1NB5A

Crystal structure of stefin a in complex with cathepsin h
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
220
structure length
220
Chain Sequence
YPPSMDWRKKGNFVSPVKNQGSCGSCWTFSTTGALESAVAIATGKMLSLAEQQLVDCAQNFNNHGCQGGLPSQAFEYIRYNKGIMGEDTYPYKGQDDHCKFQPDKAIAFVKDVANITMNDEEAMVEAVALYNPVSFAFEVTNDFLMYRKGIYSSTSCHKTPDKVNHAVLAVGYGEENGIPYWIVKNSWGPQWGMNGYFLIERGKNMCGLAACASYPIPLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin H
publication title Crystal structure of stefin A in complex with cathepsin H: N-terminal residues of inhibitors can adapt to the active sites of endo- and exopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 55
structure length 220
sequence length 220
chains with identical sequence B, C, D
ec nomenclature ec 3.4.22.16: Cathepsin H.
pdb deposition date 2002-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1nb5A00
3ERVA 3C9EA 4MSXA 3IOQA 3D6SA 2DCDA 4P6GA 3RVXA 3B79A 2YJ2A 3N3KA 3CBJA 3K8UA 4YYQA 2E03A 3BC3A 1ITOA 5EGWA 2VHFA 1U5IA 4CDEB 2B1NA 3P5UA 2FQ9A 3CH2X 1KHQA 1CS8A 7PCKA 2HD5A 4QRXA 3P5WA 2YJCA 3GCBA 2Y5BA 3PNRA 3O0UA 3O1GA 4PI3A 1PPPA 3H89A 4WA6A 4G54A 1THEA 3H8BA 4CDCB 5A24A 2AUZA 4DMXA 3WXEA 3P5VA 1PIPA 4OELA 3HHIA 4AXLA 3IMAA 1CPJA 2R9NA 4BQVA 3H6SA 4I07A 3MORA 1SP4B 3K24A 2PNSA 4I05A 1IWDA 1DF0A 1NB5A 2NQAA 3MHSA 4QRGA 3OVZA 2FRQA 1NB3A 3M99A 1QDQA 3S3RA 2E01A 2WBFX 1S4VA 3NHEA 1ATKA 2DZYA 3P5XA 1PCIA 1F2AA 1CSBB 1AYWA 4YV8A 1U9QX 3E1ZB 2XU3A 3V6EA 1CTEA 4P6EA 4DMYA 1K3BB 9PAPA 4MZSA 1BP4A 4PADA 1M6DA 1CB5A 1AU0A 1XKGA 1AU3A 3KW9A 1TLOA 1AIMA 1EWOA 1U9XA 1YVBA 2R6NA 3BPMA 3KKUA 4X6JA 3S3QA 2P7UA 2ACTA 4Q8HA 4XR7A 1AECA 1PADA 1QMYA 1GECE 3WXFA 5CVOB 4W5BA 4Q8GA 1ZIVA 5J94A 1MDWA 2XU5A 2BDZA 2G7YA 1U9VA 3IV2A 4BS6A 2F1GA 1KHPA 1EF7A 3BPFA 2CB5A 1MIRA 2OULA 2NQDB 8PCHA 3IUTA 3USVA 1AU4A 4N4ZA 4X6HA 1HUCB 2XU1A 2E02A 1GMYA 5CVMA 3CBKA 2E00A 4CDFB 3TNXA 1POPA 3HD3A 3U8EA 4BSQA 5FPWA 4OEMA 4BS5A 1Y08A 3LFYA 4HWYA 1NLJA 2AYNA 3I3TA 3WXGA 3PBHA 4W4UA 1EWMA 3QT4A 2FT2A 3K9MA 4YYWA 1STFE 2IBIA 3OISA 2FYEA 3H7DA 1CVZA 2B1MA 4RY2A 3QSDA 4K7CA 5K16A 2PADA 1ME3A 2HH5A 1YT7A 2CIOA 4YYRA 1QXPA 1SNKA 1Q6KA 2AVWA 2HHNA 3KSEA 3BCNA 1NL6A 1NQCA 1PPNA 2FTDA 1AYUA 4N79A 1JQPA 1PPDA 3PDFA 1KFUL 5CHTA 3RVVA 1MS6A 4XUIA 5EF4A 3BOWA 1EWLA 3ZUAA 1Y4HA 2FRAA 3N4CA 2AS8A 3KWBX 3V6CA 4W5CA 4X6IA 1CQDA 2PBHA 2AUXA 3H8CA 3F5VA 4YVAA 2YJ8A 1YK7A 2Y6EA 2YJBA 3I06A 1F29A 3BWKA 2R9FA 1VJVA 2FUDA 1A6RA 2C0YA 1CJLA 1KFXL 1DEUA 4CZWA 1BY8A 2GHUA 5CHVA 1AU2A 1GLOA 4BPVA 1MEMA 1AYVA 2ARYA 