1NB5A

Crystal structure of stefin a in complex with cathepsin h
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
220
structure length
220
Chain Sequence
b'YPPSMDWRKKGNFVSPVKNQGSCGSCWTFSTTGALESAVAIATGKMLSLAEQQLVDCAQNFNNHGCQGGLPSQAFEYIRYNKGIMGEDTYPYKGQDDHCKFQPDKAIAFVKDVANITMNDEEAMVEAVALYNPVSFAFEVTNDFLMYRKGIYSSTSCHKTPDKVNHAVLAVGYGEENGIPYWIVKNSWGPQWGMNGYFLIERGKNMCGLAACASYPIPLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin H
publication title Crystal structure of stefin A in complex with cathepsin H: N-terminal residues of inhibitors can adapt to the active sites of endo- and exopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 55
structure length 220
sequence length 220
chains with identical sequence B, C, D
ec nomenclature ec 3.4.22.16: Cathepsin H.
pdb deposition date 2002-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1nb5A00
1MEMA 2E01A 1NL6A 2BDZA 2R9MA 3PNRA 3S3QA 3B79A 3AI8A 1U9VA 2XU4A 3QT4A 4OEMA 1F29A 5CHVA 4BQVA 1A6RA 1CJLA 1QOLA 5CVNB 4W5BA 2G8JA 1EWMA 4N8WA 2AVWA 4P6GA 1GCBA 1Y08A 2XU5A 1Q6KA 2DC8A 3DF0A 1PBHA 3KWBX 3HHIA 2DCDA 2G8EA 3LFYA 1ICFA 2O6XA 1VJVA 2DC9A 4I07A 5CVOB 3BPMA 1GLOA 1TLOA 4W5CA 3OISA 2E03A 2DZYA 1YVBA 2VHFA 3H8BA 1AU3A 5FPWA 2IPPB 5CHTA 1GECE 3D6SA 1AU0A 2AS8A 4FJCA 1GMYA 1AU2A 2P0RA 1MS6A 4P6EA 4CDCB 2PBHA 4DMYA 1ZIVA 2PREA 2NQAA 1PPOA 3NHEA 1U9QX 4OELA 3F5VA 4X6IA 1SP4B 1Y4HA 3I06A 2ARYA 2AUXA 1PIPA 2PNSA 1CB5A 1NQCA 2C0YA 3I3TA 3N3GA 1U5IA 3ERVA 2FQ9A 2CB5A 3OVXA 2AUZA 1PXVA 2GFOA 2OULA 1QXPA 2R9FA 1AECA 3RVWA 1BGOA 1YK8A 2AIMA 2JQFR 4RY2A 4KLBA 2AYOA 3BPFA 3CBKA 3USVA 4MZSA 4G54A 4YYVA 3HWNA 4YYRA 3MHHA 1DF0A 2E02A 3IUTA 3PBHA 1CTEA 1MIRA 3KFQA 3WXEA 1O0EA 1KXRA 8PCHA 2YJ8A 2DCBA 3IOQA 3P5UA 2NQGA 3K9MA 4Q8HA 3RVVA 2G6DA 2CIOA 3TNXA 4AXMA 2DCCA 2HH5A 2YJ2A 4PP1A 2HXZA 2R9CA 1U9WA 1YALA 4X6JA 1XKGA 2XU1A 3H6SA 4WA6A 1NB3A 3CH3X 3KWZA 4CZWA 3HHAA 1TL9A 3IEJA 3M99A 2ACTA 2DC6A 1PCIA 