4P6EA

Crystal structure of human cathepsin s bound to a non-covalent inhibitor
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
219
structure length
219
Chain Sequence
b'ILPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin S
publication title Discovery of Cathepsin S Inhibitor LY3000328 for the Treatment of Abdominal Aortic Aneurysm.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 69
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2014-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4p6eA00
3RVXA 1TU6A 2DCDA 3RVVA 4WA6A 3MHSA 3QT4A 1ICFA 3D6SA 3I06A 3O0UA 2DCAA 3BPFA 9PAPA 1MEMA 3MORA 1S4VA 3P5WA 3PDFA 3RVWA 5CVMA 8PCHA 2VHSA 4YYSA 4BS6A 2R9MA 3WXFA 1NLJA 3B79A 3KX1A 3PBHA 3KW9A 2E01A 3H7DA 1BQIA 4RY2A 1Q6KA 1F2BA 2WBFX 4X6HA 4DMYA 4W5CA 4FIPA 4OEMA 1U9QX 3PW3A 5J94A 3O1GA 3CH3X 1AIMA 1Y4HA 2PBHA 2F7DA 1PCIA 2P7UA 4Q8HA 4I04A 2R9CA 3ERVA 2DJFB 4W4UA 4QRXA 1YALA 3WXEA 2AU1A 3BCNA 1YK8A 2FUDA 1HUCB 1NL6A 2R9OA 3BPMA 3LFYA 4BS5A 4Q8GA 1MS6A 2P0RA 1AYUA 1EWPA 3GCBA 1THEA 4PP2E 5FPWA 2AS8A 2CIOA 1GCBA 2AVWA 2VHFA 2E00A 2AUZA 2YJ2A 3LXSA 1MEGA 4BQVA 2NQAA 1TL9A 1PBHA 1DF0A 3N3GA 3BC3A 4QRGA 1AU0A 2PADA 2FO5A 3K24A 4XUIA 3E1ZB 3HHAA 3V6CA 1PPPA 1QMYA 2G8JA 2R9NA 2GFOA 3BWKA 2DZYA 1GLOA 3OISA 1BY8A 3H8BA 4KLBA 2ARYA 2ACTA 1CSBB 3KWBX 3ZUAA 4CDDB 1EWOA 1CJLA 3DF0A 2YJ9A 4P6GA 1GMYA 2E03A 2HD5A 2PNSA 3H8CA 4PADA 2E02A 3P5VA 4K7CA 4MZOA 3CH2X 4YYWA 1M6DA 2DC7A 3IV2A 5A24A 4YVAA 3HWNA 5F02A 1AYWA 2Y5BA 5JA7A 2R6NA 2FRQA 5CHTA 4YV8A 2DJGB 1FH0A 3HHIA 2JQGR 1CPJA 5JH3A 1ZIVA 1PIPA 2G6DA 1STFE 2O6XA 1EWMA 3HD3A 3OF8A 3USVA 1KFXL 3IOQA 1AU3A 4N79A 1PPOA 2DC6A 2FTDA 2XU4A 3N4CA 4N8WA 4YYUA 4AXMA 5CHVA 4X6IA 1X9YA 2F1GA 3IUTA 3U8EA 1ME4A 4BPVA 2HH5A 4P6EA 2B1NA 2H7JA 4CDEB 3M99A 3AI8A 4QRVA 2G7YA 3KKUA 2NQDB 4I05A 3C9EA 2XU5A 1U9WA 5EF4A 1BGOA 1CS8A 4BSQA 2R9FA 2DC9A 3BOWA 3V6EA 2G8EA 1JQPA 1KHPA 1PPNA 4QH6A 2AIMA 4AXLA 1VSNA 2DC8A 1VJVA 1PADA 1CQDA 2FT2A 3S3RA 2BDZA 2P86A 3K8UA 2OP3A 7PCKA 2XU1A 1AU2A 3KSEA 1PXVA 1YVBA 1GECE 2JQFR 2XU3A 1CB5A 4FK5A 4W5BA 1TLOA 4PP1A 4XR7A 3KWZA 2DZZA 2GHUA 4X6JA 1EWLA 1PE6A 1ITOA 2OULA 1NPZA 4PI3A 1A6RA 2YJ8A 3CBKA 4CZWA 5CVOB 4CDFB 1MHWA 2BDLA 3TNXA 4MZSA 2YJCA 1EF7A 1ATKA 4YYVA 2C0YA 1YT7A 3OVZA 4G54A 2CB5A 4DMXA 3PNRA 3H89A 1AU4A 1NB5A 1AYVA 2Y6EA 2FYEA 2HHNA 3NHEA 3I3TA 2DCBA 3H6SA 4YYQA 3QSDA 1POPA 2FQ9A 1IWDA 4CDCB 1MDWA 1QXPA 5PADA 1U9XA 1ME3A 2IBIA 3IEJA 4I07A 1F2AA 1DEUA 3S3QA 4OELA 2NQGA 1CTEA 1XKGA 