;  2BTW A;  3D6S A;  1TU6 A;  5PAD A;  2ACT A;  4OVZ A;  3MHS A;  3U8E A;  3V6E A;  2F1G A;  4BQV A;  1CSB B;  4BPV A;  5F02 A;  2UZJ A;  2DCC A;  2DCD A;  2WBF X;  2Y5B A;  5CHT A;  4R3D A;  1ME4 A;  3WXE A;  1NB5 A;  2O6X A;  4X6H A;  1KFX L;  1CS8 A;  3O0U A;  3O1G A;  2F7D A;  2FTD A;  3DF0 A;  2E00 A;  2PRE A;  3S3R A;  3USV A;  3I3T A;  4REZ A;  3KW9 A;  3BB7 A;  1O0E A;  5A24 A;  1Y08 A;  1EWL A;  1POP A;  3KX1 A;  1FH0 A;  4W4U A;  2R6N A;  1GCB A;  2R9F A;  3PRP A;  2G6D A;  1AYW A;  2XU4 A;  4G54 A;  2AU1 A;  5J94 A;  1F2C A;  3OVZ A;  2AVW A;  4RNA A;  2FYE A;  1CB5 A;  2NQA A;  4RKX A;  3PHU A;  1PIP A;  1YVB A;  2AS8 A;  2DZY A;  2VHS A;  4CZW A;  2FRA A;  2NQI A;  4Q8H A;  3ZNH A;  1ATK A;  3PW3 A;  3H7D A;  1AYV A;  2E03 A;  2HH5 A;  2R9N A;  2Y6E A;  2BU3 A;  3OF9 A;  3PDF A;  4A5U A;  4BOU A;  2YJ2 A;  3RVV A;  4ZUX U;  2PNS A;  2YJ9 A;  3MOR A;  2YJ8 A;  1F29 A;  3RNV A;  3LFY A;  3BWK A;  3RVX A;  3MJ5 A;  3BY4 A;  3N4C A;  1CPJ A;  4YVA A;  5CHV A;  3B79 A;  2DCB A;  2IBI A;  4CDD B;  1TLO A;  4I07 A;  4XZX A;  1AEC A;  1ZIV A;  1PBH A;  3MP2 A;  2ATO A;  1BP4 A;  4XR7 A;  4D8B A;  4BOP A;  4P6G A;  1QXP A;  3P5U A;  4MZS A;  1Q6K A;  1BGO A;  1SNK A;  4MSX A;  2DC7 A;  1KXR A;  4YYV A;  4HWY A;  4YYW A;  2G7Y A;  1NB3 A;  4BS6 A;  1QDQ A;  2GFO A;  2HHN A;  4OW0 A;  4PAD A;  4OEL A;  1PE6 A;  2XU1 A;  1XKG A;  4MZO A;  5E6J A;  3K8U A;  2PBH A;  4PT5 A;  2HWK A;  2C0Y A;  4D8I A;  4RF0 A;  2DJG B;  3H6S A;  4N4Z A;  3WXF A;  3BOW A;  4M0W A;  4P6E A;  2B1N A;  3IFU A;  5EZQ A;  3W31 A;  1DKI A;  3BBA A;  3IMA A;  3PSE A;  4AXL A;  3PRM A;  2Z84 A;  4I04 A;  2AGA A;  2XU3 A;  3OF8 A;  2AIM A;  8PCH A;  3MTN A;  1ITO A;  5KO3 A;  3QJ3 A;  4X6J A;  2R9O A;  2JQF R;  1CV8 A;  3M99 A;  3BPF A;  1AIM A;  3PHW A;  1KFU L;  2AUX A;  2DJF B;  3CH3 X;  3TRK A;  3BC3 A;  2HD5 A;  1DF0 A;  3IV2 A;  3OVX A;  1QMY A;  1CJL A;  1MEM A;  1EWP A;  4RF1 A;  3H8C A;  4WUR A;  3QSD A;  3WXG A;  2G8E A;  3HD3 A;  2YJC A;  3NHE A;  3H8B A;  3F75 A;  1SP4 B;  3GCB A;  2NQG A;  4PI3 A;  1MEG A;  2DOS A;  1TL9 A;  1YZB A;  1BY8 A;  3V6C A;  4HXD B;  3BCN A;  2DC8 A;  1YK8 A;  2FUD A;  2J7Q A;  2P7U A;  3I06 A;  1PXV A;  3E9S A;  1F2A A;  3CBK A;  1M6D A;  2XU5 A;  3P5V A;  3OIS A;  4CDE B;  1PVJ A;  4I05 A;  1F2B A;  5JA7 A;  4DMY A;  4N8W A;  3TNX A;  2JQG R;  2E02 A;  4XUI A;  3C0R A;  1U9W A;  4IP3 A;  3KSE