4P6EA

Crystal structure of human cathepsin s bound to a non-covalent inhibitor
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
219
structure length
219
Chain Sequence
ILPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of Cathepsin S Inhibitor LY3000328 for the Treatment of Abdominal Aortic Aneurysm.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cathepsin S
total genus 69
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2014-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4p6eA00
1NLJA 2P7UA 5CHVA 2HH5A 2Y6EA 3P5XA 3KSEA 4I07A 1AIMA 3MTNA 1PPNA 3P5WA 2PNSA 1BP4A 3IUTA 4YYWA 3O1GA 3DF0A 4W5CA 2FRQA 4G54A 3ERVA 1BQIA 2PADA 1S4VA 2G8JA 3OF8A 2WBFX 1DEUA 2R6NA 1BY8A 1Y4HA 1KFXL 2FYEA 5K16A 3OVXA 5FPWA 3I3TA 1NQCA 3BCNA 1EWMA 1Y08A 2IBIA 2CIOA 3N3GA 3LXSA 4CDCB 1MEMA 2BDZA 9PAPA 4X6JA 3OF9A 1CS8A 1PBHA 4OELA 4QRGA 4QBBA 1CVZA 4YYQA 1TL9A 2NQAA 3CH2X 2P86A 2FTDA 2HHNA 4PADA 3IEJA 3MHSA 3RVXA 2YJ9A 5A24A 1SNKA 5J94A 2XU5A 3KW9A 1EF7A 2GHUA 3OISA 5EF4A 1MS6A 1KHQA 2AU1A 2XU4A 3PDFA 2AUXA 3CH3X 2B1MA 2VHFA 3QT4A 1VJVA 3H89A 1QDQA 1GECE 4P6EA 4FIPA 5PADA 1U5IA 1AYUA 2HXZA 1QOLA 3V6CA 2IPPB 1TLOA 2DJFB 4X6IA 8PCHA 5CVNB 3MHHA 1K3BB 4MZSA 1CPJA 2DC7A 4OEMA 1BGOA 1PPDA 2OULA 3TNXA 2E01A 4BS5A 3RVWA 4Q8GA 2FQ9A 3B79A 2B1NA 3U8EA 4YYVA 1PPPA 1ME3A 2YJ8A 3H6SA 1CSBB 4MZOA 4CDDB 1YALA 4BPVA 4AXMA 3H8CA 2R9CA 6PADA 3IHPA 3N4CA 3HHAA 3NHEA 2E00A 5EGWA 4FK5A 3M99A 4I05A 4BQVA 3ZUAA 1O0EA 2PBHA 4XUIA 2F7DA 3RVVA 1NB3A 4YYRA 1NPZA 3D6SA 4QRVA 3HD3A 1U9WA 4I04A 5JH3A 1PXVA 4RY2A 3WXFA 1MHWA 3BWKA 1STFE 4BSQA 4CZWA 1CJLA 2OP3A 3IV2A 3K9MA 3HHIA 4FJCA 2YJ2A 2DZZA 1QMYA 3KWZA 4PP2E 2R9NA 3BC3A 3GCBA 3I06A 2DC8A 2JQGR 4N8WA 2OZ2A 4CDEB 1F2AA 2ACTA 1IWDA 3P5VA 1CB5A 2AYNA 1AU4A 1Q6KA 4ZUXU 1EWOA 1U9XA 2DCCA 1U9QX 3PW3A 1AYWA 2NQIA 3E1ZB 3IOQA 3MORA 4PP1A 1THEA 2O6XA 5CHTA 1TU6A 1A6RA 4QRXA 2F1GA 4N79A 3USVA 4AXLA 1CTEA 1EWLA 2DC6A 3BPFA 5JA7A 3BOWA 1FH0A 1AU3A 1F2BA 1M6DA 2YJCA 1YK8A 2FRAA 3HWNA 1GMYA 4N4ZA 2DCDA 2Y5BA 2GFOA 3S3RA 5F02A 2DCBA 1ME4A 3IMAA 3WXGA 3H7DA 2FUDA 1AYVA 2FT2A 2DCAA 2G8EA 2JQFR 3S3QA 1F2CA 1KHPA 2XU1A 4CDFB 3KFQA 4PI3A 1AECA 4QH6A 1PPOA 1KXRA 4WA6A 7PCKA 2NQDB 1ITOA 3H8BA 2ATOA 1AU0A 1ZIVA 1MDWA 3WXEA 1CQDA 2XU3A 2G6DA 2YJBA 3K8UA 2VHSA 2R9MA 1U9VA 2CB5A 2P0RA 3N3KA 4YV8A 2AVWA 4KLBA 5CVMA 2G7YA 1JQPA 2DC9A 3PBHA 1NB5A 3KKUA 3CBJA 1MIRA 4P6GA 2AIMA 3V6EA 1PE6A 2E03A 1CV8A 2ARYA 1HUCB 1AU2A 1GCBA 3C9EA 4X6HA 1PCIA 1GLOA 1YT7A 2AS8A 