2NQDB 3IV2A 1NB5A 3H8CA 4FIPA 1FH0A 1STFE 2ATOA 1MEGA 1EF7A 1BP4A 2OP3A 3OF9A 2DJFB 2FRAA 3KX1A 1CQDA 2F7DA 1CSBB 3OF8A 4N79A 1KFXL 3N4CA 3QSDA 4W4UA 4YVAA 2E00A 1EWPA 1DEUA 4PADA 7PCKA 1YT7A 4MSXA 2YJBA 1KFUL 3U8EA 4ZUXU 4N4ZA 4QRXA 2B1NA 2FUDA 2HHNA 3KKUA 1ITOA 2XU3A 3CH2X 2H7JA 2JQGR 2YJCA 3PDFA 2FYEA 1POPA 1KHQA 1NLJA 3MHSA 2DC7A 9PAPA 4MZOA 4CDDB 3IMAA 3P5XA 1AU4A 4PI3A 4XUIA 5JA7A 1AYVA 2B1MA 2NQIA 2P7UA 1AYWA 2G7YA 3RVXA 1AIMA 2YJ9A 3V6CA 3HD3A 3V6EA 1BQIA 3OVZA 4Q8GA 3QJ3A 1HUCB 3MTNA 5EF4A 1F2CA 4YYUA 3E1ZB 1CS8A 1KHPA 5JH3A 3K24A 3O1GA 3N3KA 1VSNA 5K16A 1K3BB 2Y5BA 3KW9A 1BY8A 4PP2E 1ZCMA 2OZ2A 4YYWA 2FRQA 4X6HA 4YYQA 2HD5A 2GHUA 3CBJA 4XR7A 2FO5A 4BS6A 5A24A 1IWDA 1YK7A 4BPVA 2Y6EA 3BC3A 1TU6A 1M6DA 3O0UA 3S3RA 4AXLA 2AU1A 4K7CA 4QRGA 2R9NA 1SNKA 3C9EA 2DZZA 3ZUAA 3P5VA 1MDWA 2FTDA 1S4VA 1U9XA 1PE6A 3H7DA 2DJGB 1ATKA 1QDQA 1CVZA 3P5WA 4I04A 2DCAA 6PADA 1ME3A 5CVMA 1PPPA 3BWKA 2AYNA 3WXGA 3BOWA 2P86A 3WXFA 4YYSA 3F75A 1ME4A 3KSEA 4HWYA 2R6NA 1EWOA 3LXSA 4DMXA 2F1GA 5EGWA 3K8UA 4I05A 2PADA 3IHPA 2BDLA 4FK5A 1AYUA 1CPJA 3H89A 1PPNA 1NPZA 3BCNA 4BSQA 1JQPA 4CDFB 5F02A 4QBBA 1THEA 3MORA 3PW3A 4QRVA 5PADA 1EWLA 4YV8A 4QH6A 1PPDA 4CDEB 2IBIA 1QMYA 1F2AA 2R9OA 1X9YA 3GCBA 2VHSA 5J94A 1PADA 2FT2A 1CV8A 4BS5A 1MHWA 2WBFX 1F2BA
chains in the Genus database with same CATH superfamily
1MEMA 2E01A 1NL6A 2BDZA 2R9MA 3PNRA 3S3QA 3B79A 3AI8A 1U9VA 2XU4A 3QT4A 4OEMA 5KO3A 1F29A 5CHVA 4BQVA 1A6RA 1CJLA 1QOLA 3PHUA 5CVNB 4W5BA 2G8JA 1EWMA 4N8WA 2AVWA 4P6GA 1GCBA 1Y08A 2XU5A 1Q6KA 2J7QC 2DC8A 3DF0A 1PBHA 3KWBX 4MI7A 3HHIA 2DCDA 2G8EA 3LFYA 5EZQA 3IFUA 1ICFA 2O6XA 1VJVA 2DC9A 4I07A 5CVOB 3BPMA 1GLOA 1TLOA 4W5CA 3OISA 2E03A 3TRKA 2DZYA 1YVBA 2VHFA 3H8BA 1AU3A 5FPWA 2IPPB 5CHTA 1GECE 3D6SA 1AU0A 2AS8A 4FJCA 1GMYA 4OVZB 1AU2A 2P0RA 4BOZA 1MS6A 4P6EA 4CDCB 2PBHA 4DMYA 1ZIVA 2PREA 2NQAA 1PPOA 4A5UA 3W31A 3PHXA 3NHEA 1U9QX 4OELA 3F5VA 4X6IA 1SP4B 1Y4HA 