A;  1PPO A;  1GMY A;  3CH2 X;  1S4V A;  3PBH A;  1NL6 A;  3CBJ A;  1EWO A;  3IEJ A;  3HHI A;  3IUT A;  1NPZ A;  2B1M A;  1MHW A;  4FIP A;  4CDF B;  2R9M A;  2BDL A;  2HXZ A;  2P0R A;  4OEM A;  4YYQ A;  3ZUA A;  1AU3 A;  5FPW A;  3PNR A;  5EF4 A;  1K3B B;  3KWB X;  2BDZ A;  4BOZ A;  2G8J A;  5CVN B;  5EZS A;  4KLB A;  3S3Q A;  4MM3 B;  1PAD A;  4P16 A;  1PCI A;  3F5V A;  3HWN A;  2FT2 A;  3KWZ A;  2YJB A;  4WA6 A;  1MS6 A;  1CVZ A;  2NQD B;  3O65 A;  4DMX A;  3ERV A;  2P86 A;  1GEC E;  4CDC B;  1AU0 A;  5JH3 A;  1ZCM A;  2JRI A;  1MDW A;  4W5B A;  2H7J A;  5JZE A;  4YYU A;  1PPN A;  3KKU A;  1GLO A;  2OUL A;  5K16 A;  1EF7 A;  3K9M A;  2DCA A;  3BPM A;  3OQC A;  1BQI A;  1U9Q X;  2VHF A;  1Y4H A;  2FQ9 A;  3TMP A;  3KFQ A;  1PPP A;  1IWD A;  4QH6 A;  1NQC A;  2AUZ A;  1AU4 A;  2BTW B;  4QRG A;  4IUM A;  4D8E A;  4OVZ B;  3H89 A;  3P5X A;  1ICF A;  4N79 A;  2J7Q C;  9PAP A;  2DC9 A;  3MTV A;  3RVW A;  2JTC A;  2OP3 A;  1UKF A;  3P5W A;  1NLJ A;  2PAD A;  6PAD A;  4BSQ A;  3N3K A;  1CQD A;  3AI8 A;  1STF E;  2FO5 A;  1YK7 A;  2GHU A;  4BS5 A; 
#chains in the Genus database with same CATH homology
 1CTE A;  1AYU A;  5CVO B;  1U9V A;  1VSN A;  2CB5 A;  1U9X A;  1THE A;  2AYO A;  3LXS A;  2DZZ A;  3C9E A;  4FK5 A;  3N3G A;  1PPD A;  4FJC A;  5EGW A;  1YT7 A;  2R9C A;  1VJV A;  3E1Z B;  3IOQ A;  4PP1 A;  2BSZ A;  1W6F A;  4YYR A;  2OZ2 A;  7PCK A;  2AYN A;  3K24 A;  1JQP A;  4YYS A;  4C5P A;  2ARY A;  1KHQ A;  1HUC B;  1EWM A;  4PP2 E;  4W5C A;  4RY2 A;  4QBB A;  4QRV A;  1X9Y A;  1KHP A;  2E01 A;  3HHA A;  5CVM A;  1A6R A;  1MIR A;  4YV8 A;  2CIO A;  1DEU A;  4B55 A;  2IPP B;  1U5I A;  3QT4 A;  4X6I A;  1ME3 A;  4AXM A;  4QRX A;  4Q8G A;  3MHH A;  1AU2 A;  1YAL A;  3IHP A;  4K7C A;  1QOL A;  2DC6 A;  2FRQ A;  3D6S A;  1TU6 A;  3D9W A;  5PAD A;  2ACT A;  3MHS A;  3U8E A;  3V6E A;  2F1G A;  4BQV A;  1CSB B;  4BPV A;  5F02 A;  2DCC A;  2DCD A;  2WBF X;  2Y5B A;  5CHT A;  3WXE A;  1ME4 A;  1NB5 A;  2O6X A;  4X6H A;  1KFX L;  1CS8 A;  3O0U A;  3O1G A;  2F7D A;  2FTD A;  3DF0 A;  2E00 A;  2PRE A;  3S3R A;  3USV A;  3I3T A;  3KW9 A;  1O0E A;  5A24 A;  1Y08 A;  1EWL A;  1POP A;  3KX1 A;  1FH0 A;  4W4U A;  2R6N A;  1GCB A;  2R9F A;  2G6D A;  1W5R A;  1AYW A;  2XU4 A;  4G54 A;  2AU1 A;  5J94 A;  1F2C A;  3OVZ A;  2AVW A;  2FYE A;  1CB5 A;  2NQA A;  1PIP A;  1YVB A;  2AS8 A;  2DZY A;  2VHS A;  4CZW A;  2FRA A;  2VFB A;  