1PIPA 4DMXA 4YYUA 2PREA 1PADA 1ICFA 1YVBA 2NQGA 3K24A 1KFUL 2HD5A 2DJGB 4BS6A 3KX1A 1X9YA 4W4UA 2AUZA 4YVAA 1XKGA 4K7CA 3BPMA 5CVOB 2H7JA 3QJ3A 1NL6A 1F29A 1SP4B 1MEGA 3QSDA 2BDLA 1POPA 1QXPA 4XR7A 2R9OA 1EWPA 4MSXA 2R9FA 4YYSA 3CBKA 4DMYA 2DZYA 2E02A 1ZCMA 3LFYA 3F75A 3P5UA 1ATKA 4W5BA 4Q8HA 3AI8A 1VSNA 3F5VA 2FO5A 3PNRA 1DF0A 1YK7A 3O0UA 4HWYA 3OVZA 3KWBX 2C0YA 2AYOA
chains in the Genus database with same CATH superfamily
1NLJA 2P7UA 5CHVA 2HH5A 2Y6EA 4A5UA 3P5XA 3KSEA 4I07A 1AIMA 3MTNA 1PPNA 3P5WA 2PNSA 1BP4A 3IUTA 4YYWA 3O1GA 3E9SA 3DF0A 4W5CA 2FRQA 4G54A 3ERVA 1BQIA 2PADA 1S4VA 3C0RA 2JTCA 2G8JA 3OF8A 2WBFX 1DEUA 2R6NA 1BY8A 1Y4HA 3PRMA 1KFXL 2FYEA 5K16A 3OVXA 2DOSA 5FPWA 3I3TA 1NQCA 3BCNA 2BTWA 1EWMA 1Y08A 2IBIA 2CIOA 4BOUA 3N3GA 3LXSA 4CDCB 1MEMA 2BDZA 1PVJA 9PAPA 4X6JA 3OF9A 1CS8A 1PBHA 4OELA 4QRGA 4QBBA 4HXDB 4PT5A 1CVZA 4YYQA 1TL9A 2NQAA 3CH2X 4MM3B 2P86A 2FTDA 2HHNA 4PADA 3TRKA 3IEJA 3MHSA 3RVXA 2YJ9A 4D8BA 5A24A 1SNKA 5E6JA 4D8EA 5J94A 2XU5A 3KW9A 1EF7A 2GHUA 3OISA 2HWKA 5EF4A 1MS6A 1KHQA 2AU1A 2XU4A 3PDFA 2AUXA 3CH3X 3OQCA 4R3DA 2B1MA 2VHFA 3QT4A 1VJVA 3H89A 1QDQA 1GECE 4IUMA 4P6EA 4FIPA 5PADA 1U5IA 1AYUA 2HXZA 1QOLA 3V6CA 2IPPB 1TLOA 2BTWB 3O65A 2DJFB 3BY4A 4X6IA 8PCHA 5CVNB 3MHHA 1K3BB 4M0WA 4MZSA 1CPJA 2DC7A 4OEMA 1BGOA 1PPDA 2OULA 3TNXA 2E01A 4BS5A 3RVWA 4Q8GA 2FQ9A 3B79A 2B1NA 3U8EA 4YYVA 1PPPA 1ME3A 2YJ8A 3PHUA 3H6SA 1CSBB 4MZOA 4CDDB 1YALA 4BPVA 3TMPA 4AXMA 4BOQA 3H8CA 2R9CA 6PADA 3IHPA 3N4CA 4XZXA 3HHAA 3NHEA 2E00A 5EGWA 4FK5A 3M99A 4REZA 4I05A 4BQVA 3ZUAA 1O0EA 2PBHA 4XUIA 4GUAA 2F7DA 3RVVA 1NB3A 4YYRA 1NPZA 3D6SA 4QRVA 3HD3A 1U9WA 4I04A 5JH3A 1PXVA 4RY2A 3WXFA 4OVZA 1MHWA 3BWKA 1STFE 4BSQA 4CZWA 1CJLA 2OP3A 3IV2A 3K9MA 3HHIA 4FJCA 2YJ2A 4BOZA 4RF0A 2JRIA 2DZZA 1QMYA 5KO3A 3KWZA 4PP2E 2R9NA 3BC3A 3GCBA 3I06A 2DC8A 3ZNHA 2JQGR 5JZEA 4N8WA 2OZ2A 4CDEB 1F2AA 2ACTA 1IWDA 3P5VA 1CB5A 2BU3A 3BB7A 2AYNA 1AU4A 1Q6KA 3W30A 4ZUXU 1EWOA 1U9XA 2DCCA 1U9QX 3PW3A 1AYWA 3MP2A 2NQIA 3E1ZB 3IOQA 3MORA 4PP1A 1THEA 2O6XA 5CHTA 1TU6A 1A6RA 3W31A 4QRXA 2F1GA 4N79A 3USVA 4AXLA 1CTEA 1EWLA 2DC6A 3BPFA 5JA7A 3BOWA 4IP3A 1FH0A 1AU3A 1F2BA 1M6DA 2J7QC 2YJCA 1YK8A 3B21A 2FRAA 3HWNA 1GMYA 4N4ZA 2DCDA 3MJ5A 2Y5BA 2GFOA 3S3RA 5F02A 2DCBA 1ME4A 3IMAA 3WXGA 3H7DA 1DKIA 4WURA 4P16A 2FUDA 1AYVA 2FT2A 2DCAA 3MTVA 2G8EA 2JQFR 3S3QA 1F2CA 1KHPA 2XU1A 4CDFB 3BBAA 3KFQA 4PI3A 1AECA 3PRPA 4QH6A 1PPOA 1KXRA 2FE8A 4WA6A 7PCKA 2NQDB 4BOSA 1ITOA 3H8BA 2ATOA 1AU0A 1ZIVA 