2GFOA 1MHWA 2JQGR 2P86A 2H7JA 3KWZA 2XU4A 4MZOA 2DJFB 3PW3A 1QOLA 2DC9A 1X9YA 3OF9A 5JH3A 3QJ3A 4QBBA 3CH3X 1PXVA 2G6DA 2NQGA 1ICFA 1MEGA 4PP2E 2F7DA 3OF8A 2R9CA 4PP1A 2R9OA 1PBHA 1NPZA 2DCCA 2OP3A 2DJGB 1O0EA 1EWPA 4ZUXU 2AIMA 2DC8A 2VHSA 2PREA 2DCBA 3OVXA 2JQFR 1FH0A 2O6XA 3RVWA 4YYVA 1KXRA 2DZZA 2YJ9A 2R9MA 2IPPB 3F75A 3DF0A 5JA7A 4FIPA 5F02A 1BGOA 2G8EA 3HHAA 3MTNA 2DC6A 4AXMA 3KFQA 4QH6A 1TU6A 4YYSA 3IEJA 6PADA 4QRVA 4FK5A 1PPOA 1YK8A 1BQIA 1PE6A 1ME4A 2DCAA 2AYOA 4N8WA 2P0RA 2HXZA 1F2BA 4CDDB 2BDLA 4KLBA 3IHPA 3HWNA 3MHHA 2NQIA 5CVNB 2OZ2A 1VSNA 1ZCMA 4FJCA 1GCBA 4YYUA 1CV8A 3KX1A 2AU1A 4I04A 2ATOA 2FO5A 1TL9A 3AI8A 1F2CA 1U9WA 2G8JA 3LXSA 3N3GA 5PADA 1YALA 2DC7A
chains in the Genus database with same CATH superfamily
3ERVA 3C9EA 4MSXA 3IOQA 3D6SA 2DCDA 4P6GA 3RVXA 3B79A 2YJ2A 3N3KA 3CBJA 3K8UA 4YYQA 2E03A 3BC3A 1ITOA 5EGWA 2VHFA 1U5IA 4CDEB 2B1NA 3P5UA 4WURA 2FQ9A 3CH2X 1KHQA 2BU3A 1CS8A 7PCKA 2DOSA 2HD5A 3PHUA 5KO3A 4QRXA 3P5WA 2YJCA 3GCBA 2Y5BA 3PNRA 3O0UA 2J7QC 3O1GA 4PI3A 1PPPA 3H89A 4WA6A 2HWKA 4G54A 1THEA 3H8BA 4CDCB 5A24A 5JZEA 3BY4A 2AUZA 4DMXA 3WXEA 3P5VA 1PIPA 4OELA 3HHIA 4AXLA 3IMAA 1CPJA 2R9NA 4BQVA 3H6SA 4I07A 3MORA 1SP4B 3K24A 2PNSA 4MM3B 4I05A 1IWDA 1DF0A 1NB5A 2NQAA 3MHSA 4QRGA 3OVZA 2FRQA 1NB3A 3M99A 1QDQA 3S3RA 2E01A 2WBFX 1S4VA 3C0RA 3NHEA 1ATKA 2DZYA 3P5XA 1PCIA 1F2AA 1CSBB 3IFUA 1AYWA 4YV8A 1U9QX 3E1ZB 3ZNHA 2XU3A 3V6EA 1CTEA 4P6EA 4DMYA 1K3BB 9PAPA 4MZSA 1BP4A 4PADA 1M6DA 1CB5A 1AU0A 1XKGA 1AU3A 4BOUA 4RKXA 3KW9A 1TLOA 1AIMA 1EWOA 1U9XA 1YVBA 2R6NA 3BPMA 3PRPA 4OVZB 3KKUA 4X6JA 3S3QA 2P7UA 2ACTA 4Q8HA 4XR7A 1AECA 1PADA 1QMYA 1GECE 3WXFA 4R3DA 5CVOB 4W5BA 4Q8GA 1ZIVA 5J94A 1MDWA 2XU5A 2BDZA 2G7YA 1U9VA 4BOSA 3IV2A 4BS6A 2F1GA 1KHPA 1EF7A 3BPFA 2CB5A 1MIRA 3MP2A 2OULA 2NQDB 8PCHA 3IUTA 3USVA 1AU4A 4N4ZA 4X6HA 1HUCB 2XU1A 2E02A 1GMYA 5CVMA 3CBKA 2E00A 4CDFB 3TNXA 1POPA 3HD3A 3U8EA 4BSQA 5FPWA 4OEMA 4BS5A 4D8IA 1Y08A 3LFYA 4M0WA 4GUAA 4HWYA 1NLJA 5EZSA 2AGAA 2AYNA 3I3TA 3WXGA 3PBHA 4W4UA 1EWMA 3QT4A 2FT2A 3K9MA 4YYWA 1STFE 2IBIA 3OISA 2FYEA 3H7DA 1CVZA 2B1MA 4XZXA 4RY2A 3QSDA 3RNVA 2BTWB 4K7CA 5K16A 2PADA 4P16A 1ME3A 4RF0A 1UKFA 2HH5A 3O65A 1YT7A 2CIOA 4YYRA 1QXPA 1SNKA 1Q6KA 2AVWA 2HHNA 4MI7A 3KSEA 3BCNA 4RNAA 1NL6A 1NQCA 1PPNA 2FTDA 1AYUA 4N79A 1JQPA 1PPDA 3OQCA 3PDFA 1KFUL 3B21A 5CHTA 3RVVA 1MS6A 4XUIA 5EF4A 3BOWA 1EWLA 3ZUAA 1Y4HA 2FRAA 3N4CA 2AS8A 3KWBX 2FE8A 3V6CA 4W5CA 4X6IA 1CQDA 2PBHA 2AUXA 3H8CA 3F5VA 4YVAA 2YJ8A 1YK7A 2Y6EA 4PT5A 4A5UA 2YJBA 3I06A 1F29A 3PHWA 