3IHPA 4YYRA 1NQCA 3MTNA 3OVXA 1Y08A 3KFQA 6PADA 1PPDA 2B1MA 3K9MA 1K3BB 4HWYA 5EGWA 2DCCA 2AYOA 2PREA 1YK7A 1AECA 1MIRA 1F2CA 3OF9A 1BP4A 1U5IA 1O0EA 2OZ2A 3N3KA 1KFUL 3CBJA 3MHHA 2AUXA 4ZUXU 1KHQA 1ZCMA 1QDQA 3QJ3A 3WXGA 1KXRA 1F29A 2AYNA 1QOLA 2FRAA 2ATOA 4QBBA 2HXZA 1CVZA 4N4ZA 3IMAA 1U9VA 1SNKA 2IPPB 3P5XA 5CVNB 3P5UA 3F75A 4FJCA 1CV8A 1SP4B 2NQIA 5K16A 4MSXA 2YJBA 1NB3A 3F5VA
chains in the Genus database with same CATH superfamily
3RVXA 1TU6A 2DCDA 3RVVA 4WA6A 3MHSA 3QT4A 1ICFA 3B21A 3D6SA 3I06A 3O0UA 4MM3B 2DCAA 3BPFA 9PAPA 1MEMA 3BB7A 3MORA 1S4VA 3P5WA 3PDFA 3RVWA 5CVMA 8PCHA 2VHSA 4YYSA 5KO3A 4BS6A 2R9MA 3WXFA 3PHXA 1NLJA 3B79A 3KX1A 4BOPA 3PBHA 4OVZB 3KW9A 2E01A 3H7DA 4OVZA 4RNAA 1BQIA 4RY2A 3O65A 1Q6KA 1F2BA 2WBFX 4X6HA 4DMYA 4W5CA 4FIPA 4OEMA 1U9QX 4RF1A 3PW3A 4PT5A 5J94A 3O1GA 2BTWB 3CH3X 1AIMA 1Y4HA 2PBHA 4P16A 2BTWA 2F7DA 5E6JA 1PCIA 2J7QC 2P7UA 4Q8HA 3PRPA 4I04A 2R9CA 3ERVA 4ZTBA 2DJFB 4W4UA 4QRXA 1YALA 3WXEA 2AU1A 3BCNA 1YK8A 2FUDA 1HUCB 1NL6A 2R9OA 3BPMA 3LFYA 4BS5A 4Q8GA 1MS6A 2P0RA 1AYUA 4BOSA 1EWPA 3GCBA 1THEA 5EZQA 4PP2E 5FPWA 2AS8A 2CIOA 4XZXA 1GCBA 2AVWA 2JRIA 2VHFA 2E00A 2AUZA 2YJ2A 3LXSA 1MEGA 4BQVA 3MJ5A 4RKXA 2NQAA 1TL9A 1PBHA 1DF0A 3N3GA 3BC3A 4QRGA 1AU0A 2PADA 2FO5A 3K24A 4XUIA 3E1ZB 3HHAA 3V6CA 1PPPA 1QMYA 2G8JA 2HWKA 2R9NA 2GFOA 3BWKA 2DZYA 1GLOA 3OISA 1BY8A 3H8BA 4BOQA 4KLBA 2ARYA 2ACTA 1CSBB 3KWBX 3ZUAA 4CDDB 4D8BA 1EWOA 1CJLA 3DF0A 2UZJA 2YJ9A 3PT2A 4P6GA 3PSEA 1GMYA 2E03A 2HD5A 2PNSA 3H8CA 4PADA 2E02A 3P5VA 4M0WA 4K7CA 4D8EA 4MZOA 3CH2X 4YYWA 1M6DA 2DC7A 3IV2A 5A24A 3PHUA 4YVAA 4OW0A 3HWNA 5F02A 2AGAA 1AYWA 2Y5BA 5JA7A 5JZEA 2R6NA 3TRKA 2FRQA 5CHTA 4YV8A 2DJGB 1FH0A 3HHIA 2JQGR 4BOUA 1CPJA 3RNVA 5JH3A 1ZIVA 4D8IA 1PIPA 2G6DA 1STFE 4WURA 2O6XA 2J7QA 1EWMA 3HD3A 3OF8A 3USVA 1KFXL 3IOQA 1AU3A 4N79A 1PPOA 2DC6A 2FTDA 2XU4A 3N4CA 4N8WA 2BU3A 4YYUA 4AXMA 5CHVA 4BOZA 4X6IA 3PHWA 1X9YA 2F1GA 3IUTA 3U8EA 1ME4A 4BPVA 2HH5A 4P6EA 2B1NA 2H7JA 4CDEB 3M99A 3AI8A 3ZNHA 4QRVA 2G7YA 3KKUA 4IUMA 2NQDB 4I05A 3C9EA 2XU5A 1U9WA 5EF4A 1BGOA 1CS8A 4BSQA 2R9FA 3E9SA 3W31A 2DC9A 3BOWA 3V6EA 3BY4A 2G8EA 1JQPA 1KHPA 3TMPA 1PPNA 4QH6A 2AIMA 4AXLA 1VSNA 2DC8A 1VJVA 1PADA 1CQDA 2FT2A 3S3RA 2JTCA 2BDZA 2P86A 4RF0A 3K8UA 2OP3A 7PCKA 2XU1A 1AU2A 3KSEA 1PXVA 1YVBA 1GECE 2JQFR 2Z84A 2XU3A 1CB5A 4FK5A 4W5BA 4MI7A 1TLOA 4PP1A 4XR7A 1YZBA 3KWZA 5EZSA 2DZZA 2GHUA 4X6JA 1EWLA 1PE6A 1ITOA 2OULA 1NPZA 4PI3A 1A6RA 2YJ8A 3CBKA 4CZWA 5CVOB 4CDFB 1MHWA 2BDLA 3TNXA 