3IFUA 1MDWA 3WXEA 1CQDA 2XU3A 2G6DA 2YJBA 4BOPA 3K8UA 2VHSA 2R9MA 2J7QA 1U9VA 2CB5A 2P0RA 3N3KA 4YV8A 2AVWA 4KLBA 3PT2A 2G7YA 5CVMA 4MI7A 1JQPA 2DC9A 3RNVA 3PBHA 4RKXA 4D8IA 5EZSA 1YZBA 1NB5A 3KKUA 3CBJA 1MIRA 4P6GA 2AIMA 3V6EA 1PE6A 2E03A 1CV8A 2ARYA 1HUCB 1AU2A 1GCBA 3C9EA 4X6HA 1PCIA 1GLOA 1YT7A 2AS8A 1PIPA 4DMXA 4YYUA 2PREA 1PADA 1ICFA 1YVBA 2NQGA 3K24A 4ZTBA 1KFUL 2HD5A 2DJGB 4BS6A 3KX1A 5EZQA 1X9YA 4W4UA 2AUZA 4YVAA 1UKFA 1XKGA 4K7CA 3BPMA 5CVOB 2H7JA 3QJ3A 4RF1A 1NL6A 1F29A 1SP4B 1MEGA 3QSDA 2BDLA 1POPA 1QXPA 4XR7A 2R9OA 3PHWA 1EWPA 4MSXA 2R9FA 4OW0A 4YYSA 3CBKA 4DMYA 2DZYA 2E02A 4OVZB 3PHXA 4RNAA 1ZCMA 3LFYA 3F75A 3P5UA 1ATKA 4W5BA 4Q8HA 3AI8A 1VSNA 3F5VA 2FO5A 3PNRA 1DF0A 2UZJA 1YK7A 3O0UA 2Z84A 4HWYA 3OVZA 3KWBX 2C0YA 2AGAA 3PSEA 2AYOA
chains in the Genus database with same CATH topology
1NLJA 2P7UA 5CHVA 2HH5A 2Y6EA 3P5XA 3KSEA 4I07A 1AIMA 3MTNA 1PPNA 3P5WA 2PNSA 1BP4A 3IUTA 4C5PA 4YYWA 3O1GA 3DF0A 4W5CA 2FRQA 4G54A 3ERVA 1BQIA 4BGFA 2PADA 1S4VA 2G8JA 3OF8A 2WBFX 1DEUA 2R6NA 1BY8A 1Y4HA 1KFXL 2FYEA 5K16A 3OVXA 5FPWA 3I3TA 1NQCA 3BCNA 4B55A 1EWMA 1Y08A 2IBIA 2CIOA 3N3GA 3LXSA 4CDCB 1MEMA 2BDZA 4NV7A 1W4TA 9PAPA 4X6JA 3OF9A 1CS8A 1PBHA 4OELA 4QRGA 4QBBA 1CVZA 4YYQA 1TL9A 2NQAA 3CH2X 2P86A 2FTDA 2HHNA 4PADA 3IEJA 3MHSA 3RVXA 2YJ9A 5A24A 1SNKA 5J94A 2XU5A 3KW9A 1EF7A 2GHUA 3OISA 5EF4A 1MS6A 1KHQA 2AU1A 2XU4A 3PDFA 2AUXA 3CH3X 2B1MA 2VHFA 3QT4A 1VJVA 3H89A 1QDQA 1GECE 4P6EA 4FIPA 5PADA 1U5IA 1AYUA 2HXZA 1QOLA 1E2TA 3V6CA 2IPPB 1TLOA 3LTWA 2DJFB 4X6IA 8PCHA 3D9WA 5CVNB 3MHHA 1K3BB 4MZSA 1CPJA 2DC7A 1W6FA 4OEMA 1BGOA 1PPDA 2OULA 3TNXA 2E01A 4BS5A 3RVWA 4Q8GA 2FQ9A 3B79A 2B1NA 3U8EA 4YYVA 1PPPA 1ME3A 2YJ8A 3H6SA 1CSBB 4MZOA 4CDDB 1YALA 4BPVA 4AXMA 4NV8A 3H8CA 2R9CA 6PADA 3IHPA 3N4CA 3HHAA 3NHEA 2E00A 5EGWA 4FK5A 3M99A 4I05A 4BQVA 3ZUAA 1O0EA 2PBHA 4XUIA 2F7DA 3RVVA 1NB3A 4YYRA 1NPZA 3D6SA 4QRVA 3HD3A 1U9WA 4I04A 5JH3A 1PXVA 4RY2A 3WXFA 1MHWA 3BWKA 1STFE 4BSQA 4CZWA 1CJLA 2OP3A 3IV2A 3K9MA 3HHIA 4FJCA 2YJ2A 2DZZA 1QMYA 3KWZA 4PP2E 2R9NA 3BC3A 3GCBA 3I06A 2DC8A 2JQGR 2VFCA 4N8WA 2OZ2A 4CDEB 1F2AA 2ACTA 1IWDA 3P5VA 1CB5A 2AYNA 1AU4A 1Q6KA 4ZUXU 1EWOA 1U9XA 2DCCA 1U9QX 3PW3A 1AYWA 2NQIA 3E1ZB 3IOQA 3MORA 4PP1A 1THEA 2O6XA 5CHTA 1TU6A 1A6RA 4QRXA 2F1GA 4N79A 3USVA 4AXLA 1CTEA 1EWLA 2DC6A 3BPFA 5JA7A 3BOWA 1FH0A 1AU3A 1F2BA 1M6DA 2VFBA 2YJCA 1YK8A 2FRAA 3HWNA 1GMYA 4N4ZA 2DCDA 2Y5BA 2GFOA 3S3RA 5F02A 2DCBA 1ME4A 3IMAA 3WXGA 3H7DA 2FUDA 1AYVA 2FT2A 2DCAA 