4REZA 3BBAA 3BWKA 2R9FA 1VJVA 4OW0A 2FUDA 1A6RA 1YZBA 2C0YA 2JTCA 4D8BA 1CJLA 1KFXL 1DEUA 4CZWA 1BY8A 2GHUA 5CHVA 1AU2A 4HXDB 1GLOA 4BPVA 1MEMA 1AYVA 2ARYA 2GFOA 2J7QA 3PSEA 1MHWA 2JQGR 2P86A 3BB7A 2H7JA 3KWZA 2XU4A 4MZOA 2DJFB 3PW3A 1QOLA 2DC9A 1X9YA 3OF9A 5JH3A 3QJ3A 4QBBA 1PVJA 3CH3X 1PXVA 2BTWA 2G6DA 2NQGA 1ICFA 1MEGA 4PP2E 2F7DA 3OF8A 5EZQA 2R9CA 3W31A 4PP1A 2R9OA 1PBHA 1NPZA 2DCCA 2OP3A 1DKIA 2DJGB 2JRIA 1O0EA 1EWPA 4ZUXU 2AIMA 2DC8A 2VHSA 4BOZA 2PREA 2DCBA 3OVXA 2JQFR 1FH0A 4ZTBA 2O6XA 3RVWA 4YYVA 1KXRA 4IP3A 2DZZA 2YJ9A 4BOQA 2R9MA 2IPPB 3F75A 3DF0A 5JA7A 4FIPA 5F02A 1BGOA 2G8EA 3HHAA 3MTNA 3W30A 2DC6A 4AXMA 4OVZA 3KFQA 4QH6A 1TU6A 4YYSA 3IEJA 6PADA 4QRVA 4FK5A 1PPOA 1YK8A 3MTVA 3PT2A 1BQIA 1PE6A 1ME4A 2DCAA 2AYOA 4N8WA 2P0RA 2HXZA 1F2BA 4BOPA 4CDDB 3PHXA 2BDLA 4KLBA 3IHPA 3HWNA 4D8EA 5E6JA 3MHHA 2NQIA 5CVNB 2OZ2A 1VSNA 1ZCMA 4FJCA 1GCBA 4YYUA 2Z84A 1CV8A 3KX1A 4IUMA 2AU1A 3TRKA 3MJ5A 4I04A 4RF1A 2ATOA 3E9SA 3TMPA 2FO5A 3AI8A 1TL9A 1F2CA 2UZJA 1U9WA 2G8JA 3LXSA 3N3GA 5PADA 1YALA 2DC7A 3PRMA
chains in the Genus database with same CATH topology
3ERVA 3C9EA 4MSXA 3IOQA 3D6SA 2DCDA 4P6GA 3RVXA 3B79A 2YJ2A 3N3KA 3CBJA 3K8UA 4YYQA 2E03A 3BC3A 1ITOA 4B55A 5EGWA 2VHFA 1U5IA 4CDEB 2B1NA 3P5UA 2FQ9A 3CH2X 1KHQA 1CS8A 7PCKA 2HD5A 4QRXA 3P5WA 2YJCA 3GCBA 2Y5BA 3PNRA 3O0UA 3O1GA 4PI3A 1PPPA 3H89A 4WA6A 4G54A 1THEA 3H8BA 4CDCB 5A24A 2AUZA 4DMXA 3WXEA 3P5VA 1PIPA 4NV8A 4OELA 3HHIA 4AXLA 1E2TA 3IMAA 1CPJA 2R9NA 4BQVA 3H6SA 4I07A 3MORA 1SP4B 3K24A 2PNSA 4I05A 1IWDA 1DF0A 1NB5A 2NQAA 3MHSA 4QRGA 3OVZA 2FRQA 1NB3A 3M99A 1QDQA 3S3RA 2E01A 2WBFX 1S4VA 3NHEA 1ATKA 2DZYA 3P5XA 1PCIA 1F2AA 1CSBB 1AYWA 4YV8A 1U9QX 3E1ZB 4BGFA 2XU3A 3V6EA 1CTEA 4P6EA 4DMYA 1K3BB 9PAPA 4MZSA 1BP4A 4PADA 1M6DA 1CB5A 1AU0A 1XKGA 1AU3A 3KW9A 1TLOA 1AIMA 1EWOA 1U9XA 1YVBA 2R6NA 3BPMA 3KKUA 4X6JA 3S3QA 2P7UA 2ACTA 4Q8HA 4XR7A 1AECA 1PADA 1QMYA 1GECE 3WXFA 5CVOB 4W5BA 4Q8GA 1ZIVA 5J94A 1MDWA 2XU5A 2BDZA 2G7YA 1U9VA 3IV2A 4BS6A 4GUZA 2F1GA 1KHPA 1EF7A 3BPFA 2CB5A 1MIRA 2OULA 2NQDB 8PCHA 3IUTA 3USVA 1AU4A 4N4ZA 4C5PA 4X6HA 1HUCB 2XU1A 2E02A 1GMYA 5CVMA 3CBKA 2E00A 4CDFB 3TNXA 1POPA 3HD3A 3U8EA 4BSQA 5FPWA 4OEMA 4BS5A 1Y08A 3LFYA 4HWYA 1NLJA 2AYNA 3I3TA 3WXGA 3PBHA 4W4UA 1EWMA 3QT4A 2FT2A 3K9MA 4YYWA 1STFE 2IBIA 3OISA 2FYEA 3H7DA 1CVZA 2B1MA 4RY2A 3QSDA 4K7CA 5K16A 2PADA 1ME3A 1W5RA 2HH5A 1YT7A 2CIOA 4YYRA 1QXPA 1SNKA 1Q6KA 2AVWA 2HHNA 3KSEA 3BCNA 1NL6A 1NQCA 1PPNA 2FTDA 1AYUA 4N79A 1JQPA 1PPDA 3PDFA 1KFUL 1W4TA 5CHTA 3RVVA 1MS6A 4XUIA 