3BBAA 4MZSA 2YJCA 3OQCA 1EF7A 1ATKA 4YYVA 4HXDB 2C0YA 1YT7A 3OVZA 4G54A 2CB5A 4DMXA 3PNRA 3H89A 1AU4A 1DKIA 1NB5A 1AYVA 4IP3A 2Y6EA 2FE8A 2FYEA 2HHNA 3NHEA 3I3TA 4R3DA 2DCBA 3H6SA 4YYQA 3QSDA 4GUAA 1UKFA 1POPA 2FQ9A 1IWDA 4CDCB 1MDWA 3W30A 1QXPA 4REZA 1U9XA 5PADA 1ME3A 2IBIA 3IEJA 4I07A 4A5UA 1F2AA 1DEUA 3S3QA 4OELA 2NQGA 1CTEA 1XKGA 3IHPA 4YYRA 1NQCA 3MTNA 3OVXA 1Y08A 3KFQA 6PADA 1PPDA 2B1MA 3K9MA 1K3BB 4HWYA 5EGWA 2DCCA 2AYOA 2PREA 1YK7A 1AECA 1MIRA 1F2CA 3OF9A 1BP4A 3IFUA 1U5IA 1O0EA 1PVJA 2OZ2A 3N3KA 1KFUL 3CBJA 3MHHA 3MTVA 2DOSA 2AUXA 4ZUXU 1KHQA 1ZCMA 1QDQA 3QJ3A 3WXGA 1KXRA 1F29A 3C0RA 2AYNA 1QOLA 2FRAA 2ATOA 2HXZA 4QBBA 1CVZA 4N4ZA 3IMAA 1U9VA 1SNKA 2IPPB 3P5XA 5CVNB 3P5UA 3F75A 4FJCA 1CV8A 1SP4B 2NQIA 5K16A 4MSXA 2YJBA 1NB3A 3MP2A 3F5VA 3PRMA
chains in the Genus database with same CATH topology
3RVXA 1TU6A 2DCDA 3RVVA 4WA6A 3MHSA 3QT4A 1ICFA 3D6SA 3I06A 3O0UA 2DCAA 3BPFA 9PAPA 1MEMA 3MORA 1S4VA 3P5WA 3PDFA 3RVWA 5CVMA 8PCHA 2VHSA 4YYSA 4BS6A 2R9MA 3WXFA 1NLJA 3B79A 3KX1A 3PBHA 3KW9A 2E01A 3H7DA 3LTWA 1BQIA 4RY2A 1Q6KA 1F2BA 2WBFX 4X6HA 4DMYA 4W5CA 4FIPA 4OEMA 3D9WA 1U9QX 3PW3A 5J94A 3O1GA 3CH3X 1AIMA 1Y4HA 1W4TA 2PBHA 2F7DA 1PCIA 2P7UA 4Q8HA 4I04A 2R9CA 3ERVA 2DJFB 4NV8A 4W4UA 4QRXA 1YALA 3WXEA 2AU1A 3BCNA 1YK8A 2FUDA 1HUCB 1NL6A 2R9OA 3BPMA 3LFYA 4BS5A 4Q8GA 1MS6A 2P0RA 1AYUA 1EWPA 3GCBA 1THEA 4PP2E 5FPWA 2AS8A 2CIOA 1GCBA 2AVWA 2VHFA 2E00A 2AUZA 2YJ2A 1E2TA 3LXSA 1MEGA 4BQVA 2NQAA 1TL9A 1PBHA 1DF0A 3N3GA 3BC3A 4QRGA 1AU0A 2PADA 2FO5A 3K24A 4XUIA 3E1ZB 3HHAA 3V6CA 1PPPA 4B55A 1QMYA 2G8JA 2R9NA 2GFOA 3BWKA 4C5PA 2DZYA 1GLOA 3OISA 1BY8A 3H8BA 4KLBA 2ARYA 2ACTA 1CSBB 3KWBX 3ZUAA 4CDDB 1EWOA 1CJLA 3DF0A 2YJ9A 4P6GA 1GMYA 2E03A 2HD5A 2PNSA 3H8CA 4PADA 2E02A 3P5VA 4K7CA 4MZOA 3CH2X 4YYWA 1M6DA 2DC7A 3IV2A 5A24A 4YVAA 3HWNA 5F02A 1AYWA 2Y5BA 5JA7A 1GX3A 2R6NA 2FRQA 5CHTA 4YV8A 2DJGB 1FH0A 3HHIA 2JQGR 1CPJA 5JH3A 1ZIVA 1PIPA 2G6DA 1STFE 2O6XA 1EWMA 3HD3A 3OF8A 3USVA 1KFXL 3IOQA 1AU3A 4N79A 1PPOA 2DC6A 2FTDA 2XU4A 3N4CA 4N8WA 4YYUA 4AXMA 5CHVA 4X6IA 1X9YA 2F1GA 3IUTA 3U8EA 1ME4A 4BPVA 2HH5A 4P6EA 2B1NA 2H7JA 4CDEB 3M99A 3AI8A 2VFBA 4QRVA 2G7YA 3KKUA 2VFCA 2NQDB 4I05A 3C9EA 2XU5A 1U9WA 5EF4A 1BGOA 1CS8A 1W6FA 2R9FA 4BSQA 2DC9A 3BOWA 3V6EA 2G8EA 1JQPA 1KHPA 1PPNA 4QH6A 2AIMA 4AXLA 1VSNA 2DC8A 1VJVA 1PADA 2BSZA 1CQDA 2FT2A 3S3RA 2BDZA 2P86A 3K8UA 2OP3A 7PCKA 2XU1A 1AU2A 3KSEA 1PXVA 1YVBA 1GECE 2JQFR 2XU3A 1CB5A 4FK5A 4W5BA 1TLOA 4PP1A 4XR7A 3KWZA 2DZZA 