1NB5A

Crystal structure of stefin a in complex with cathepsin h
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
220
structure length
220
Chain Sequence
YPPSMDWRKKGNFVSPVKNQGSCGSCWTFSTTGALESAVAIATGKMLSLAEQQLVDCAQNFNNHGCQGGLPSQAFEYIRYNKGIMGEDTYPYKGQDDHCKFQPDKAIAFVKDVANITMNDEEAMVEAVALYNPVSFAFEVTNDFLMYRKGIYSSTSCHKTPDKVNHAVLAVGYGEENGIPYWIVKNSWGPQWGMNGYFLIERGKNMCGLAACASYPIPLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of stefin A in complex with cathepsin H: N-terminal residues of inhibitors can adapt to the active sites of endo- and exopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cathepsin H
total genus 55
structure length 220
sequence length 220
chains with identical sequence B, C, D
ec nomenclature ec 3.4.22.16: Cathepsin H.
pdb deposition date 2002-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1nb5A00
1BP4A 1CB5A 1CPJA 3O0UA 1NB5A 4PP1A 3ZUAA 2FUDA 4BQVA 3BOWA 1CTEA 3B79A 1F2BA 2XU1A 2DCCA 4YYQA 4YYUA 1VSNA 2FO5A 3MTNA 8PCHA 3V6EA 4CDEB 5EF4A 1NQCA 4W5BA 4N79A 5CVMA 2VHFA 1K3BB 2PREA 3K24A 2YJ8A 2H7JA 4I05A 2R9CA 1SP4B 1YK8A 3HWNA 1AU3A 4Q8HA 1EWOA 4QRXA 1CS8A 2YJBA 2DC7A 3H8BA 1A6RA 1GECE 1BQIA 1PPOA 4I04A 2VHSA 2NQGA 1MDWA 1U9WA 2FRQA 5CVOB 2IPPB 4W4UA 3V6CA 3RVWA 4RY2A 4QH6A 1M6DA 3F75A 1QMYA 1YVBA 4OEMA 2G6DA 5F02A 3IMAA 3IEJA 4QRVA 3KWZA 4KLBA 1PPPA 1ME3A 2FQ9A 3N4CA 2Y6EA 3N3KA 1THEA 2DC6A 2HD5A 2XU4A 9PAPA 3PW3A 1QDQA 3ERVA 1U9QX 1U5IA 4BS6A 3QT4A 3C9EA 2E00A 3AI8A 3KX1A 4X6IA 3PDFA 1DEUA 3H89A 2FTDA 3I3TA 1FH0A 3H6SA 3MORA 1S4VA 2E03A 2R6NA 1CVZA 1ME4A 3HHIA 1GMYA 2DCAA 5EGWA 4MSXA 3GCBA 3IOQA 1EF7A 1F2CA 1YK7A 1AYUA 1HUCB 3TNXA 4FK5A 2AUXA 3KKUA 3M99A 4K7CA 1KHQA 3DF0A 1QOLA 4CZWA 3LFYA 1MEMA 2P86A 2AIMA 2WBFX 3S3RA 2NQDB 1PIPA 1AIMA 1CV8A 4AXLA 3LXSA 2B1MA 2YJ2A 3MHSA 1AU4A 5J94A 4X6HA 1TLOA 3OVXA 1CJLA 4PI3A 2R9NA 1MS6A 2AS8A 1Y08A 3U8EA 1EWMA 1AYVA 1AYWA 4Q8GA 1ATKA 3P5WA 3IHPA 4WA6A 4QBBA 2R9FA 1PPDA 3IUTA 2OP3A 1ZIVA 3H7DA 2BDLA 4P6GA 1YT7A 2HHNA 2AUZA 2DJGB 3P5UA 1KFXL 1VJVA 1AU2A 2O6XA 1EWPA 4AXMA 1ZCMA 4P6EA 3BCNA 4X6JA 5JA7A 1PPNA 3BC3A 4DMYA 3OISA 3CH2X 3E1ZB 2E02A 2DCBA 1YALA 2BDZA 4YVAA 4CDCB 3CBJA 1X9YA 3KSEA 1IWDA 1KXRA 1TU6A 2XU3A 1NB3A 3HHAA 2F1GA 3WXEA 2DZZA 2DJFB 4MZOA 3D6SA 1ICFA 2GFOA 3OF9A 4MZSA 2P7UA 1AECA 4FIPA 2Y5BA 5K16A 1XKGA 3RVVA 1PE6A 4OELA 4BPVA 3BWKA 3K8UA 1PXVA 2HH5A 1NPZA 1Y4HA 2DC8A 3KW9A 2C0YA 3WXFA 3MHHA 1GCBA 2DCDA 1F2AA 1SNKA 4BS5A 2G7YA 3KFQA 4CDFB 1MIRA 2YJ9A 2PNSA 2HXZA 1EWLA 1POPA 3N3GA 3P5VA 1QXPA 2CIOA 3H8CA 