5EF4A 3BOWA 1EWLA 3ZUAA 1Y4HA 2FRAA 3N4CA 2AS8A 3KWBX 3V6CA 4W5CA 4X6IA 1CQDA 2PBHA 2AUXA 3H8CA 3F5VA 4YVAA 2YJ8A 1YK7A 2Y6EA 2YJBA 3I06A 1F29A 3BWKA 2R9FA 1VJVA 2FUDA 1A6RA 2C0YA 1CJLA 1KFXL 1DEUA 4CZWA 1BY8A 2GHUA 5CHVA 1AU2A 1GLOA 4BPVA 1MEMA 1AYVA 2ARYA 2GFOA 1MHWA 2JQGR 2P86A 2H7JA 3KWZA 2XU4A 4MZOA 2DJFB 3PW3A 1QOLA 2DC9A 1X9YA 3OF9A 5JH3A 3QJ3A 4QBBA 3CH3X 1PXVA 2G6DA 2NQGA 1ICFA 1MEGA 4PP2E 2F7DA 3OF8A 2R9CA 4PP1A 2R9OA 1PBHA 1NPZA 2DCCA 2OP3A 2DJGB 1O0EA 1EWPA 4ZUXU 2AIMA 2DC8A 2VHSA 1W6FA 2PREA 2DCBA 3OVXA 2JQFR 1FH0A 2O6XA 3RVWA 4YYVA 1KXRA 2DZZA 2YJ9A 2R9MA 2IPPB 2VFCA 3F75A 3DF0A 5JA7A 4FIPA 5F02A 1BGOA 2G8EA 3HHAA 3MTNA 2DC6A 4AXMA 3KFQA 4QH6A 1TU6A 4YYSA 3IEJA 6PADA 4QRVA 4FK5A 1PPOA 1YK8A 1BQIA 1PE6A 1ME4A 2DCAA 2AYOA 4N8WA 2P0RA 2HXZA 1F2BA 4CDDB 2BDLA 4KLBA 3IHPA 3HWNA 3MHHA 2NQIA 5CVNB 2OZ2A 1VSNA 1ZCMA 4FJCA 1GCBA 4NV7A 2VFBA 4YYUA 1CV8A 3KX1A 2AU1A 4I04A 3LTWA 2ATOA 1GX3A 2FO5A 3D9WA 1TL9A 3AI8A 1F2CA 1U9WA 2G8JA 3LXSA 3N3GA 2BSZA 5PADA 1YALA 2DC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ERV A;  3C9E A;  4MSX A;  3IOQ A;  3D6S A;  2DCD A;  4P6G A;  3RVX A;  3B79 A;  2YJ2 A;  3N3K A;  3CBJ A;  3K8U A;  4YYQ A;  2E03 A;  3BC3 A;  1ITO A;  5EGW A;  2VHF A;  1U5I A;  4CDE B;  2B1N A;  3P5U A;  2FQ9 A;  3CH2 X;  1KHQ A;  1CS8 A;  7PCK A;  2HD5 A;  4QRX A;  3P5W A;  2YJC A;  3GCB A;  2Y5B A;  3PNR A;  3O0U A;  3O1G A;  4PI3 A;  1PPP A;  3H89 A;  4WA6 A;  4G54 A;  1THE A;  3H8B A;  4CDC B;  5A24 A;  2AUZ A;  4DMX A;  3WXE A;  3P5V A;  1PIP A;  4OEL A;  3HHI A;  4AXL A;  3IMA A;  1CPJ A;  2R9N A;  4BQV A;  3H6S A;  4I07 A;  3MOR A;  1SP4 B;  3K24 A;  2PNS A;  4I05 A;  1IWD A;  1DF0 A;  1NB5 A;  2NQA A;  3MHS A;  4QRG A;  3OVZ A;  2FRQ A;  1NB3 A;  3M99 A;  1QDQ A;  3S3R A;  2E01 A;  2WBF X;  1S4V A;  3NHE A;  1ATK A;  2DZY A;  3P5X A;  1PCI A;  1F2A A;  1CSB B;  1AYW A;  4YV8 A;  1U9Q X;  3E1Z B;  2XU3 A;  3V6E A;  1CTE A;  4P6E A;  4DMY A;  1K3B B;  9PAP A;  4MZS A;  1BP4 A;  4PAD A;  1M6D A;  1CB5 A;  1AU0 A;  1XKG A;  1AU3 A;  3KW9 A;  1TLO A;  1AIM A;  1EWO A;  1U9X A;  1YVB A;  2R6N A;  3BPM A;  3KKU A;  4X6J A;  3S3Q A;  2P7U A;  2ACT A;  4Q8H A;  4XR7 A;  1AEC A;  1PAD A;  1QMY A;  1GEC E;  3WXF A;  5CVO B;  4W5B A;  4Q8G A;  1ZIV A;  5J94 A;  1MDW A;  2XU5 A;  2BDZ A;  2G7Y A;  1U9V A;  3IV2 A;  4BS6 A;  2F1G A;  1KHP A;  1EF7 A;  3BPF A;  2CB5 A;  1MIR A;  2OUL A;  2NQD B;  8PCH A;  3IUT A;  3USV A;  1AU4 A;  4N4Z A;  4X6H A;  1HUC B;  2XU1 A;  2E02 A;  1GMY A;  