2GHUA 4X6JA 1EWLA 1PE6A 1ITOA 2OULA 1NPZA 4PI3A 1A6RA 2YJ8A 3CBKA 4CZWA 5CVOB 4CDFB 1MHWA 2BDLA 3TNXA 4MZSA 2YJCA 1EF7A 1ATKA 4YYVA 2C0YA 1YT7A 3OVZA 4G54A 2CB5A 4DMXA 3PNRA 3H89A 1AU4A 1NB5A 1AYVA 2Y6EA 2FYEA 2HHNA 3NHEA 3I3TA 2DCBA 3H6SA 4YYQA 3QSDA 1POPA 2FQ9A 1IWDA 4CDCB 1MDWA 1QXPA 5PADA 1U9XA 1ME3A 2IBIA 3IEJA 4I07A 1F2AA 1DEUA 3S3QA 4OELA 2NQGA 1CTEA 1XKGA 3IHPA 4YYRA 1NQCA 3MTNA 3OVXA 1Y08A 3KFQA 6PADA 4BGFA 1PPDA 2B1MA 3K9MA 1K3BB 4HWYA 5EGWA 2DCCA 2AYOA 2PREA 1YK7A 1AECA 1MIRA 1F2CA 3OF9A 1BP4A 1U5IA 1O0EA 2OZ2A 3N3KA 1KFUL 3CBJA 3MHHA 2AUXA 4ZUXU 1KHQA 1ZCMA 4NV7A 1QDQA 3QJ3A 3WXGA 1KXRA 1F29A 2AYNA 1QOLA 2FRAA 2ATOA 2HXZA 4QBBA 1CVZA 4N4ZA 3IMAA 1U9VA 1SNKA 2IPPB 3P5XA 5CVNB 3P5UA 3F75A 4FJCA 1CV8A 4GUZA 1SP4B 2NQIA 1W5RA 5K16A 4MSXA 2YJBA 1NB3A 3F5VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RVX A;  1TU6 A;  2DCD A;  3RVV A;  4WA6 A;  3MHS A;  3QT4 A;  1ICF A;  3D6S A;  3I06 A;  3O0U A;  2DCA A;  3BPF A;  9PAP A;  1MEM A;  3MOR A;  1S4V A;  3P5W A;  3PDF A;  3RVW A;  5CVM A;  8PCH A;  2VHS A;  4YYS A;  4BS6 A;  2R9M A;  3WXF A;  1NLJ A;  3B79 A;  3KX1 A;  3PBH A;  3KW9 A;  2E01 A;  3H7D A;  1BQI A;  4RY2 A;  1Q6K A;  1F2B A;  2WBF X;  4X6H A;  4DMY A;  4W5C A;  4FIP A;  4OEM A;  1U9Q X;  3PW3 A;  5J94 A;  3O1G A;  3CH3 X;  1AIM A;  1Y4H A;  2PBH A;  2F7D A;  1PCI A;  2P7U A;  4Q8H A;  4I04 A;  2R9C A;  3ERV A;  2DJF B;  4W4U A;  4QRX A;  1YAL A;  3WXE A;  2AU1 A;  3BCN A;  1YK8 A;  2FUD A;  1HUC B;  1NL6 A;  2R9O A;  3BPM A;  3LFY A;  4BS5 A;  4Q8G A;  1MS6 A;  2P0R A;  1AYU A;  1EWP A;  3GCB A;  1THE A;  4PP2 E;  5FPW A;  2AS8 A;  2CIO A;  1GCB A;  2AVW A;  2VHF A;  2E00 A;  2AUZ A;  2YJ2 A;  3LXS A;  1MEG A;  4BQV A;  2NQA A;  1TL9 A;  1PBH A;  1DF0 A;  3N3G A;  3BC3 A;  4QRG A;  1AU0 A;  2PAD A;  2FO5 A;  3K24 A;  4XUI A;  3E1Z B;  3HHA A;  3V6C A;  1PPP A;  1QMY A;  2G8J A;  2R9N A;  2GFO A;  3BWK A;  2DZY A;  1GLO A;  3OIS A;  1BY8 A;  3H8B A;  4KLB A;  2ARY A;  2ACT A;  1CSB B;  3KWB X;  3ZUA A;  4CDD B;  1EWO A;  1CJL A;  3DF0 A;  2YJ9 A;  4P6G A;  1GMY A;  2E03 A;  2HD5 A;  2PNS A;  3H8C A;  4PAD A;  2E02 A;  3P5V A;  4K7C A;  4MZO A;  3CH2 X;  4YYW A;  1M6D A;  2DC7 A;  3IV2 A;  5A24 A;  4YVA A;  3HWN A;  5F02 A;  1AYW A;  2Y5B A;  5JA7 A;  2R6N A;  2FRQ A;  5CHT A;  4YV8 A;  2DJG B;  1FH0 A;  3HHI A;  2JQG R;  1CPJ A;  5JH3 A;  1ZIV A;  1PIP A;  2G6D A;  1STF E;  2O6X A;  1EWM A;  3HD3 A;  3OF8 A;  3USV A;  1KFX L;  3IOQ A;  1AU3 A;  4N79 A;  1PPO A;  2DC6 A;  2FTD A;  2XU4 A;  3N4C A;  4N8W A;  4YYU A;  4AXM A;  5CHV A;  4X6I A;  1X9Y A;  2F1G A;  3IUT A;  3U8E A;  1ME4 A;  4BPV A;  2HH5 A;  4P6E A;  2B1N A;  2H7J A;  4CDE B;  3M99 A;  3AI8 A;  4QRV A;  2G7Y A;  3KKU A;  2NQD B;  4I05 A;  3C9E A;  2XU5 A;  1U9W A;  5EF4 A;  1BGO A;  1CS8 A;  4BSQ A;  2R9F A;  2DC9 A;  3BOW A;  3V6E A;  2G8E A;  1JQP A;  1KHP A;  1PPN A;  4QH6 A;  2AIM A;  4AXL A;  1VSN A;  2DC8 A;  1VJV A;  1PAD A;  1CQD A;  2FT2 A;  3S3R A;  2BDZ A;  2P86 A;  3K8U A;  2OP3 A;  7PCK A;  2XU1 A;  1AU2 A;  3KSE A;  1PXV A;  1YVB A;  1GEC E;  2JQF R;  2XU3 A;  1CB5 A;  4FK5 A;  4W5B A;  1TLO A;  4PP1 A;  4XR7 A;  3KWZ A;  2DZZ A;  2GHU A;  4X6J A;  1EWL A;  1PE6 A;  1ITO A;  2OUL A;  1NPZ A;  4PI3 A;  1A6R A;  2YJ8 A;  3CBK A;  4CZW A;  5CVO B;  4CDF B;  1MHW A;  2BDL A;  3TNX A;  4MZS A;  2YJC A;  1EF7 A;  1ATK A;  4YYV A;  2C0Y A;  1YT7 A;  3OVZ A;  4G54 A;  2CB5 A;  4DMX A;  3PNR A;  3H89 A;  1AU4 A;  1NB5 A;  1AYV A;  2Y6E A;  2FYE A;  2HHN A;  3NHE A;  3I3T A;  2DCB A;  3H6S A;  4YYQ A;  3QSD A;  1POP A;  2FQ9 A;  1IWD A;  4CDC B;  1MDW A;  1QXP A;  5PAD A;  1U9X A;  1ME3 A;  2IBI A;  3IEJ A;  4I07 A;  1F2A A;  1DEU A;  3S3Q A;  4OEL A;  2NQG A;  1CTE A;  1XKG A;  3IHP A;  4YYR A;  1NQC A;  3MTN A;  3OVX A;  1Y08 A;  3KFQ A;  6PAD A;  1PPD A;  2B1M A;  3K9M A;  1K3B B;  4HWY A;  5EGW A;  2DCC A;  2AYO A;  2PRE A;  1YK7 A;  1AEC A;  1MIR A;  1F2C A;  3OF9 A;  1BP4 A;  1U5I A;  1O0E A;  2OZ2 A;  3N3K A;  1KFU L;  3CBJ A;  3MHH A;  2AUX A;  4ZUX U;  1KHQ A;  1ZCM A;  1QDQ A;  3QJ3 A;  3WXG A;  1KXR A;  1F29 A;  2AYN A;  1QOL A;  2FRA A;  2ATO A;  4QBB A;  2HXZ A;  1CVZ A;  4N4Z A;  3IMA A;  1U9V A;  1SNK A;  2IPP B;  3P5X A;  5CVN B;  3P5U A;  3F75 A;  4FJC A;  1CV8 A;  1SP4 B;  2NQI A;  5K16 A;  4MSX A;  2YJB A;  1NB3 A;  3F5V A; 
#chains in the Genus database with same CATH topology
 3RVX A;  1TU6 A;  2DCD A;  3RVV A;  4WA6 A;  3MHS A;  3QT4 A;  1ICF A;  3B21 A;  3D6S A;  3I06 A;  3O0U A;  4MM3 B;  2DCA A;  3BPF A;  9PAP A;  1MEM A;  3BB7 A;  3MOR A;  1S4V A;  3P5W A;  3PDF A;  3RVW A;  5CVM A;  8PCH A;  2VHS A;  4YYS A;  5KO3 A;  4BS6 A;  2R9M A;  3WXF A;  3PHX A;  1NLJ A;  3B79 A;  3KX1 A;  4BOP A;  3PBH A;  4OVZ B;  3KW9 A;  2E01 A;  3H7D A;  4OVZ A;  4RNA A;  1BQI A;  4RY2 A;  3O65 A;  1Q6K A;  1F2B A;  2WBF X;  4X6H A;  4DMY A;  4W5C A;  4FIP A;  4OEM A;  1U9Q X;  4RF1 A;  3PW3 A;  4PT5 A;  5J94 