3I06A 2ARYA 2AUXA 1PIPA 3PSEA 2PNSA 1CB5A 1NQCA 2C0YA 3I3TA 3N3GA 1U5IA 4BOQA 3ERVA 2FQ9A 2CB5A 3OVXA 2AUZA 1PXVA 2GFOA 2OULA 1QXPA 2R9FA 1AECA 3RVWA 1BGOA 1YK8A 2AIMA 2JQFR 4RY2A 4KLBA 2AYOA 3PT2A 3BPFA 3CBKA 3USVA 4MZSA 4G54A 4YYVA 3HWNA 4YYRA 3MTVA 3MHHA 1DF0A 2E02A 3IUTA 3PBHA 1CTEA 1MIRA 3RNVA 3KFQA 3WXEA 1O0EA 1KXRA 8PCHA 2YJ8A 2DCBA 3IOQA 3P5UA 2NQGA 3K9MA 4Q8HA 3RVVA 2G6DA 2CIOA 3TNXA 4AXMA 2DCCA 2HH5A 4OVZA 2YJ2A 4PP1A 3B21A 2HXZA 2R9CA 1U9WA 4R3DA 4IP3A 1YALA 4X6JA 1XKGA 2XU1A 3H6SA 4WA6A 1NB3A 3CH3X 4OW0A 2JRIA 3KWZA 4CZWA 2BU3A 3HHAA 1TL9A 3IEJA 3M99A 2ACTA 2DC6A 1PCIA 2NQDB 3IV2A 1NB5A 3H8CA 4FIPA 1FH0A 1STFE 2ATOA 2HWKA 1MEGA 1EF7A 1BP4A 2OP3A 3OF9A 2DJFB 2FRAA 3KX1A 1CQDA 2F7DA 1CSBB 4MM3B 2FE8A 3OF8A 4N79A 1KFXL 3N4CA 3QSDA 4W4UA 4YVAA 2E00A 3C0RA 3PRMA 1EWPA 1DEUA 2BTWB 4PADA 7PCKA 1YT7A 3PHWA 4MSXA 2YJBA 1KFUL 3U8EA 4ZUXU 4N4ZA 4QRXA 2DOSA 4REZA 2B1NA 2FUDA 4GUAA 2HHNA 3KKUA 1ITOA 2XU3A 3O65A 3CH2X 2H7JA 2JQGR 2YJCA 3PDFA 2FYEA 1POPA 3BY4A 1KHQA 1NLJA 3MHSA 2DC7A 9PAPA 4MZOA 4CDDB 3IMAA 3P5XA 1AU4A 4PI3A 4PT5A 4XUIA 5JA7A 1AYVA 2B1MA 2NQIA 2P7UA 1AYWA 2G7YA 3RVXA 1AIMA 2YJ9A 3V6CA 2J7QA 2UZJA 3HD3A 3V6EA 1BQIA 4BOPA 3OVZA 4Q8GA 3QJ3A 1DKIA 1HUCB 3MTNA 5EF4A 1F2CA 4YYUA 3E1ZB 3E9SA 1CS8A 1KHPA 3W30A 5JH3A 4WURA 3K24A 3O1GA 3N3KA 4ZTBA 1VSNA 5K16A 1K3BB 2Y5BA 3KW9A 1BY8A 4PP2E 4RKXA 1ZCMA 2OZ2A 4YYWA 2FRQA 4X6HA 3ZNHA 4D8BA 4YYQA 2HD5A 4RF1A 2GHUA 3CBJA 4XR7A 2FO5A 4BS6A 5A24A 1IWDA 1YK7A 2AGAA 4BPVA 2Y6EA 3BC3A 1TU6A 4D8IA 3BBAA 1M6DA 3O0UA 3S3RA 4AXLA 2AU1A 1YZBA 4K7CA 4QRGA 2R9NA 1SNKA 3C9EA 1PVJA 2DZZA 3ZUAA 3P5VA 1MDWA 2FTDA 1S4VA 1U9XA 5EZSA 1PE6A 3H7DA 2DJGB 4BOSA 1ATKA 1QDQA 3MJ5A 1CVZA 2JTCA 3P5WA 4I04A 1UKFA 2DCAA 6PADA 3BB7A 1ME3A 2Z84A 5CVMA 1PPPA 3BWKA 2AYNA 3WXGA 3BOWA 2P86A 3WXFA 4YYSA 3F75A 1ME4A 3KSEA 4HWYA 4HXDB 2R6NA 1EWOA 3LXSA 3PRPA 4DMXA 2F1GA 3TMPA 5EGWA 3K8UA 4D8EA 4I05A 2PADA 3IHPA 2BDLA 4FK5A 1AYUA 