5CVM A;  3CBK A;  2E00 A;  4CDF B;  3TNX A;  1POP A;  3HD3 A;  3U8E A;  4BSQ A;  5FPW A;  4OEM A;  4BS5 A;  1Y08 A;  3LFY A;  4HWY A;  1NLJ A;  2AYN A;  3I3T A;  3WXG A;  3PBH A;  4W4U A;  1EWM A;  3QT4 A;  2FT2 A;  3K9M A;  4YYW A;  1STF E;  2IBI A;  3OIS A;  2FYE A;  3H7D A;  1CVZ A;  2B1M A;  4RY2 A;  3QSD A;  4K7C A;  5K16 A;  2PAD A;  1ME3 A;  2HH5 A;  1YT7 A;  2CIO A;  4YYR A;  1QXP A;  1SNK A;  1Q6K A;  2AVW A;  2HHN A;  3KSE A;  3BCN A;  1NL6 A;  1NQC A;  1PPN A;  2FTD A;  1AYU A;  4N79 A;  1JQP A;  1PPD A;  3PDF A;  1KFU L;  5CHT A;  3RVV A;  1MS6 A;  4XUI A;  5EF4 A;  3BOW A;  1EWL A;  3ZUA A;  1Y4H A;  2FRA A;  3N4C A;  2AS8 A;  3KWB X;  3V6C A;  4W5C A;  4X6I A;  1CQD A;  2PBH A;  2AUX A;  3H8C A;  3F5V A;  4YVA A;  2YJ8 A;  1YK7 A;  2Y6E A;  2YJB A;  3I06 A;  1F29 A;  3BWK A;  2R9F A;  1VJV A;  2FUD A;  1A6R A;  2C0Y A;  1CJL A;  1KFX L;  1DEU A;  4CZW A;  1BY8 A;  2GHU A;  5CHV A;  1AU2 A;  1GLO A;  4BPV A;  1MEM A;  1AYV A;  2ARY A;  2GFO A;  1MHW A;  2JQG R;  2P86 A;  2H7J A;  3KWZ A;  2XU4 A;  4MZO A;  2DJF B;  3PW3 A;  1QOL A;  2DC9 A;  1X9Y A;  3OF9 A;  5JH3 A;  3QJ3 A;  4QBB A;  3CH3 X;  1PXV A;  2G6D A;  2NQG A;  1ICF A;  1MEG A;  4PP2 E;  2F7D A;  3OF8 A;  2R9C A;  4PP1 A;  2R9O A;  1PBH A;  1NPZ A;  2DCC A;  2OP3 A;  2DJG B;  1O0E A;  1EWP A;  4ZUX U;  2AIM A;  2DC8 A;  2VHS A;  2PRE A;  2DCB A;  3OVX A;  2JQF R;  1FH0 A;  2O6X A;  3RVW A;  4YYV A;  1KXR A;  2DZZ A;  2YJ9 A;  2R9M A;  2IPP B;  3F75 A;  3DF0 A;  5JA7 A;  4FIP A;  5F02 A;  1BGO A;  2G8E A;  3HHA A;  3MTN A;  2DC6 A;  4AXM A;  3KFQ A;  4QH6 A;  1TU6 A;  4YYS A;  3IEJ A;  6PAD A;  4QRV A;  4FK5 A;  1PPO A;  1YK8 A;  1BQI A;  1PE6 A;  1ME4 A;  2DCA A;  2AYO A;  4N8W A;  2P0R A;  2HXZ A;  1F2B A;  4CDD B;  2BDL A;  4KLB A;  3IHP A;  3HWN A;  3MHH A;  2NQI A;  5CVN B;  2OZ2 A;  1VSN A;  1ZCM A;  4FJC A;  1GCB A;  4YYU A;  1CV8 A;  3KX1 A;  2AU1 A;  4I04 A;  2ATO A;  2FO5 A;  1TL9 A;  3AI8 A;  1F2C A;  1U9W A;  2G8J A;  3LXS A;  3N3G A;  5PAD A;  1YAL A;  2DC7 A; 
#chains in the Genus database with same CATH topology
 3ERV A;  3C9E A;  4MSX A;  3IOQ A;  3D6S A;  2DCD A;  4P6G A;  3RVX A;  3B79 A;  2YJ2 A;  3N3K A;  3CBJ A;  3K8U A;  4YYQ A;  2E03 A;  3BC3 A;  1ITO A;  5EGW A;  2VHF A;  1U5I A;  4CDE B;  2B1N A;  3P5U A;  4WUR A;  2FQ9 A;  3CH2 X;  1KHQ A;  2BU3 A;  1CS8 A;  7PCK A;  2DOS A;  2HD5 A;  3PHU A;  5KO3 A;  4QRX A;  3P5W A;  2YJC A;  3GCB A;  2Y5B A;  3PNR A;  3O0U A;  2J7Q C;  3O1G A;  4PI3 A;  1PPP