A;  3O1G A;  2BTW B;  3CH3 X;  1AIM A;  1Y4H A;  2PBH A;  4P16 A;  2BTW A;  2F7D A;  5E6J A;  1PCI A;  2J7Q C;  2P7U A;  4Q8H A;  3PRP A;  4I04 A;  2R9C A;  3ERV A;  4ZTB A;  2DJF B;  4W4U A;  4QRX A;  1YAL A;  3WXE A;  2AU1 A;  3BCN A;  1YK8 A;  2FUD A;  1HUC B;  1NL6 A;  2R9O A;  3BPM A;  3LFY A;  4BS5 A;  4Q8G A;  1MS6 A;  2P0R A;  1AYU A;  4BOS A;  1EWP A;  3GCB A;  1THE A;  5EZQ A;  4PP2 E;  5FPW A;  2AS8 A;  2CIO A;  4XZX A;  1GCB A;  2AVW A;  2JRI A;  2VHF A;  2E00 A;  2AUZ A;  2YJ2 A;  3LXS A;  1MEG A;  4BQV A;  3MJ5 A;  4RKX A;  2NQA A;  1TL9 A;  1PBH A;  1DF0 A;  3N3G A;  3BC3 A;  4QRG A;  1AU0 A;  2PAD A;  2FO5 A;  3K24 A;  4XUI A;  3E1Z B;  3HHA A;  3V6C A;  1PPP A;  1QMY A;  2G8J A;  2HWK A;  2R9N A;  2GFO A;  3BWK A;  2DZY A;  1GLO A;  3OIS A;  1BY8 A;  3H8B A;  4BOQ A;  4KLB A;  2ARY A;  2ACT A;  1CSB B;  3KWB X;  3ZUA A;  4CDD B;  4D8B A;  1EWO A;  1CJL A;  3DF0 A;  2UZJ A;  2YJ9 A;  3PT2 A;  4P6G A;  3PSE A;  1GMY A;  2E03 A;  2HD5 A;  2PNS A;  3H8C A;  4PAD A;  2E02 A;  3P5V A;  4M0W A;  4K7C A;  4D8E A;  4MZO A;  3CH2 X;  4YYW A;  1M6D A;  2DC7 A;  3IV2 A;  5A24 A;  3PHU A;  4YVA A;  4OW0 A;  3HWN A;  5F02 A;  2AGA A;  1AYW A;  2Y5B A;  5JA7 A;  5JZE A;  2R6N A;  3TRK A;  2FRQ A;  5CHT A;  4YV8 A;  2DJG B;  1FH0 A;  3HHI A;  2JQG R;  4BOU A;  1CPJ A;  3RNV A;  5JH3 A;  1ZIV A;  4D8I A;  1PIP A;  2G6D A;  1STF E;  4WUR A;  2O6X A;  2J7Q A;  1EWM A;  3HD3 A;  3OF8 A;  3USV A;  1KFX L;  3IOQ A;  1AU3 A;  4N79 A;  1PPO A;  2DC6 A;  2FTD A;  2XU4 A;  3N4C A;  4N8W A;  2BU3 A;  4YYU A;  4AXM A;  5CHV A;  4BOZ A;  4X6I A;  3PHW A;  1X9Y A;  2F1G A;  3IUT A;  3U8E A;  1ME4 A;  4BPV A;  2HH5 A;  4P6E A;  2B1N A;  2H7J A;  4CDE B;  3M99 A;  3AI8 A;  3ZNH A;  4QRV A;  2G7Y A;  3KKU A;  4IUM A;  2NQD B;  4I05 A;  3C9E A;  2XU5 A;  1U9W A;  5EF4 A;  1BGO A;  1CS8 A;  4BSQ A;  2R9F A;  3E9S A;  3W31 A;  2DC9 A;  3BOW A;  3V6E A;  3BY4 A;  2G8E A;  1JQP A;  1KHP A;  3TMP A;  1PPN A;  4QH6 A;  2AIM A;  4AXL A;  1VSN A;  2DC8 A;  1VJV A;  1PAD A;  1CQD A;  2FT2 A;  3S3R A;  2JTC A;  2BDZ A;  2P86 A;  4RF0 A;  3K8U A;  2OP3 A;  7PCK A;  2XU1 A;  1AU2 A;  3KSE A;  1PXV A;  1YVB A;  1GEC E;  2JQF R;  2Z84 A;  2XU3 A;  1CB5 A;  4FK5 A;  4W5B A;  4MI7 A;  1TLO A;  4PP1 A;  4XR7 A;  1YZB A;  3KWZ A;  5EZS A;  2DZZ A;  2GHU A;  4X6J A;  1EWL A;  1PE6 A;  1ITO A;  2OUL A;  1NPZ A;  4PI3 A;  1A6R A;  2YJ8 A;  3CBK A;  4CZW A;  5CVO B;  4CDF B;  1MHW A;  2BDL