3F5VA 4BSQA 2JQFR 3CH3X 4N8WA 2AYNA 2YJCA 5A24A 2R9OA 4CDDB 1GLOA 1KHPA 7PCKA 1NL6A 2PADA 1STFE 5PADA 3WXGA 4YYVA 4ZUXU 2PBHA 2F7DA 1PADA 3BPFA 3I06A 3KWBX 4W5CA 1PBHA 2GHUA 1JQPA 3BPMA 2CB5A 1MEGA 2FYEA 4FJCA 3K9MA 1NLJA 3USVA 1ITOA 2ACTA 4YV8A 3P5XA 1CSBB 3S3QA 3QSDA 2OULA 1Q6KA 5CHTA 1CQDA 3IV2A 4G54A 4N4ZA 1U9VA 2NQIA 5JH3A 1MHWA 1DF0A 1BY8A 4YYRA 1F29A 5CVNB 1AU0A 2E01A 1PCIA 2NQAA 3RVXA 2ARYA 1BGOA 2DC9A 5FPWA 5CHVA 4QRGA 4XR7A 2FRAA 4HWYA 4YYWA 6PADA 2G8JA 3PBHA 4I07A 1KFUL 3O1GA 2R9MA 1O0EA 2IBIA 2AVWA 2XU5A 2AYOA 4PADA 2P0RA 3CBKA 4XUIA 1TL9A 3PNRA 2JQGR 2AU1A 1U9XA 3HD3A 4YYSA 4PP2E 3OVZA 2ATOA 2B1NA 2FT2A 2DZYA 2OZ2A 3OF8A 2G8EA 3NHEA 3QJ3A 4DMXA
chains in the Genus database with same CATH superfamily
1BP4A 1CB5A 1CPJA 3O0UA 1NB5A 4PP1A 3ZUAA 2FUDA 4BQVA 3MJ5A 5EZQA 3BOWA 1CTEA 3B79A 1F2BA 2XU1A 2DCCA 4YYQA 4YYUA 1VSNA 2FO5A 3C0RA 3MTNA 4OVZB 3PT2A 8PCHA 3V6EA 4CDEB 5EF4A 1NQCA 3TRKA 4W5BA 4N79A 5CVMA 2VHFA 1K3BB 2PREA 3K24A 2YJ8A 2H7JA 4I05A 2R9CA 1SP4B 1YK8A 3HWNA 1AU3A 4Q8HA 1EWOA 4QRXA 1CS8A 2YJBA 2DC7A 3H8BA 1A6RA 1GECE 1BQIA 1PPOA 4I04A 2VHSA 2NQGA 3E9SA 1MDWA 1U9WA 2FRQA 2JRIA 5CVOB 2IPPB 4W4UA 3V6CA 3RVWA 4RY2A 4QH6A 1M6DA 3F75A 1QMYA 1YVBA 4OEMA 2G6DA 5F02A 3IMAA 3IEJA 4QRVA 3KWZA 4KLBA 2FE8A 2UZJA 4WURA 1PPPA 1ME3A 2FQ9A 3N4CA 3OQCA 2Y6EA 3N3KA 1THEA 4IUMA 2DC6A 2HD5A 2XU4A 9PAPA 3PW3A 1QDQA 3ERVA 1U9QX 1U5IA 4BS6A 3QT4A 4IP3A 3C9EA 2E00A 3AI8A 3KX1A 4X6IA 4XZXA 3PDFA 3BB7A 1DEUA 3H89A 2FTDA 3I3TA 4PT5A 1FH0A 3H6SA 3MORA 2JTCA 1S4VA 2E03A 2R6NA 1CVZA 1ME4A 3HHIA 1GMYA 2DCAA 3PHWA 3PHUA 5EGWA 4MSXA 3GCBA 4A5UA 3IOQA 1EF7A 1F2CA 1YK7A 1AYUA 1HUCB 3TNXA 3PSEA 4FK5A 2AUXA 3KKUA 3M99A 4K7CA 1KHQA 4RF1A 3DF0A 1QOLA 4CZWA 3LFYA 2AGAA 4GUAA 1MEMA 3IFUA 2P86A 2AIMA 2WBFX 3S3RA 2NQDB 1PIPA 1AIMA 1CV8A 4AXLA 3LXSA 2B1MA 2YJ2A 3MHSA 1AU4A 2BTWA 5J94A 4OW0A 4X6HA 1TLOA 3OVXA 1CJLA 4PI3A 2R9NA 1MS6A 2AS8A 1Y08A 3U8EA 1EWMA 1AYVA 1AYWA 1ATKA 4Q8GA 3P5WA 3IHPA 4WA6A 4QBBA 2R9FA 1PPDA 3IUTA 2OP3A 3PRPA 1DKIA 3PHXA 1ZIVA 3H7DA 2BDLA 4REZA 4P6GA 1YT7A 2HHNA 2AUZA 2DJGB 3P5UA 4BOQA 2J7QC 1KFXL 1VJVA 1AU2A 2O6XA 1EWPA 4AXMA 1ZCMA 4P6EA 4BOPA 3MTVA 3BCNA 4X6JA 2Z84A 5JA7A 1PPNA 3BC3A 4DMYA 3OISA 3CH2X 3E1ZB 2E02A 2DCBA 1YALA 2BDZA 4YVAA 4CDCB 3CBJA 1X9YA 4RNAA 3KSEA 1IWDA 1KXRA 1TU6A 2XU3A 3BBAA 1NB3A 3HHAA 2F1GA 3WXEA 2DZZA 2DJFB 4MZOA 4BOZA 3D6SA 1ICFA 2GFOA 3OF9A 4MZSA 4D8EA 2P7UA 1AECA 4FIPA 3W31A 2Y5BA 5K16A 1XKGA 3RVVA 3BY4A 1PE6A 4OELA 4MI7A 4M0WA 4BPVA 4D8IA 3BWKA 3K8UA 2BU3A 1PXVA 2HH5A 1NPZA 1Y4HA 2DC8A 4RF0A 3KW9A 2C0YA 3WXFA 3TMPA 3MHHA 1GCBA 2DCDA 1F2AA 1SNKA 4BS5A 2G7YA 5E6JA 3KFQA 4CDFB 1UKFA 3MP2A 1MIRA 4ZTBA 2YJ9A 2PNSA 2HXZA 1EWLA 1POPA 3N3GA 3P5VA 1QXPA 2CIOA 3H8CA 3F5VA 4BSQA 2JQFR 3CH3X 4N8WA 2AYNA 2YJCA 5A24A 2R9OA 4CDDB 1GLOA 1KHPA 7PCKA 1NL6A 2PADA 3PRMA 1STFE 5PADA 3WXGA 4YYVA 2J7QA 4BOUA 4ZUXU 2PBHA 2F7DA 1PADA 3BPFA 3I06A 3KWBX 4R3DA 1PVJA 4W5CA 1PBHA 4MM3B 2GHUA 1JQPA 3BPMA 2CB5A 1MEGA 4RKXA 2FYEA 4FJCA 3K9MA 1NLJA 3USVA 1ITOA 2ACTA 4YV8A 3P5XA 1CSBB 3S3QA 3QSDA 4OVZA 2OULA 1Q6KA 5CHTA 1CQDA 3IV2A 4G54A 4N4ZA 1U9VA 2NQIA 5JH3A 1MHWA 1DF0A 1BY8A 4YYRA 5EZSA 1F29A 5CVNB 1AU0A 2E01A 1PCIA 2NQAA 2HWKA 3RVXA 2ARYA 3RNVA 1BGOA 2DC9A 3ZNHA 5FPWA 4D8BA 5CHVA 4QRGA 4XR7A 2FRAA 4HWYA 4YYWA 6PADA 2G8JA 3PBHA 3B21A 4I07A 1KFUL 2DOSA 3O1GA 2R9MA 1O0EA 2IBIA 2AVWA 2XU5A 4BOSA 2AYOA 4PADA 2P0RA 1YZBA 3CBKA 4XUIA 5JZEA 1TL9A 3PNRA 2JQGR 2AU1A 1U9XA 3HD3A 4YYSA 2BTWB 4PP2E 3OVZA 3O65A 2ATOA 2B1NA 2FT2A 5KO3A 2DZYA 2OZ2A 3OF8A 2G8EA 4HXDB 3NHEA 3QJ3A 4DMXA 3W30A 4P16A
chains in the Genus database with same CATH topology
1BP4A 1CB5A 1CPJA 3O0UA 1NB5A 4PP1A 3ZUAA 2FUDA 4BQVA 3BOWA 1CTEA 3B79A 1F2BA 2XU1A 2DCCA 4YYQA 4YYUA 1VSNA 2FO5A 3MTNA 8PCHA 3V6EA 4CDEB 5EF4A 1NQCA 1W6FA 4W5BA 4N79A 5CVMA 2VHFA 1K3BB 2PREA 3K24A 2YJ8A 2H7JA 4I05A 2R9CA 1SP4B 1YK8A 3HWNA 1AU3A 4Q8HA 1EWOA 1W4TA 4QRXA 1CS8A 2YJBA 2DC7A 3H8BA 1A6RA 1GECE 1BQIA 3D9WA 1PPOA 4I04A 2VHSA 2NQGA 1MDWA 1U9WA 2FRQA 5CVOB 2IPPB 4W4UA 3V6CA 3RVWA 4RY2A 4QH6A 1M6DA 3F75A 1QMYA 1YVBA 4OEMA 2G6DA 5F02A 3IMAA 3IEJA 4QRVA 3KWZA 4KLBA 2VFCA 1PPPA 1ME3A 2FQ9A 3N4CA 2Y6EA 3N3KA 1THEA 2DC6A 2HD5A 2XU4A 9PAPA 3PW3A 1QDQA 3ERVA 1U9QX 1U5IA 4BS6A 3QT4A 3C9EA 2E00A 3AI8A 3KX1A 4X6IA 3PDFA 1DEUA 3H89A 2FTDA 3I3TA 1FH0A 3H6SA 3MORA 1S4VA 2E03A 2R6NA 1CVZA 1ME4A 3HHIA 1GMYA 2DCAA 5EGWA 4MSXA 3GCBA 3IOQA 1EF7A 1F2CA 1YK7A 1AYUA 1HUCB 3TNXA 4FK5A 2AUXA 3KKUA 3M99A 4K7CA 1KHQA 3DF0A 1QOLA 4CZWA 3LFYA 1MEMA 2P86A 2AIMA 2WBFX 3S3RA 2NQDB 1PIPA 1AIMA 1CV8A 4AXLA 3LXSA 2B1MA 2YJ2A 3MHSA 1AU4A 5J94A 4X6HA 1TLOA 3OVXA 1CJLA 4PI3A 2R9NA 1MS6A 2AS8A 1Y08A 3U8EA 1EWMA 1AYVA 1AYWA 4Q8GA 1ATKA 3P5WA 3IHPA 4WA6A 4QBBA 2R9FA 1PPDA 3IUTA 2OP3A 1ZIVA 3H7DA 2BDLA 4P6GA 1YT7A 4C5PA 2HHNA 2AUZA 2DJGB 3P5UA 1KFXL 1VJVA 1AU2A 2O6XA 1EWPA 4AXMA 1ZCMA 4P6EA 3BCNA 4X6JA 5JA7A 1PPNA 3BC3A 4DMYA 4GUZA 3OISA 3CH2X 3E1ZB 2E02A 2DCBA 1YALA 2BDZA 4YVAA 4CDCB 3CBJA 1X9YA 3KSEA 1IWDA 1KXRA 1TU6A 2XU3A 1NB3A 3HHAA 2F1GA 3WXEA 2DZZA 2DJFB 4MZOA 3D6SA 1ICFA 2GFOA 3OF9A 