4GUZA 2G8EA 2JQFR 3S3QA 1F2CA 1KHPA 2XU1A 4CDFB 3KFQA 4PI3A 1AECA 4QH6A 1PPOA 1KXRA 4WA6A 7PCKA 2NQDB 1ITOA 3H8BA 2ATOA 1AU0A 1ZIVA 1MDWA 3WXEA 1CQDA 2XU3A 2G6DA 2YJBA 3K8UA 2VHSA 2R9MA 1U9VA 2CB5A 2P0RA 3N3KA 4YV8A 2AVWA 4KLBA 5CVMA 2G7YA 1JQPA 2DC9A 3PBHA 1NB5A 3KKUA 3CBJA 1MIRA 4P6GA 2AIMA 3V6EA 1PE6A 2E03A 1CV8A 2ARYA 1HUCB 1AU2A 1GCBA 3C9EA 4X6HA 1PCIA 1GLOA 1YT7A 2AS8A 1PIPA 4DMXA 4YYUA 2PREA 1PADA 1ICFA 1YVBA 2NQGA 3K24A 1KFUL 2HD5A 2DJGB 2BSZA 4BS6A 3KX1A 1GX3A 1X9YA 4W4UA 2AUZA 4YVAA 1XKGA 4K7CA 3BPMA 5CVOB 2H7JA 3QJ3A 1NL6A 1F29A 1SP4B 1MEGA 3QSDA 2BDLA 1POPA 1QXPA 4XR7A 2R9OA 1EWPA 4MSXA 2R9FA 1W5RA 4YYSA 3CBKA 4DMYA 2DZYA 2E02A 1ZCMA 3LFYA 3F75A 3P5UA 1ATKA 4W5BA 4Q8HA 3AI8A 1VSNA 3F5VA 2FO5A 3PNRA 1DF0A 1YK7A 3O0UA 4HWYA 3OVZA 3KWBX 2C0YA 2AYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NLJ A;  2P7U A;  5CHV A;  2HH5 A;  2Y6E A;  3P5X A;  3KSE A;  4I07 A;  1AIM A;  3MTN A;  1PPN A;  3P5W A;  2PNS A;  1BP4 A;  3IUT A;  4YYW A;  3O1G A;  3DF0 A;  4W5C A;  2FRQ A;  4G54 A;  3ERV A;  1BQI A;  2PAD A;  1S4V A;  2G8J A;  3OF8 A;  2WBF X;  1DEU A;  2R6N A;  1BY8 A;  1Y4H A;  1KFX L;  2FYE A;  5K16 A;  3OVX A;  5FPW A;  3I3T A;  1NQC A;  3BCN A;  1EWM A;  1Y08 A;  2IBI A;  2CIO A;  3N3G A;  3LXS A;  4CDC B;  1MEM A;  2BDZ A;  9PAP A;  4X6J A;  3OF9 A;  1CS8 A;  1PBH A;  4OEL A;  4QRG A;  4QBB A;  1CVZ A;  4YYQ A;  1TL9 A;  2NQA A;  3CH2 X;  2P86 A;  2FTD A;  2HHN A;  4PAD A;  3IEJ A;  3MHS A;  3RVX A;  2YJ9 A;  5A24 A;  1SNK A;  5J94 A;  2XU5 A;  3KW9 A;  1EF7 A;  2GHU A;  3OIS A;  5EF4 A;  1MS6 A;  1KHQ A;  2AU1 A;  2XU4 A;  3PDF A;  2AUX A;  3CH3 X;  2B1M A;  2VHF A;  3QT4 A;  1VJV A;  3H89 A;  1QDQ A;  1GEC E;  4P6E A;  4FIP A;  5PAD A;  1U5I A;  1AYU A;  2HXZ A;  1QOL A;  3V6C A;  2IPP B;  1TLO A;  2DJF B;  4X6I A;  8PCH A;  5CVN B;  3MHH A;  1K3B B;  4MZS A;  1CPJ A;  2DC7 A;  4OEM A;  1BGO A;  1PPD A;  2OUL A;  3TNX A;  2E01 A;  4BS5 A;  3RVW A;  4Q8G A;  2FQ9 A;  3B79 A;  2B1N A;  3U8E A;  4YYV A;  1PPP A;  1ME3 A;  2YJ8 A;  3H6S A;  1CSB B;  4MZO A;  4CDD B;  1YAL A;  4BPV A;  4AXM A;  3H8C A;  2R9C A;  6PAD A;  3IHP A;  3N4C A;  3HHA A;  3NHE A;  2E00 A;  5EGW A;  4FK5 A;  3M99 A;  4I05 A;  4BQV A;  3ZUA A;  1O0E A;  2PBH A;  4XUI A;  2F7D A;  3RVV A;  1NB3 A;  4YYR A;  1NPZ A;  3D6S A;  4QRV A;  3HD3 A;  1U9W A;  4I04 A;  5JH3 A;  1PXV A;  4RY2 A;  3WXF A;  1MHW A;  3BWK A;  1STF E;  4BSQ A;  4CZW A;  1CJL A;  2OP3 A;  3IV2 A;  