A;  3TNX A;  3BBA A;  4MZS A;  2YJC A;  3OQC A;  1EF7 A;  1ATK A;  4YYV A;  4HXD B;  2C0Y A;  1YT7 A;  3OVZ A;  4G54 A;  2CB5 A;  4DMX A;  3PNR A;  3H89 A;  1AU4 A;  1DKI A;  1NB5 A;  1AYV A;  4IP3 A;  2Y6E A;  2FE8 A;  2FYE A;  2HHN A;  3NHE A;  3I3T A;  4R3D A;  2DCB A;  3H6S A;  4YYQ A;  3QSD A;  4GUA A;  1UKF A;  1POP A;  2FQ9 A;  1IWD A;  4CDC B;  1MDW A;  3W30 A;  1QXP A;  4REZ A;  1U9X A;  5PAD A;  1ME3 A;  2IBI A;  3IEJ A;  4I07 A;  4A5U A;  1F2A A;  1DEU A;  3S3Q A;  4OEL A;  2NQG A;  1CTE A;  1XKG A;  3IHP A;  4YYR A;  1NQC A;  3MTN A;  3OVX A;  1Y08 A;  3KFQ A;  6PAD A;  1PPD A;  2B1M A;  3K9M A;  1K3B B;  4HWY A;  5EGW A;  2DCC A;  2AYO A;  2PRE A;  1YK7 A;  1AEC A;  1MIR A;  1F2C A;  3OF9 A;  1BP4 A;  3IFU A;  1U5I A;  1O0E A;  1PVJ A;  2OZ2 A;  3N3K A;  1KFU L;  3CBJ A;  3MHH A;  3MTV A;  2DOS A;  2AUX A;  4ZUX U;  1KHQ A;  1ZCM A;  1QDQ A;  3QJ3 A;  3WXG A;  1KXR A;  1F29 A;  3C0R A;  2AYN A;  1QOL A;  2FRA A;  2ATO A;  2HXZ A;  4QBB A;  1CVZ A;  4N4Z A;  3IMA A;  1U9V A;  1SNK A;  2IPP B;  3P5X A;  5CVN B;  3P5U A;  3F75 A;  4FJC A;  1CV8 A;  1SP4 B;  2NQI A;  5K16 A;  4MSX A;  2YJB A;  1NB3 A;  3MP2 A;  3F5V A;  3PRM A; 
#chains in the Genus database with same CATH homology
 3RVX A;  1TU6 A;  2DCD A;  3RVV A;  4WA6 A;  3MHS A;  3QT4 A;  1ICF A;  3D6S A;  3I06 A;  3O0U A;  2DCA A;  3BPF A;  9PAP A;  1MEM A;  3MOR A;  1S4V A;  3P5W A;  3PDF A;  3RVW A;  5CVM A;  8PCH A;  2VHS A;  4YYS A;  4BS6 A;  2R9M A;  3WXF A;  1NLJ A;  3B79 A;  3KX1 A;  3PBH A;  3KW9 A;  2E01 A;  3H7D A;  3LTW A;  1BQI A;  4RY2 A;  1Q6K A;  1F2B A;  2WBF X;  4X6H A;  4DMY A;  4W5C A;  4FIP A;  4OEM A;  3D9W A;  1U9Q X;  3PW3 A;  5J94 A;  3O1G A;  3CH3 X;  1AIM A;  1Y4H A;  1W4T A;  2PBH A;  2F7D A;  1PCI A;  2P7U A;  4Q8H A;  4I04 A;  2R9C A;  3ERV A;  2DJF B;  4NV8 A;  4W4U A;  4QRX A;  1YAL A;  3WXE A;  2AU1 A;  3BCN A;  1YK8 A;  2FUD A;  1HUC B;  1NL6 A;  2R9O A;  3BPM A;  3LFY A;  4BS5 A;  4Q8G A;  1MS6 A;  2P0R A;  1AYU A;  1EWP A;  3GCB A;  1THE A;  4PP2 E;  5FPW A;  2AS8 A;  2CIO A;  1GCB A;  2AVW A;  2VHF A;  2E00 A;  2AUZ A;  2YJ2 A;  1E2T A;  3LXS A;  1MEG A;  4BQV A;  2NQA A;  1TL9 A;  1PBH A;  1DF0 A;  3N3G A;  3BC3 A;  4QRG A;  1AU0 A;  2PAD A;  2FO5 A;  3K24 A;  4XUI A;  3E1Z B;  3HHA A;  3V6C A;  1PPP A;  4B55 A;  1QMY A;  2G8J A;  2R9N A;  2GFO A;  3BWK A;  4C5P A;  2DZY A;  1GLO A;  3OIS A;  1BY8 A;  3H8B A;  4KLB A;  2ARY A;  2ACT A;  1CSB B;  3KWB