4MZSA 2P7UA 1AECA 4FIPA 2Y5BA 5K16A 1XKGA 3RVVA 1PE6A 4OELA 4BPVA 3BWKA 3K8UA 1PXVA 2HH5A 1NPZA 1Y4HA 2DC8A 3KW9A 1GX3A 2C0YA 3WXFA 3MHHA 1GCBA 2DCDA 3LTWA 1F2AA 1SNKA 4BS5A 4B55A 2G7YA 3KFQA 4CDFB 1E2TA 1MIRA 2YJ9A 2PNSA 2HXZA 1EWLA 2VFBA 1POPA 3N3GA 3P5VA 1QXPA 2CIOA 3H8CA 3F5VA 4BSQA 2JQFR 3CH3X 4BGFA 4N8WA 2AYNA 2YJCA 5A24A 2R9OA 4CDDB 1GLOA 1KHPA 7PCKA 1NL6A 2PADA 1STFE 5PADA 3WXGA 4YYVA 4ZUXU 2PBHA 2F7DA 1PADA 3BPFA 3I06A 3KWBX 4W5CA 1PBHA 2GHUA 1JQPA 3BPMA 2CB5A 1MEGA 2FYEA 4FJCA 3K9MA 1NLJA 3USVA 1ITOA 2ACTA 4YV8A 3P5XA 1CSBB 3S3QA 3QSDA 2OULA 1Q6KA 5CHTA 1CQDA 3IV2A 4G54A 4N4ZA 1U9VA 2NQIA 5JH3A 1MHWA 1DF0A 1BY8A 2BSZA 4YYRA 1F29A 5CVNB 1AU0A 2E01A 1PCIA 2NQAA 3RVXA 2ARYA 1BGOA 2DC9A 5FPWA 5CHVA 4QRGA 4XR7A 2FRAA 4HWYA 4YYWA 6PADA 2G8JA 3PBHA 1W5RA 4I07A 1KFUL 4NV7A 3O1GA 2R9MA 1O0EA 2IBIA 2AVWA 2XU5A 2AYOA 4PADA 2P0RA 3CBKA 4XUIA 1TL9A 3PNRA 2JQGR 2AU1A 1U9XA 3HD3A 4YYSA 4PP2E 3OVZA 2ATOA 2B1NA 2FT2A 4NV8A 2DZYA 2OZ2A 3OF8A 2G8EA 3NHEA 3QJ3A 4DMXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BP4 A;  1CB5 A;  1CPJ A;  3O0U A;  1NB5 A;  4PP1 A;  3ZUA A;  2FUD A;  4BQV A;  3BOW A;  1CTE A;  3B79 A;  1F2B A;  2XU1 A;  2DCC A;  4YYQ A;  4YYU A;  1VSN A;  2FO5 A;  3MTN A;  8PCH A;  3V6E A;  4CDE B;  5EF4 A;  1NQC A;  4W5B A;  4N79 A;  5CVM A;  2VHF A;  1K3B B;  2PRE A;  3K24 A;  2YJ8 A;  2H7J A;  4I05 A;  2R9C A;  1SP4 B;  1YK8 A;  3HWN A;  1AU3 A;  4Q8H A;  1EWO A;  4QRX A;  1CS8 A;  2YJB A;  2DC7 A;  3H8B A;  1A6R A;  1GEC E;  1BQI A;  1PPO A;  4I04 A;  2VHS A;  2NQG A;  1MDW A;  1U9W A;  2FRQ A;  5CVO B;  2IPP B;  4W4U A;  3V6C A;  3RVW A;  4RY2 A;  4QH6 A;  1M6D A;  3F75 A;  1QMY A;  1YVB A;  4OEM A;  2G6D A;  5F02 A;  3IMA A;  3IEJ A;  4QRV A;  3KWZ A;  4KLB A;  1PPP A;  1ME3 A;  2FQ9 A;  3N4C A;  2Y6E A;  3N3K A;  1THE A;  2DC6 A;  2HD5 A;  2XU4 A;  9PAP A;  3PW3 A;  1QDQ A;  3ERV A;  1U9Q X;  1U5I A;  4BS6 A;  3QT4 A;  3C9E A;  2E00 A;  3AI8 A;  3KX1 A;  4X6I A;  3PDF A;  1DEU A;  3H89 A;  2FTD A;  3I3T A;  1FH0 A;  3H6S A;  3MOR A;  1S4V A;  2E03 A;  2R6N A;  1CVZ A;  1ME4 A;  3HHI A;  1GMY A;  2DCA A;  5EGW A;  4MSX A;  3GCB A;  3IOQ A;  1EF7 A;  1F2C A;  1YK7 A;  1AYU A;  1HUC B;  3TNX A;  4FK5 A;  2AUX A;  3KKU A;  3M99 A;  4K7C A;  1KHQ A;  3DF0 A;  1QOL A;  4CZW A;  3LFY A;  1MEM A;  2P86 A;  2AIM A;  2WBF X;  3S3R A;  2NQD B;  1PIP A;  1AIM A;  1CV8 A;  4AXL A;  3LXS A;  2B1M A;  2YJ2 A;  3MHS A;  1AU4 A;  5J94 A;  4X6H A;  1TLO A;  3OVX A;  1CJL A;  4PI3 A;  2R9N A;  