3K9M A;  3HHI A;  4FJC A;  2YJ2 A;  2DZZ A;  1QMY A;  3KWZ A;  4PP2 E;  2R9N A;  3BC3 A;  3GCB A;  3I06 A;  2DC8 A;  2JQG R;  4N8W A;  2OZ2 A;  4CDE B;  1F2A A;  2ACT A;  1IWD A;  3P5V A;  1CB5 A;  2AYN A;  1AU4 A;  1Q6K A;  4ZUX U;  1EWO A;  1U9X A;  2DCC A;  1U9Q X;  3PW3 A;  1AYW A;  2NQI A;  3E1Z B;  3IOQ A;  3MOR A;  4PP1 A;  1THE A;  2O6X A;  5CHT A;  1TU6 A;  1A6R A;  4QRX A;  2F1G A;  4N79 A;  3USV A;  4AXL A;  1CTE A;  1EWL A;  2DC6 A;  3BPF A;  5JA7 A;  3BOW A;  1FH0 A;  1AU3 A;  1F2B A;  1M6D A;  2YJC A;  1YK8 A;  2FRA A;  3HWN A;  1GMY A;  4N4Z A;  2DCD A;  2Y5B A;  2GFO A;  3S3R A;  5F02 A;  2DCB A;  1ME4 A;  3IMA A;  3WXG A;  3H7D A;  2FUD A;  1AYV A;  2FT2 A;  2DCA A;  2G8E A;  2JQF R;  3S3Q A;  1F2C A;  1KHP A;  2XU1 A;  4CDF B;  3KFQ A;  4PI3 A;  1AEC A;  4QH6 A;  1PPO A;  1KXR A;  4WA6 A;  7PCK A;  2NQD B;  1ITO A;  3H8B A;  2ATO A;  1AU0 A;  1ZIV A;  1MDW A;  3WXE A;  1CQD A;  2XU3 A;  2G6D A;  2YJB A;  3K8U A;  2VHS A;  2R9M A;  1U9V A;  2CB5 A;  2P0R A;  3N3K A;  4YV8 A;  2AVW A;  4KLB A;  5CVM A;  2G7Y A;  1JQP A;  2DC9 A;  3PBH A;  1NB5 A;  3KKU A;  3CBJ A;  1MIR A;  4P6G A;  2AIM A;  3V6E A;  1PE6 A;  2E03 A;  1CV8 A;  2ARY A;  1HUC B;  1AU2 A;  1GCB A;  3C9E A;  4X6H A;  1PCI A;  1GLO A;  1YT7 A;  2AS8 A;  1PIP A;  4DMX A;  4YYU A;  2PRE A;  1PAD A;  1ICF A;  1YVB A;  2NQG A;  3K24 A;  1KFU L;  2HD5 A;  2DJG B;  4BS6 A;  3KX1 A;  1X9Y A;  4W4U A;  2AUZ A;  4YVA A;  1XKG A;  4K7C A;  3BPM A;  5CVO B;  2H7J A;  3QJ3 A;  1NL6 A;  1F29 A;  1SP4 B;  1MEG A;  3QSD A;  2BDL A;  1POP A;  1QXP A;  4XR7 A;  2R9O A;  1EWP A;  4MSX A;  2R9F A;  4YYS A;  3CBK A;  4DMY A;  2DZY A;  2E02 A;  1ZCM A;  3LFY A;  3F75 A;  3P5U A;  1ATK A;  4W5B A;  4Q8H A;  3AI8 A;  1VSN A;  3F5V A;  2FO5 A;  3PNR A;  1DF0 A;  1YK7 A;  3O0U A;  4HWY A;  3OVZ A;  3KWB X;  2C0Y A;  2AYO A; 
#chains in the Genus database with same CATH topology
 1NLJ A;  2P7U A;  5CHV A;  2HH5 A;  2Y6E A;  4A5U A;  3P5X A;  3KSE A;  4I07 A;  1AIM A;  3MTN A;  1PPN A;  3P5W A;  2PNS A;  1BP4 A;  3IUT A;  4YYW A;  3O1G A;  3E9S A;  3DF0 A;  4W5C A;  2FRQ A;  4G54 A;  3ERV A;  1BQI A;  2PAD A;  1S4V A;  3C0R A;  2JTC A;  2G8J A;  3OF8 A;  2WBF X;  1DEU A;  2R6N A;  1BY8 A;  1Y4H A;  3PRM A;  1KFX L;  2FYE A;  5K16 A;  3OVX A;  2DOS A;  5FPW A;  3I3T A;  1NQC A;  3BCN A;  2BTW A;  1EWM A;  1Y08 A;  2IBI A;  2CIO A;  4BOU A;  3N3G A;  3LXS A;  4CDC B;  1MEM A;  2BDZ A;  1PVJ A;  9PAP A;  