A;  3H89 A;  4WA6 A;  2HWK A;  4G54 A;  1THE A;  3H8B A;  4CDC B;  5A24 A;  5JZE A;  3BY4 A;  2AUZ A;  4DMX A;  3WXE A;  3P5V A;  1PIP A;  4OEL A;  3HHI A;  4AXL A;  3IMA A;  1CPJ A;  2R9N A;  4BQV A;  3H6S A;  4I07 A;  3MOR A;  1SP4 B;  3K24 A;  2PNS A;  4MM3 B;  4I05 A;  1IWD A;  1DF0 A;  1NB5 A;  2NQA A;  3MHS A;  4QRG A;  3OVZ A;  2FRQ A;  1NB3 A;  3M99 A;  1QDQ A;  3S3R A;  2E01 A;  2WBF X;  1S4V A;  3C0R A;  3NHE A;  1ATK A;  2DZY A;  3P5X A;  1PCI A;  1F2A A;  1CSB B;  3IFU A;  1AYW A;  4YV8 A;  1U9Q X;  3E1Z B;  3ZNH A;  2XU3 A;  3V6E A;  1CTE A;  4P6E A;  4DMY A;  1K3B B;  9PAP A;  4MZS A;  1BP4 A;  4PAD A;  1M6D A;  1CB5 A;  1AU0 A;  1XKG A;  1AU3 A;  4BOU A;  4RKX A;  3KW9 A;  1TLO A;  1AIM A;  1EWO A;  1U9X A;  1YVB A;  2R6N A;  3BPM A;  3PRP A;  4OVZ B;  3KKU A;  4X6J A;  3S3Q A;  2P7U A;  2ACT A;  4Q8H A;  4XR7 A;  1AEC A;  1PAD A;  1QMY A;  1GEC E;  3WXF A;  4R3D A;  5CVO B;  4W5B A;  4Q8G A;  1ZIV A;  5J94 A;  1MDW A;  2XU5 A;  2BDZ A;  2G7Y A;  1U9V A;  4BOS A;  3IV2 A;  4BS6 A;  2F1G A;  1KHP A;  1EF7 A;  3BPF A;  2CB5 A;  1MIR A;  3MP2 A;  2OUL A;  2NQD B;  8PCH A;  3IUT A;  3USV A;  1AU4 A;  4N4Z A;  4X6H A;  1HUC B;  2XU1 A;  2E02 A;  1GMY A;  5CVM A;  3CBK A;  2E00 A;  4CDF B;  3TNX A;  1POP A;  3HD3 A;  3U8E A;  4BSQ A;  5FPW A;  4OEM A;  4BS5 A;  4D8I A;  1Y08 A;  3LFY A;  4M0W A;  4GUA A;  4HWY A;  1NLJ A;  5EZS A;  2AGA A;  2AYN A;  3I3T A;  3WXG A;  3PBH A;  4W4U A;  1EWM A;  3QT4 A;  2FT2 A;  3K9M A;  4YYW A;  1STF E;  2IBI A;  3OIS A;  2FYE A;  3H7D A;  1CVZ A;  2B1M A;  4XZX A;  4RY2 A;  3QSD A;  3RNV A;  2BTW B;  4K7C A;  5K16 A;  2PAD A;  4P16 A;  1ME3 A;  4RF0 A;  1UKF A;  2HH5 A;  3O65 A;  1YT7 A;  2CIO A;  4YYR A;  1QXP A;  1SNK A;  1Q6K A;  2AVW A;  2HHN A;  4MI7 A;  3KSE A;  3BCN A;  4RNA A;  1NL6 A;  1NQC A;  1PPN A;  2FTD A;  1AYU A;  4N79 A;  1JQP A;  1PPD A;  3OQC A;  3PDF A;  1KFU L;  3B21 A;  5CHT A;  3RVV A;  1MS6 A;  4XUI A;  5EF4 A;  3BOW A;  1EWL A;  3ZUA A;  1Y4H A;  2FRA A;  3N4C A;  2AS8 A;  3KWB X;  2FE8 A;  3V6C A;  4W5C A;  4X6I A;  1CQD A;  2PBH A;  2AUX A;  3H8C A;  3F5V A;  4YVA A;  2YJ8 A;  1YK7 A;  2Y6E A;  4PT5 A;  4A5U A;  2YJB A;  3I06 A;  1F29 A;  3PHW A;  4REZ A;  3BBA A;  3BWK A;  2R9F A;  1VJV A;  4OW0 A;  2FUD A;  1A6R A;  1YZB A;  2C0Y A;  2JTC A;  4D8B A;  1CJL A;  1KFX L;  1DEU A;  4CZW A;  1BY8 A;  2GHU A;  5CHV A;  1AU2 A;  4HXD B;  1GLO A;  4BPV A;  1MEM A;  1AYV A;  2ARY A;  2GFO A;  2J7Q A;  3PSE A;  1MHW A;  2JQG R;  