1MS6 A;  2AS8 A;  1Y08 A;  3U8E A;  1EWM A;  1AYV A;  1AYW A;  4Q8G A;  1ATK A;  3P5W A;  3IHP A;  4WA6 A;  4QBB A;  2R9F A;  1PPD A;  3IUT A;  2OP3 A;  1ZIV A;  3H7D A;  2BDL A;  4P6G A;  1YT7 A;  2HHN A;  2AUZ A;  2DJG B;  3P5U A;  1KFX L;  1VJV A;  1AU2 A;  2O6X A;  1EWP A;  4AXM A;  1ZCM A;  4P6E A;  3BCN A;  4X6J A;  5JA7 A;  1PPN A;  3BC3 A;  4DMY A;  3OIS A;  3CH2 X;  3E1Z B;  2E02 A;  2DCB A;  1YAL A;  2BDZ A;  4YVA A;  4CDC B;  3CBJ A;  1X9Y A;  3KSE A;  1IWD A;  1KXR A;  1TU6 A;  2XU3 A;  1NB3 A;  3HHA A;  2F1G A;  3WXE A;  2DZZ A;  2DJF B;  4MZO A;  3D6S A;  1ICF A;  2GFO A;  3OF9 A;  4MZS A;  2P7U A;  1AEC A;  4FIP A;  2Y5B A;  5K16 A;  1XKG A;  3RVV A;  1PE6 A;  4OEL A;  4BPV A;  3BWK A;  3K8U A;  1PXV A;  2HH5 A;  1NPZ A;  1Y4H A;  2DC8 A;  3KW9 A;  2C0Y A;  3WXF A;  3MHH A;  1GCB A;  2DCD A;  1F2A A;  1SNK A;  4BS5 A;  2G7Y A;  3KFQ A;  4CDF B;  1MIR A;  2YJ9 A;  2PNS A;  2HXZ A;  1EWL A;  1POP A;  3N3G A;  3P5V A;  1QXP A;  2CIO A;  3H8C A;  3F5V A;  4BSQ A;  2JQF R;  3CH3 X;  4N8W A;  2AYN A;  2YJC A;  5A24 A;  2R9O A;  4CDD B;  1GLO A;  1KHP A;  7PCK A;  1NL6 A;  2PAD A;  1STF E;  5PAD A;  3WXG A;  4YYV A;  4ZUX U;  2PBH A;  2F7D A;  1PAD A;  3BPF A;  3I06 A;  3KWB X;  4W5C A;  1PBH A;  2GHU A;  1JQP A;  3BPM A;  2CB5 A;  1MEG A;  2FYE A;  4FJC A;  3K9M A;  1NLJ A;  3USV A;  1ITO A;  2ACT A;  4YV8 A;  3P5X A;  1CSB B;  3S3Q A;  3QSD A;  2OUL A;  1Q6K A;  5CHT A;  1CQD A;  3IV2 A;  4G54 A;  4N4Z A;  1U9V A;  2NQI A;  5JH3 A;  1MHW A;  1DF0 A;  1BY8 A;  4YYR A;  1F29 A;  5CVN B;  1AU0 A;  2E01 A;  1PCI A;  2NQA A;  3RVX A;  2ARY A;  1BGO A;  2DC9 A;  5FPW A;  5CHV A;  4QRG A;  4XR7 A;  2FRA A;  4HWY A;  4YYW A;  6PAD A;  2G8J A;  3PBH A;  4I07 A;  1KFU L;  3O1G A;  2R9M A;  1O0E A;  2IBI A;  2AVW A;  2XU5 A;  2AYO A;  4PAD A;  2P0R A;  3CBK A;  4XUI A;  1TL9 A;  3PNR A;  2JQG R;  2AU1 A;  1U9X A;  3HD3 A;  4YYS A;  4PP2 E;  3OVZ A;  2ATO A;  2B1N A;  2FT2 A;  2DZY A;  2OZ2 A;  3OF8 A;  2G8E A;  3NHE A;  3QJ3 A;  4DMX A; 
#chains in the Genus database with same CATH topology
 1BP4 A;  1CB5 A;  1CPJ A;  3O0U A;  1NB5 A;  4PP1 A;  3ZUA A;  2FUD A;  4BQV A;  3MJ5 A;  5EZQ A;  3BOW A;  1CTE A;  3B79 A;  1F2B A;  2XU1 A;  2DCC A;  4YYQ A;  4YYU A;  1VSN A;  2FO5 A;  3C0R A;  3MTN A;  4OVZ B;  3PT2 A;  8PCH A;  3V6E A;  4CDE B;  5EF4 A;  1NQC A;  3TRK A;  4W5B A;  4N79 A;  5CVM A;  2VHF A;  1K3B B;  2PRE A;  3K24 A;  2YJ8 A;  2H7J A;  4I05 A;  2R9C A;  1SP4 B;  1YK8 A;  3HWN A;  