4X6J A;  3OF9 A;  1CS8 A;  1PBH A;  4OEL A;  4QRG A;  4QBB A;  4HXD B;  4PT5 A;  1CVZ A;  4YYQ A;  1TL9 A;  2NQA A;  3CH2 X;  4MM3 B;  2P86 A;  2FTD A;  2HHN A;  4PAD A;  3TRK A;  3IEJ A;  3MHS A;  3RVX A;  2YJ9 A;  4D8B A;  5A24 A;  1SNK A;  5E6J A;  4D8E A;  5J94 A;  2XU5 A;  3KW9 A;  1EF7 A;  2GHU A;  3OIS A;  2HWK A;  5EF4 A;  1MS6 A;  1KHQ A;  2AU1 A;  2XU4 A;  3PDF A;  2AUX A;  3CH3 X;  3OQC A;  4R3D A;  2B1M A;  2VHF A;  3QT4 A;  1VJV A;  3H89 A;  1QDQ A;  1GEC E;  4IUM A;  4P6E A;  4FIP A;  5PAD A;  1U5I A;  1AYU A;  2HXZ A;  1QOL A;  3V6C A;  2IPP B;  1TLO A;  2BTW B;  3O65 A;  2DJF B;  3BY4 A;  4X6I A;  8PCH A;  5CVN B;  3MHH A;  1K3B B;  4M0W A;  4MZS A;  1CPJ A;  2DC7 A;  4OEM A;  1BGO A;  1PPD A;  2OUL A;  3TNX A;  2E01 A;  4BS5 A;  3RVW A;  4Q8G A;  2FQ9 A;  3B79 A;  2B1N A;  3U8E A;  4YYV A;  1PPP A;  1ME3 A;  2YJ8 A;  3PHU A;  3H6S A;  1CSB B;  4MZO A;  4CDD B;  1YAL A;  4BPV A;  3TMP A;  4AXM A;  4BOQ A;  3H8C A;  2R9C A;  6PAD A;  3IHP A;  3N4C A;  4XZX A;  3HHA A;  3NHE A;  2E00 A;  5EGW A;  4FK5 A;  3M99 A;  4REZ A;  4I05 A;  4BQV A;  3ZUA A;  1O0E A;  2PBH A;  4XUI A;  4GUA A;  2F7D A;  3RVV A;  1NB3 A;  4YYR A;  1NPZ A;  3D6S A;  4QRV A;  3HD3 A;  1U9W A;  4I04 A;  5JH3 A;  1PXV A;  4RY2 A;  3WXF A;  4OVZ A;  1MHW A;  3BWK A;  1STF E;  4BSQ A;  4CZW A;  1CJL A;  2OP3 A;  3IV2 A;  3K9M A;  3HHI A;  4FJC A;  2YJ2 A;  4BOZ A;  4RF0 A;  2JRI A;  2DZZ A;  1QMY A;  5KO3 A;  3KWZ A;  4PP2 E;  2R9N A;  3BC3 A;  3GCB A;  3I06 A;  2DC8 A;  3ZNH A;  2JQG R;  5JZE A;  4N8W A;  2OZ2 A;  4CDE B;  1F2A A;  2ACT A;  1IWD A;  3P5V A;  1CB5 A;  2BU3 A;  3BB7 A;  2AYN A;  1AU4 A;  1Q6K A;  3W30 A;  4ZUX U;  1EWO A;  1U9X A;  2DCC A;  1U9Q X;  3PW3 A;  1AYW A;  3MP2 A;  2NQI A;  3E1Z B;  3IOQ A;  3MOR A;  4PP1 A;  1THE A;  2O6X A;  5CHT A;  1TU6 A;  1A6R A;  3W31 A;  4QRX A;  2F1G A;  4N79 A;  3USV A;  4AXL A;  1CTE A;  1EWL A;  2DC6 A;  3BPF A;  5JA7 A;  3BOW A;  4IP3 A;  1FH0 A;  1AU3 A;  1F2B A;  1M6D A;  2J7Q C;  2YJC A;  1YK8 A;  3B21 A;  2FRA A;  3HWN A;  1GMY A;  4N4Z A;  2DCD A;  3MJ5 A;  2Y5B A;  2GFO A;  3S3R A;  5F02 A;  2DCB A;  1ME4 A;  3IMA A;  3WXG A;  3H7D A;  1DKI A;  4WUR A;  4P16 A;  2FUD A;  1AYV A;  2FT2 A;  2DCA A;  3MTV A;  2G8E A;  2JQF R;  3S3Q A;  1F2C A;  1KHP A;  2XU1 A;  4CDF B;  3BBA A;  3KFQ A;  4PI3 A;  1AEC A;  3PRP A;  4QH6 A;  1PPO A;  1KXR A;  2FE8 A;  4WA6 A;  7PCK A;  2NQD B;  4BOS A;  1ITO A;  3H8B A;  2ATO A;  