2P86 A;  3BB7 A;  2H7J A;  3KWZ A;  2XU4 A;  4MZO A;  2DJF B;  3PW3 A;  1QOL A;  2DC9 A;  1X9Y A;  3OF9 A;  5JH3 A;  3QJ3 A;  4QBB A;  1PVJ A;  3CH3 X;  1PXV A;  2BTW A;  2G6D A;  2NQG A;  1ICF A;  1MEG A;  4PP2 E;  2F7D A;  3OF8 A;  5EZQ A;  2R9C A;  3W31 A;  4PP1 A;  2R9O A;  1PBH A;  1NPZ A;  2DCC A;  2OP3 A;  1DKI A;  2DJG B;  2JRI A;  1O0E A;  1EWP A;  4ZUX U;  2AIM A;  2DC8 A;  2VHS A;  4BOZ A;  2PRE A;  2DCB A;  3OVX A;  2JQF R;  1FH0 A;  4ZTB A;  2O6X A;  3RVW A;  4YYV A;  1KXR A;  4IP3 A;  2DZZ A;  2YJ9 A;  4BOQ A;  2R9M A;  2IPP B;  3F75 A;  3DF0 A;  5JA7 A;  4FIP A;  5F02 A;  1BGO A;  2G8E A;  3HHA A;  3MTN A;  3W30 A;  2DC6 A;  4AXM A;  4OVZ A;  3KFQ A;  4QH6 A;  1TU6 A;  4YYS A;  3IEJ A;  6PAD A;  4QRV A;  4FK5 A;  1PPO A;  1YK8 A;  3MTV A;  3PT2 A;  1BQI A;  1PE6 A;  1ME4 A;  2DCA A;  2AYO A;  4N8W A;  2P0R A;  2HXZ A;  1F2B A;  4BOP A;  4CDD B;  3PHX A;  2BDL A;  4KLB A;  3IHP A;  3HWN A;  4D8E A;  5E6J A;  3MHH A;  2NQI A;  5CVN B;  2OZ2 A;  1VSN A;  1ZCM A;  4FJC A;  1GCB A;  4YYU A;  2Z84 A;  1CV8 A;  3KX1 A;  4IUM A;  2AU1 A;  3TRK A;  3MJ5 A;  4I04 A;  4RF1 A;  2ATO A;  3E9S A;  3TMP A;  2FO5 A;  3AI8 A;  1TL9 A;  1F2C A;  2UZJ A;  1U9W A;  2G8J A;  3LXS A;  3N3G A;  5PAD A;  1YAL A;  2DC7 A;  3PRM A; 
#chains in the Genus database with same CATH homology
 3ERV A;  3C9E A;  4MSX A;  3IOQ A;  3D6S A;  2DCD A;  4P6G A;  3RVX A;  3B79 A;  2YJ2 A;  3N3K A;  3CBJ A;  3K8U A;  4YYQ A;  2E03 A;  3BC3 A;  1ITO A;  4B55 A;  5EGW A;  2VHF A;  1U5I A;  4CDE B;  2B1N A;  3P5U A;  2FQ9 A;  3CH2 X;  1KHQ A;  1CS8 A;  7PCK A;  2HD5 A;  4QRX A;  3P5W A;  2YJC A;  3GCB A;  2Y5B A;  3PNR A;  3O0U A;  3O1G A;  4PI3 A;  1PPP A;  3H89 A;  4WA6 A;  4G54 A;  1THE A;  3H8B A;  4CDC B;  5A24 A;  2AUZ A;  4DMX A;  3WXE A;  3P5V A;  1PIP A;  4NV8 A;  4OEL A;  3HHI A;  4AXL A;  1E2T A;  3IMA A;  1CPJ A;  2R9N A;  4BQV A;  3H6S A;  4I07 A;  3MOR A;  1SP4 B;  3K24 A;  2PNS A;  4I05 A;  1IWD A;  1DF0 A;  1NB5 A;  2NQA A;  3MHS A;  4QRG A;  3OVZ A;  2FRQ A;  1NB3 A;  3M99 A;  1QDQ A;  3S3R A;  2E01 A;  2WBF X;  1S4V A;  3NHE A;  1ATK A;  2DZY A;  3P5X A;  1PCI A;  1F2A A;  1CSB B;  1AYW A;  4YV8 A;  1U9Q X;  3E1Z B;  4BGF A;  2XU3 A;  3V6E A;  1CTE A;  4P6E A;  4DMY A;  1K3B B;  9PAP A;  4MZS A;  1BP4 A;  4PAD A;  1M6D A;  1CB5 A;  1AU0 A;  1XKG A;  1AU3 A;  3KW9 A;  1TLO A;  1AIM A;  1EWO A;  1U9X A;  1YVB A;  2R6N A;  3BPM A;  3KKU A;  4X6J A;  3S3Q A;  2P7U A;  2ACT A;  4Q8H A;  4XR7 A;  1AEC A;  1PAD A;  