1AU3 A;  4Q8H A;  1EWO A;  4QRX A;  1CS8 A;  2YJB A;  2DC7 A;  3H8B A;  1A6R A;  1GEC E;  1BQI A;  1PPO A;  4I04 A;  2VHS A;  2NQG A;  3E9S A;  1MDW A;  1U9W A;  2FRQ A;  2JRI A;  5CVO B;  2IPP B;  4W4U A;  3V6C A;  3RVW A;  4RY2 A;  4QH6 A;  1M6D A;  3F75 A;  1QMY A;  1YVB A;  4OEM A;  2G6D A;  5F02 A;  3IMA A;  3IEJ A;  4QRV A;  3KWZ A;  4KLB A;  2FE8 A;  2UZJ A;  4WUR A;  1PPP A;  1ME3 A;  2FQ9 A;  3N4C A;  3OQC A;  2Y6E A;  3N3K A;  1THE A;  4IUM A;  2DC6 A;  2HD5 A;  2XU4 A;  9PAP A;  3PW3 A;  1QDQ A;  3ERV A;  1U9Q X;  1U5I A;  4BS6 A;  3QT4 A;  4IP3 A;  3C9E A;  2E00 A;  3AI8 A;  3KX1 A;  4X6I A;  4XZX A;  3PDF A;  3BB7 A;  1DEU A;  3H89 A;  2FTD A;  3I3T A;  4PT5 A;  1FH0 A;  3H6S A;  3MOR A;  2JTC A;  1S4V A;  2E03 A;  2R6N A;  1CVZ A;  1ME4 A;  3HHI A;  1GMY A;  2DCA A;  3PHW A;  3PHU A;  5EGW A;  4MSX A;  3GCB A;  4A5U A;  3IOQ A;  1EF7 A;  1F2C A;  1YK7 A;  1AYU A;  1HUC B;  3TNX A;  3PSE A;  4FK5 A;  2AUX A;  3KKU A;  3M99 A;  4K7C A;  1KHQ A;  4RF1 A;  3DF0 A;  1QOL A;  4CZW A;  3LFY A;  2AGA A;  4GUA A;  1MEM A;  3IFU A;  2P86 A;  2AIM A;  2WBF X;  3S3R A;  2NQD B;  1PIP A;  1AIM A;  1CV8 A;  4AXL A;  3LXS A;  2B1M A;  2YJ2 A;  3MHS A;  1AU4 A;  2BTW A;  5J94 A;  4OW0 A;  4X6H A;  1TLO A;  3OVX A;  1CJL A;  4PI3 A;  2R9N A;  1MS6 A;  2AS8 A;  1Y08 A;  3U8E A;  1EWM A;  1AYV A;  1AYW A;  1ATK A;  4Q8G A;  3P5W A;  3IHP A;  4WA6 A;  4QBB A;  2R9F A;  1PPD A;  3IUT A;  2OP3 A;  3PRP A;  1DKI A;  3PHX A;  1ZIV A;  3H7D A;  2BDL A;  4REZ A;  4P6G A;  1YT7 A;  2HHN A;  2AUZ A;  2DJG B;  3P5U A;  4BOQ A;  2J7Q C;  1KFX L;  1VJV A;  1AU2 A;  2O6X A;  1EWP A;  4AXM A;  1ZCM A;  4P6E A;  4BOP A;  3MTV A;  3BCN A;  4X6J A;  2Z84 A;  5JA7 A;  1PPN A;  3BC3 A;  4DMY A;  3OIS A;  3CH2 X;  3E1Z B;  2E02 A;  2DCB A;  1YAL A;  2BDZ A;  4YVA A;  4CDC B;  3CBJ A;  1X9Y A;  4RNA A;  3KSE A;  1IWD A;  1KXR A;  1TU6 A;  2XU3 A;  3BBA A;  1NB3 A;  3HHA A;  2F1G A;  3WXE A;  2DZZ A;  2DJF B;  4MZO A;  4BOZ A;  3D6S A;  1ICF A;  2GFO A;  3OF9 A;  4MZS A;  4D8E A;  2P7U A;  1AEC A;  4FIP A;  3W31 A;  2Y5B A;  5K16 A;  1XKG A;  3RVV A;  3BY4 A;  1PE6 A;  4OEL A;  4MI7 A;  4M0W A;  4BPV A;  4D8I A;  3BWK A;  3K8U A;  2BU3 A;  1PXV A;  2HH5 A;  1NPZ A;  1Y4H A;  2DC8 A;  4RF0 A;  3KW9 A;  2C0Y A;  3WXF A;  3TMP A;  3MHH A;  1GCB A;  2DCD A;  1F2A A;  1SNK A;  4BS5 A;  2G7Y A;  5E6J A;  3KFQ A;  4CDF B;  1UKF A;  3MP2 A;  1MIR A;  4ZTB A;  2YJ9 A;  2PNS A;  2HXZ A;  1EWL A;  1POP A;  3N3G A;  3P5V A;  1QXP