X;  3ZUA A;  4CDD B;  1EWO A;  1CJL A;  3DF0 A;  2YJ9 A;  4P6G A;  1GMY A;  2E03 A;  2HD5 A;  2PNS A;  3H8C A;  4PAD A;  2E02 A;  3P5V A;  4K7C A;  4MZO A;  3CH2 X;  4YYW A;  1M6D A;  2DC7 A;  3IV2 A;  5A24 A;  4YVA A;  3HWN A;  5F02 A;  1AYW A;  2Y5B A;  5JA7 A;  1GX3 A;  2R6N A;  2FRQ A;  5CHT A;  4YV8 A;  2DJG B;  1FH0 A;  3HHI A;  2JQG R;  1CPJ A;  5JH3 A;  1ZIV A;  1PIP A;  2G6D A;  1STF E;  2O6X A;  1EWM A;  3HD3 A;  3OF8 A;  3USV A;  1KFX L;  3IOQ A;  1AU3 A;  4N79 A;  1PPO A;  2DC6 A;  2FTD A;  2XU4 A;  3N4C A;  4N8W A;  4YYU A;  4AXM A;  5CHV A;  4X6I A;  1X9Y A;  2F1G A;  3IUT A;  3U8E A;  1ME4 A;  4BPV A;  2HH5 A;  4P6E A;  2B1N A;  2H7J A;  4CDE B;  3M99 A;  3AI8 A;  2VFB A;  4QRV A;  2G7Y A;  3KKU A;  2VFC A;  2NQD B;  4I05 A;  3C9E A;  2XU5 A;  1U9W A;  5EF4 A;  1BGO A;  1CS8 A;  1W6F A;  2R9F A;  4BSQ A;  2DC9 A;  3BOW A;  3V6E A;  2G8E A;  1JQP A;  1KHP A;  1PPN A;  4QH6 A;  2AIM A;  4AXL A;  1VSN A;  2DC8 A;  1VJV A;  1PAD A;  2BSZ A;  1CQD A;  2FT2 A;  3S3R A;  2BDZ A;  2P86 A;  3K8U A;  2OP3 A;  7PCK A;  2XU1 A;  1AU2 A;  3KSE A;  1PXV A;  1YVB A;  1GEC E;  2JQF R;  2XU3 A;  1CB5 A;  4FK5 A;  4W5B A;  1TLO A;  4PP1 A;  4XR7 A;  3KWZ A;  2DZZ A;  2GHU A;  4X6J A;  1EWL A;  1PE6 A;  1ITO A;  2OUL A;  1NPZ A;  4PI3 A;  1A6R A;  2YJ8 A;  3CBK A;  4CZW A;  5CVO B;  4CDF B;  1MHW A;  2BDL A;  3TNX A;  4MZS A;  2YJC A;  1EF7 A;  1ATK A;  4YYV A;  2C0Y A;  1YT7 A;  3OVZ A;  4G54 A;  2CB5 A;  4DMX A;  3PNR A;  3H89 A;  1AU4 A;  1NB5 A;  1AYV A;  2Y6E A;  2FYE A;  2HHN A;  3NHE A;  3I3T A;  2DCB A;  3H6S A;  4YYQ A;  3QSD A;  1POP A;  2FQ9 A;  1IWD A;  4CDC B;  1MDW A;  1QXP A;  5PAD A;  1U9X A;  1ME3 A;  2IBI A;  3IEJ A;  4I07 A;  1F2A A;  1DEU A;  3S3Q A;  4OEL A;  2NQG A;  1CTE A;  1XKG A;  3IHP A;  4YYR A;  1NQC A;  3MTN A;  3OVX A;  1Y08 A;  3KFQ A;  6PAD A;  4BGF A;  1PPD A;  2B1M A;  3K9M A;  1K3B B;  4HWY A;  5EGW A;  2DCC A;  2AYO A;  2PRE A;  1YK7 A;  1AEC A;  1MIR A;  1F2C A;  3OF9 A;  1BP4 A;  1U5I A;  1O0E A;  2OZ2 A;  3N3K A;  1KFU L;  3CBJ A;  3MHH A;  2AUX A;  4ZUX U;  1KHQ A;  1ZCM A;  4NV7 A;  1QDQ A;  3QJ3 A;  3WXG A;  1KXR A;  1F29 A;  2AYN A;  1QOL A;  2FRA A;  2ATO A;  2HXZ A;  4QBB A;  1CVZ A;  4N4Z A;  3IMA A;  1U9V A;  1SNK A;  2IPP B;  3P5X A;  5CVN B;  3P5U A;  3F75 A;  4FJC A;  1CV8 A;  4GUZ A;  1SP4 B;  2NQI A;  1W5R A;  5K16 A;  4MSX A;  2YJB A;  1NB3 A;  3F5V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...