2NQI A;  4Q8H A;  1ATK A;  3PW3 A;  3H7D A;  1AYV A;  3LTW A;  2E03 A;  2HH5 A;  2R9N A;  2Y6E A;  3OF9 A;  3PDF A;  2YJ2 A;  3RVV A;  4ZUX U;  2PNS A;  2YJ9 A;  3MOR A;  2YJ8 A;  1F29 A;  3LFY A;  3BWK A;  3RVX A;  3N4C A;  1CPJ A;  4YVA A;  5CHV A;  3B79 A;  2DCB A;  2IBI A;  4CDD B;  1TLO A;  4I07 A;  4NV7 A;  1AEC A;  1ZIV A;  1PBH A;  2ATO A;  1E2T A;  1BP4 A;  4XR7 A;  4P6G A;  1QXP A;  3P5U A;  4MZS A;  1Q6K A;  1W4T A;  1BGO A;  1GX3 A;  1SNK A;  4MSX A;  2DC7 A;  1KXR A;  4YYV A;  4HWY A;  4YYW A;  2G7Y A;  1NB3 A;  4BS6 A;  1QDQ A;  2GFO A;  2HHN A;  4PAD A;  4OEL A;  1PE6 A;  2XU1 A;  1XKG A;  4MZO A;  3K8U A;  2PBH A;  2C0Y A;  2DJG B;  3H6S A;  4N4Z A;  3WXF A;  3BOW A;  4P6E A;  2B1N A;  3IMA A;  4AXL A;  4I04 A;  2XU3 A;  3OF8 A;  2AIM A;  8PCH A;  3MTN A;  1ITO A;  3QJ3 A;  4X6J A;  2R9O A;  2JQF R;  1CV8 A;  3M99 A;  3BPF A;  1AIM A;  1KFU L;  2AUX A;  2DJF B;  3CH3 X;  3BC3 A;  2HD5 A;  1DF0 A;  3IV2 A;  3OVX A;  1QMY A;  1CJL A;  1MEM A;  1EWP A;  3H8C A;  3QSD A;  3WXG A;  2G8E A;  3HD3 A;  2YJC A;  3NHE A;  3H8B A;  3F75 A;  1SP4 B;  3GCB A;  2NQG A;  4PI3 A;  1MEG A;  1TL9 A;  1BY8 A;  3V6C A;  2VFC A;  3BCN A;  2DC8 A;  1YK8 A;  2FUD A;  2P7U A;  3I06 A;  4BGF A;  1PXV A;  1F2A A;  3CBK A;  1M6D A;  2XU5 A;  4NV8 A;  3P5V A;  3OIS A;  4CDE B;  4I05 A;  1F2B A;  5JA7 A;  4DMY A;  4N8W A;  3TNX A;  2JQG R;  2E02 A;  4XUI A;  1U9W A;  3KSE A;  1PPO A;  1GMY A;  3CH2 X;  1S4V A;  3PBH A;  1NL6 A;  3CBJ A;  1EWO A;  3IEJ A;  3HHI A;  3IUT A;  1NPZ A;  2B1M A;  1MHW A;  4FIP A;  4CDF B;  2R9M A;  2BDL A;  2HXZ A;  2P0R A;  4OEM A;  4YYQ A;  3ZUA A;  1AU3 A;  5FPW A;  3PNR A;  5EF4 A;  1K3B B;  3KWB X;  2BDZ A;  2G8J A;  5CVN B;  3S3Q A;  4KLB A;  1PAD A;  1PCI A;  3F5V A;  3HWN A;  2FT2 A;  3KWZ A;  2YJB A;  4WA6 A;  1MS6 A;  1CVZ A;  2NQD B;  4DMX A;  3ERV A;  2P86 A;  1GEC E;  4CDC B;  1AU0 A;  5JH3 A;  1ZCM A;  1MDW A;  4W5B A;  2H7J A;  4YYU A;  1PPN A;  3KKU A;  1GLO A;  2OUL A;  5K16 A;  1EF7 A;  3K9M A;  2DCA A;  3BPM A;  1BQI A;  4GUZ A;  1U9Q X;  2VHF A;  1Y4H A;  2FQ9 A;  3KFQ A;  1PPP A;  1IWD A;  4QH6 A;  1NQC A;  2AUZ A;  1AU4 A;  4QRG A;  3H89 A;  3P5X A;  1ICF A;  4N79 A;  9PAP A;  2DC9 A;  3RVW A;  2OP3 A;  3P5W A;  1NLJ A;  2PAD A;  6PAD A;  4BSQ A;  3N3K A;  1CQD A;  3AI8 A;  1STF E;  2FO5 A;  1YK7 A;  2GHU A;  4BS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...