A;  2CIO A;  3H8C A;  3F5V A;  4BSQ A;  2JQF R;  3CH3 X;  4N8W A;  2AYN A;  2YJC A;  5A24 A;  2R9O A;  4CDD B;  1GLO A;  1KHP A;  7PCK A;  1NL6 A;  2PAD A;  3PRM A;  1STF E;  5PAD A;  3WXG A;  4YYV A;  2J7Q A;  4BOU A;  4ZUX U;  2PBH A;  2F7D A;  1PAD A;  3BPF A;  3I06 A;  3KWB X;  4R3D A;  1PVJ A;  4W5C A;  1PBH A;  4MM3 B;  2GHU A;  1JQP A;  3BPM A;  2CB5 A;  1MEG A;  4RKX A;  2FYE A;  4FJC A;  3K9M A;  1NLJ A;  3USV A;  1ITO A;  2ACT A;  4YV8 A;  3P5X A;  1CSB B;  3S3Q A;  3QSD A;  4OVZ A;  2OUL A;  1Q6K A;  5CHT A;  1CQD A;  3IV2 A;  4G54 A;  4N4Z A;  1U9V A;  2NQI A;  5JH3 A;  1MHW A;  1DF0 A;  1BY8 A;  4YYR A;  5EZS A;  1F29 A;  5CVN B;  1AU0 A;  2E01 A;  1PCI A;  2NQA A;  2HWK A;  3RVX A;  2ARY A;  3RNV A;  1BGO A;  2DC9 A;  3ZNH A;  5FPW A;  4D8B A;  5CHV A;  4QRG A;  4XR7 A;  2FRA A;  4HWY A;  4YYW A;  6PAD A;  2G8J A;  3PBH A;  3B21 A;  4I07 A;  1KFU L;  2DOS A;  3O1G A;  2R9M A;  1O0E A;  2IBI A;  2AVW A;  2XU5 A;  4BOS A;  2AYO A;  4PAD A;  2P0R A;  1YZB A;  3CBK A;  4XUI A;  5JZE A;  1TL9 A;  3PNR A;  2JQG R;  2AU1 A;  1U9X A;  3HD3 A;  4YYS A;  2BTW B;  4PP2 E;  3OVZ A;  3O65 A;  2ATO A;  2B1N A;  2FT2 A;  5KO3 A;  2DZY A;  2OZ2 A;  3OF8 A;  2G8E A;  4HXD B;  3NHE A;  3QJ3 A;  4DMX A;  3W30 A;  4P16 A; 
#chains in the Genus database with same CATH homology
 1BP4 A;  1CB5 A;  1CPJ A;  3O0U A;  1NB5 A;  4PP1 A;  3ZUA A;  2FUD A;  4BQV A;  3BOW A;  1CTE A;  3B79 A;  1F2B A;  2XU1 A;  2DCC A;  4YYQ A;  4YYU A;  1VSN A;  2FO5 A;  3MTN A;  8PCH A;  3V6E A;  4CDE B;  5EF4 A;  1NQC A;  1W6F A;  4W5B A;  4N79 A;  5CVM A;  2VHF A;  1K3B B;  2PRE A;  3K24 A;  2YJ8 A;  2H7J A;  4I05 A;  2R9C A;  1SP4 B;  1YK8 A;  3HWN A;  1AU3 A;  4Q8H A;  1EWO A;  1W4T A;  4QRX A;  1CS8 A;  2YJB A;  2DC7 A;  3H8B A;  1A6R A;  1GEC E;  1BQI A;  3D9W A;  1PPO A;  4I04 A;  2VHS A;  2NQG A;  1MDW A;  1U9W A;  2FRQ A;  5CVO B;  2IPP B;  4W4U A;  3V6C A;  3RVW A;  4RY2 A;  4QH6 A;  1M6D A;  3F75 A;  1QMY A;  1YVB A;  4OEM A;  2G6D A;  5F02 A;  3IMA A;  3IEJ A;  4QRV A;  3KWZ A;  4KLB A;  2VFC A;  1PPP A;  1ME3 A;  2FQ9 A;  3N4C A;  2Y6E A;  3N3K A;  1THE A;  2DC6 A;  2HD5 A;  2XU4 A;  9PAP A;  3PW3 A;  1QDQ A;  3ERV A;  1U9Q X;  1U5I A;  4BS6 A;  3QT4 A;  3C9E A;  2E00 A;  3AI8 A;  3KX1 A;  4X6I A;  3PDF A;  1DEU A;  3H89 A;  2FTD A;  3I3T A;  1FH0 A;  3H6S A;  3MOR A;  1S4V A;  2E03 A;  2R6N A;  1CVZ A;  1ME4 A;  3HHI A;  1GMY A;  2DCA A;  5EGW A;  4MSX A;  3GCB A;  3IOQ A;  1EF7 A;  1F2C A;  1YK7 A;  1AYU A;  