1AU0 A;  1ZIV A;  3IFU A;  1MDW A;  3WXE A;  1CQD A;  2XU3 A;  2G6D A;  2YJB A;  4BOP A;  3K8U A;  2VHS A;  2R9M A;  2J7Q A;  1U9V A;  2CB5 A;  2P0R A;  3N3K A;  4YV8 A;  2AVW A;  4KLB A;  3PT2 A;  2G7Y A;  5CVM A;  4MI7 A;  1JQP A;  2DC9 A;  3RNV A;  3PBH A;  4RKX A;  4D8I A;  5EZS A;  1YZB A;  1NB5 A;  3KKU A;  3CBJ A;  1MIR A;  4P6G A;  2AIM A;  3V6E A;  1PE6 A;  2E03 A;  1CV8 A;  2ARY A;  1HUC B;  1AU2 A;  1GCB A;  3C9E A;  4X6H A;  1PCI A;  1GLO A;  1YT7 A;  2AS8 A;  1PIP A;  4DMX A;  4YYU A;  2PRE A;  1PAD A;  1ICF A;  1YVB A;  2NQG A;  3K24 A;  4ZTB A;  1KFU L;  2HD5 A;  2DJG B;  4BS6 A;  3KX1 A;  5EZQ A;  1X9Y A;  4W4U A;  2AUZ A;  4YVA A;  1UKF A;  1XKG A;  4K7C A;  3BPM A;  5CVO B;  2H7J A;  3QJ3 A;  4RF1 A;  1NL6 A;  1F29 A;  1SP4 B;  1MEG A;  3QSD A;  2BDL A;  1POP A;  1QXP A;  4XR7 A;  2R9O A;  3PHW A;  1EWP A;  4MSX A;  2R9F A;  4OW0 A;  4YYS A;  3CBK A;  4DMY A;  2DZY A;  2E02 A;  4OVZ B;  3PHX A;  4RNA A;  1ZCM A;  3LFY A;  3F75 A;  3P5U A;  1ATK A;  4W5B A;  4Q8H A;  3AI8 A;  1VSN A;  3F5V A;  2FO5 A;  3PNR A;  1DF0 A;  2UZJ A;  1YK7 A;  3O0U A;  2Z84 A;  4HWY A;  3OVZ A;  3KWB X;  2C0Y A;  2AGA A;  3PSE A;  2AYO A; 
#chains in the Genus database with same CATH homology
 1NLJ A;  2P7U A;  5CHV A;  2HH5 A;  2Y6E A;  3P5X A;  3KSE A;  4I07 A;  1AIM A;  3MTN A;  1PPN A;  3P5W A;  2PNS A;  1BP4 A;  3IUT A;  4C5P A;  4YYW A;  3O1G A;  3DF0 A;  4W5C A;  2FRQ A;  4G54 A;  3ERV A;  1BQI A;  4BGF A;  2PAD A;  1S4V A;  2G8J A;  3OF8 A;  2WBF X;  1DEU A;  2R6N A;  1BY8 A;  1Y4H A;  1KFX L;  2FYE A;  5K16 A;  3OVX A;  5FPW A;  3I3T A;  1NQC A;  3BCN A;  4B55 A;  1EWM A;  1Y08 A;  2IBI A;  2CIO A;  3N3G A;  3LXS A;  4CDC B;  1MEM A;  2BDZ A;  4NV7 A;  1W4T A;  9PAP A;  4X6J A;  3OF9 A;  1CS8 A;  1PBH A;  4OEL A;  4QRG A;  4QBB A;  1CVZ A;  4YYQ A;  1TL9 A;  2NQA A;  3CH2 X;  2P86 A;  2FTD A;  2HHN A;  4PAD A;  3IEJ A;  3MHS A;  3RVX A;  2YJ9 A;  5A24 A;  1SNK A;  5J94 A;  2XU5 A;  3KW9 A;  1EF7 A;  2GHU A;  3OIS A;  5EF4 A;  1MS6 A;  1KHQ A;  2AU1 A;  2XU4 A;  3PDF A;  2AUX A;  3CH3 X;  2B1M A;  2VHF A;  3QT4 A;  1VJV A;  3H89 A;  1QDQ A;  1GEC E;  4P6E A;  4FIP A;  5PAD A;  1U5I A;  1AYU A;  2HXZ A;  1QOL A;  1E2T A;  3V6C A;  2IPP B;  1TLO A;  3LTW A;  2DJF B;  4X6I A;  8PCH A;  3D9W A;  5CVN B;  3MHH A;  1K3B B;  4MZS A;  1CPJ A;  2DC7 A;  1W6F A;  4OEM A;  1BGO A;  1PPD A;  2OUL A;  3TNX A;  2E01 A;  4BS5 A;  3RVW A;  4Q8G A;  2FQ9 A;  3B79 