1QMY A;  1GEC E;  3WXF A;  5CVO B;  4W5B A;  4Q8G A;  1ZIV A;  5J94 A;  1MDW A;  2XU5 A;  2BDZ A;  2G7Y A;  1U9V A;  3IV2 A;  4BS6 A;  4GUZ A;  2F1G A;  1KHP A;  1EF7 A;  3BPF A;  2CB5 A;  1MIR A;  2OUL A;  2NQD B;  8PCH A;  3IUT A;  3USV A;  1AU4 A;  4N4Z A;  4C5P A;  4X6H A;  1HUC B;  2XU1 A;  2E02 A;  1GMY A;  5CVM A;  3CBK A;  2E00 A;  4CDF B;  3TNX A;  1POP A;  3HD3 A;  3U8E A;  4BSQ A;  5FPW A;  4OEM A;  4BS5 A;  1Y08 A;  3LFY A;  4HWY A;  1NLJ A;  2AYN A;  3I3T A;  3WXG A;  3PBH A;  4W4U A;  1EWM A;  3QT4 A;  2FT2 A;  3K9M A;  4YYW A;  1STF E;  2IBI A;  3OIS A;  2FYE A;  3H7D A;  1CVZ A;  2B1M A;  4RY2 A;  3QSD A;  4K7C A;  5K16 A;  2PAD A;  1ME3 A;  1W5R A;  2HH5 A;  1YT7 A;  2CIO A;  4YYR A;  1QXP A;  1SNK A;  1Q6K A;  2AVW A;  2HHN A;  3KSE A;  3BCN A;  1NL6 A;  1NQC A;  1PPN A;  2FTD A;  1AYU A;  4N79 A;  1JQP A;  1PPD A;  3PDF A;  1KFU L;  1W4T A;  5CHT A;  3RVV A;  1MS6 A;  4XUI A;  5EF4 A;  3BOW A;  1EWL A;  3ZUA A;  1Y4H A;  2FRA A;  3N4C A;  2AS8 A;  3KWB X;  3V6C A;  4W5C A;  4X6I A;  1CQD A;  2PBH A;  2AUX A;  3H8C A;  3F5V A;  4YVA A;  2YJ8 A;  1YK7 A;  2Y6E A;  2YJB A;  3I06 A;  1F29 A;  3BWK A;  2R9F A;  1VJV A;  2FUD A;  1A6R A;  2C0Y A;  1CJL A;  1KFX L;  1DEU A;  4CZW A;  1BY8 A;  2GHU A;  5CHV A;  1AU2 A;  1GLO A;  4BPV A;  1MEM A;  1AYV A;  2ARY A;  2GFO A;  1MHW A;  2JQG R;  2P86 A;  2H7J A;  3KWZ A;  2XU4 A;  4MZO A;  2DJF B;  3PW3 A;  1QOL A;  2DC9 A;  1X9Y A;  3OF9 A;  5JH3 A;  3QJ3 A;  4QBB A;  3CH3 X;  1PXV A;  2G6D A;  2NQG A;  1ICF A;  1MEG A;  4PP2 E;  2F7D A;  3OF8 A;  2R9C A;  4PP1 A;  2R9O A;  1PBH A;  1NPZ A;  2DCC A;  2OP3 A;  2DJG B;  1O0E A;  1EWP A;  4ZUX U;  2AIM A;  2DC8 A;  2VHS A;  1W6F A;  2PRE A;  2DCB A;  3OVX A;  2JQF R;  1FH0 A;  2O6X A;  3RVW A;  4YYV A;  1KXR A;  2DZZ A;  2YJ9 A;  2R9M A;  2IPP B;  2VFC A;  3F75 A;  3DF0 A;  5JA7 A;  4FIP A;  5F02 A;  1BGO A;  2G8E A;  3HHA A;  3MTN A;  2DC6 A;  4AXM A;  3KFQ A;  4QH6 A;  1TU6 A;  4YYS A;  3IEJ A;  6PAD A;  4QRV A;  4FK5 A;  1PPO A;  1YK8 A;  1BQI A;  1PE6 A;  1ME4 A;  2DCA A;  2AYO A;  4N8W A;  2P0R A;  2HXZ A;  1F2B A;  4CDD B;  2BDL A;  4KLB A;  3IHP A;  3HWN A;  3MHH A;  2NQI A;  5CVN B;  2OZ2 A;  1VSN A;  1ZCM A;  4FJC A;  1GCB A;  4NV7 A;  2VFB A;  4YYU A;  1CV8 A;  3KX1 A;  2AU1 A;  4I04 A;  3LTW A;  2ATO A;  1GX3 A;  2FO5 A;  3D9W A;  1TL9 A;  3AI8 A;  1F2C A;  1U9W A;  2G8J A;  3LXS A;  3N3G A;  2BSZ A;  5PAD A;  1YAL A;  2DC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...