1HUC B;  3TNX A;  4FK5 A;  2AUX A;  3KKU A;  3M99 A;  4K7C A;  1KHQ A;  3DF0 A;  1QOL A;  4CZW A;  3LFY A;  1MEM A;  2P86 A;  2AIM A;  2WBF X;  3S3R A;  2NQD B;  1PIP A;  1AIM A;  1CV8 A;  4AXL A;  3LXS A;  2B1M A;  2YJ2 A;  3MHS A;  1AU4 A;  5J94 A;  4X6H A;  1TLO A;  3OVX A;  1CJL A;  4PI3 A;  2R9N A;  1MS6 A;  2AS8 A;  1Y08 A;  3U8E A;  1EWM A;  1AYV A;  1AYW A;  4Q8G A;  1ATK A;  3P5W A;  3IHP A;  4WA6 A;  4QBB A;  2R9F A;  1PPD A;  3IUT A;  2OP3 A;  1ZIV A;  3H7D A;  2BDL A;  4P6G A;  1YT7 A;  4C5P A;  2HHN A;  2AUZ A;  2DJG B;  3P5U A;  1KFX L;  1VJV A;  1AU2 A;  2O6X A;  1EWP A;  4AXM A;  1ZCM A;  4P6E A;  3BCN A;  4X6J A;  5JA7 A;  1PPN A;  3BC3 A;  4DMY A;  4GUZ A;  3OIS A;  3CH2 X;  3E1Z B;  2E02 A;  2DCB A;  1YAL A;  2BDZ A;  4YVA A;  4CDC B;  3CBJ A;  1X9Y A;  3KSE A;  1IWD A;  1KXR A;  1TU6 A;  2XU3 A;  1NB3 A;  3HHA A;  2F1G A;  3WXE A;  2DZZ A;  2DJF B;  4MZO A;  3D6S A;  1ICF A;  2GFO A;  3OF9 A;  4MZS A;  2P7U A;  1AEC A;  4FIP A;  2Y5B A;  5K16 A;  1XKG A;  3RVV A;  1PE6 A;  4OEL A;  4BPV A;  3BWK A;  3K8U A;  1PXV A;  2HH5 A;  1NPZ A;  1Y4H A;  2DC8 A;  3KW9 A;  1GX3 A;  2C0Y A;  3WXF A;  3MHH A;  1GCB A;  2DCD A;  3LTW A;  1F2A A;  1SNK A;  4BS5 A;  4B55 A;  2G7Y A;  3KFQ A;  4CDF B;  1E2T A;  1MIR A;  2YJ9 A;  2PNS A;  2HXZ A;  1EWL A;  2VFB A;  1POP A;  3N3G A;  3P5V A;  1QXP A;  2CIO A;  3H8C A;  3F5V A;  4BSQ A;  2JQF R;  3CH3 X;  4BGF A;  4N8W A;  2AYN A;  2YJC A;  5A24 A;  2R9O A;  4CDD B;  1GLO A;  1KHP A;  7PCK A;  1NL6 A;  2PAD A;  1STF E;  5PAD A;  3WXG A;  4YYV A;  4ZUX U;  2PBH A;  2F7D A;  1PAD A;  3BPF A;  3I06 A;  3KWB X;  4W5C A;  1PBH A;  2GHU A;  1JQP A;  3BPM A;  2CB5 A;  1MEG A;  2FYE A;  4FJC A;  3K9M A;  1NLJ A;  3USV A;  1ITO A;  2ACT A;  4YV8 A;  3P5X A;  1CSB B;  3S3Q A;  3QSD A;  2OUL A;  1Q6K A;  5CHT A;  1CQD A;  3IV2 A;  4G54 A;  4N4Z A;  1U9V A;  2NQI A;  5JH3 A;  1MHW A;  1DF0 A;  1BY8 A;  2BSZ A;  4YYR A;  1F29 A;  5CVN B;  1AU0 A;  2E01 A;  1PCI A;  2NQA A;  3RVX A;  2ARY A;  1BGO A;  2DC9 A;  5FPW A;  5CHV A;  4QRG A;  4XR7 A;  2FRA A;  4HWY A;  4YYW A;  6PAD A;  2G8J A;  3PBH A;  1W5R A;  4I07 A;  1KFU L;  4NV7 A;  3O1G A;  2R9M A;  1O0E A;  2IBI A;  2AVW A;  2XU5 A;  2AYO A;  4PAD A;  2P0R A;  3CBK A;  4XUI A;  1TL9 A;  3PNR A;  2JQG R;  2AU1 A;  1U9X A;  3HD3 A;  4YYS A;  4PP2 E;  3OVZ A;  2ATO A;  2B1N A;  2FT2 A;  4NV8 A;  2DZY A;  2OZ2 A;  3OF8 A;  2G8E A;  3NHE A;  3QJ3 A;  4DMX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...