A;  2B1N A;  3U8E A;  4YYV A;  1PPP A;  1ME3 A;  2YJ8 A;  3H6S A;  1CSB B;  4MZO A;  4CDD B;  1YAL A;  4BPV A;  4AXM A;  4NV8 A;  3H8C A;  2R9C A;  6PAD A;  3IHP A;  3N4C A;  3HHA A;  3NHE A;  2E00 A;  5EGW A;  4FK5 A;  3M99 A;  4I05 A;  4BQV A;  3ZUA A;  1O0E A;  2PBH A;  4XUI A;  2F7D A;  3RVV A;  1NB3 A;  4YYR A;  1NPZ A;  3D6S A;  4QRV A;  3HD3 A;  1U9W A;  4I04 A;  5JH3 A;  1PXV A;  4RY2 A;  3WXF A;  1MHW A;  3BWK A;  1STF E;  4BSQ A;  4CZW A;  1CJL A;  2OP3 A;  3IV2 A;  3K9M A;  3HHI A;  4FJC A;  2YJ2 A;  2DZZ A;  1QMY A;  3KWZ A;  4PP2 E;  2R9N A;  3BC3 A;  3GCB A;  3I06 A;  2DC8 A;  2JQG R;  2VFC A;  4N8W A;  2OZ2 A;  4CDE B;  1F2A A;  2ACT A;  1IWD A;  3P5V A;  1CB5 A;  2AYN A;  1AU4 A;  1Q6K A;  4ZUX U;  1EWO A;  1U9X A;  2DCC A;  1U9Q X;  3PW3 A;  1AYW A;  2NQI A;  3E1Z B;  3IOQ A;  3MOR A;  4PP1 A;  1THE A;  2O6X A;  5CHT A;  1TU6 A;  1A6R A;  4QRX A;  2F1G A;  4N79 A;  3USV A;  4AXL A;  1CTE A;  1EWL A;  2DC6 A;  3BPF A;  5JA7 A;  3BOW A;  1FH0 A;  1AU3 A;  1F2B A;  1M6D A;  2VFB A;  2YJC A;  1YK8 A;  2FRA A;  3HWN A;  1GMY A;  4N4Z A;  2DCD A;  2Y5B A;  2GFO A;  3S3R A;  5F02 A;  2DCB A;  1ME4 A;  3IMA A;  3WXG A;  3H7D A;  2FUD A;  1AYV A;  2FT2 A;  2DCA A;  4GUZ A;  2G8E A;  2JQF R;  3S3Q A;  1F2C A;  1KHP A;  2XU1 A;  4CDF B;  3KFQ A;  4PI3 A;  1AEC A;  4QH6 A;  1PPO A;  1KXR A;  4WA6 A;  7PCK A;  2NQD B;  1ITO A;  3H8B A;  2ATO A;  1AU0 A;  1ZIV A;  1MDW A;  3WXE A;  1CQD A;  2XU3 A;  2G6D A;  2YJB A;  3K8U A;  2VHS A;  2R9M A;  1U9V A;  2CB5 A;  2P0R A;  3N3K A;  4YV8 A;  2AVW A;  4KLB A;  5CVM A;  2G7Y A;  1JQP A;  2DC9 A;  3PBH A;  1NB5 A;  3KKU A;  3CBJ A;  1MIR A;  4P6G A;  2AIM A;  3V6E A;  1PE6 A;  2E03 A;  1CV8 A;  2ARY A;  1HUC B;  1AU2 A;  1GCB A;  3C9E A;  4X6H A;  1PCI A;  1GLO A;  1YT7 A;  2AS8 A;  1PIP A;  4DMX A;  4YYU A;  2PRE A;  1PAD A;  1ICF A;  1YVB A;  2NQG A;  3K24 A;  1KFU L;  2HD5 A;  2DJG B;  2BSZ A;  4BS6 A;  3KX1 A;  1GX3 A;  1X9Y A;  4W4U A;  2AUZ A;  4YVA A;  1XKG A;  4K7C A;  3BPM A;  5CVO B;  2H7J A;  3QJ3 A;  1NL6 A;  1F29 A;  1SP4 B;  1MEG A;  3QSD A;  2BDL A;  1POP A;  1QXP A;  4XR7 A;  2R9O A;  1EWP A;  4MSX A;  2R9F A;  1W5R A;  4YYS A;  3CBK A;  4DMY A;  2DZY A;  2E02 A;  1ZCM A;  3LFY A;  3F75 A;  3P5U A;  1ATK A;  4W5B A;  4Q8H A;  3AI8 A;  1VSN A;  3F5V A;  2FO5 A;  3PNR A;  1DF0 A;  1YK7 A;  3O0U A;  4HWY A;  3OVZ A;  3KWB X;  2C0Y A;  2AYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...