1CPJA 3OQCA 3H89A 1PPNA 1NPZA 4RNAA 3BCNA 4BSQA 1JQPA 4CDFB 5F02A 4BOUA 4QBBA 1THEA 5E6JA 3MORA 3PW3A 5JZEA 4QRVA 5PADA 1EWLA 4YV8A 4QH6A 4XZXA 1PPDA 4CDEB 4RF0A 2IBIA 1QMYA 1F2AA 2R9OA 1X9YA 3GCBA 2VHSA 5J94A 3MP2A 1PADA 2BTWA 2FT2A 4M0WA 1CV8A 4P16A 4BS5A 1MHWA 2WBFX 1F2BA 4IUMA
chains in the Genus database with same CATH topology
1MEMA 2E01A 1NL6A 2BDZA 2R9MA 3PNRA 3S3QA 3B79A 3AI8A 1U9VA 2XU4A 3QT4A 4OEMA 1F29A 5CHVA 4BQVA 1A6RA 1CJLA 1QOLA 5CVNB 4W5BA 2G8JA 1EWMA 4N8WA 2AVWA 4P6GA 1GCBA 1Y08A 2XU5A 1Q6KA 2DC8A 3DF0A 1PBHA 3KWBX 3HHIA 2DCDA 2G8EA 3LFYA 1ICFA 2O6XA 1VJVA 2DC9A 4I07A 5CVOB 3BPMA 1GLOA 1TLOA 4W5CA 3OISA 2E03A 2DZYA 1YVBA 2VHFA 3H8BA 1AU3A 5FPWA 2IPPB 5CHTA 1GECE 3D6SA 1AU0A 2AS8A 4FJCA 1GMYA 1W6FA 1AU2A 2P0RA 1MS6A 4P6EA 4CDCB 2PBHA 4DMYA 1ZIVA 2PREA 2NQAA 1PPOA 3NHEA 4NV7A 1U9QX 4OELA 3F5VA 4X6IA 1SP4B 1Y4HA 3I06A 2ARYA 2AUXA 1PIPA 2PNSA 1CB5A 1NQCA 2C0YA 3I3TA 3N3GA 1U5IA 3ERVA 2FQ9A 2CB5A 3OVXA 2AUZA 1PXVA 2GFOA 2OULA 1QXPA 2R9FA 1AECA 3RVWA 1BGOA 1YK8A 2AIMA 2JQFR 4RY2A 4KLBA 2AYOA 3BPFA 3CBKA 3USVA 4MZSA 4G54A 4YYVA 3HWNA 4YYRA 3MHHA 1DF0A 2E02A 3IUTA 3PBHA 1CTEA 1MIRA 3KFQA 3WXEA 1O0EA 1KXRA 8PCHA 2YJ8A 2DCBA 3IOQA 3P5UA 2NQGA 3K9MA 2VFBA 4Q8HA 3RVVA 2G6DA 2CIOA 3TNXA 4AXMA 2DCCA 2HH5A 2YJ2A 4PP1A 2HXZA 2R9CA 1U9WA 1YALA 4X6JA 1XKGA 2XU1A 3H6SA 4WA6A 1NB3A 3CH3X 3KWZA 4CZWA 3HHAA 1TL9A 3IEJA 3M99A 2ACTA 2DC6A 1PCIA 2NQDB 3IV2A 1NB5A 3H8CA 3LTWA 4FIPA 4NV8A 1FH0A 1STFE 2ATOA 4BGFA 1MEGA 1EF7A 1BP4A 2OP3A 3OF9A 2DJFB 2FRAA 3KX1A 1CQDA 2F7DA 1CSBB 3OF8A 4N79A 1KFXL 3N4CA 3QSDA 4W4UA 4YVAA 2E00A 1EWPA 1DEUA 4PADA 7PCKA 1YT7A 4MSXA 2YJBA 1KFUL 3U8EA 4ZUXU 4N4ZA 4QRXA 2B1NA 2FUDA 2HHNA 3KKUA 1ITOA 2XU3A 3CH2X 2H7JA 2JQGR 2YJCA 3PDFA 2FYEA 1E2TA 4C5PA 1POPA 1KHQA 1NLJA 3MHSA 4GUZA 2DC7A 9PAPA 4MZOA 4CDDB 3IMAA 3P5XA 1AU4A 4PI3A 4XUIA 5JA7A 1AYVA 2B1MA 2NQIA 2P7UA 1AYWA 2G7YA 3RVXA 1AIMA 2YJ9A 3V6CA 3HD3A 3V6EA 1BQIA 3OVZA 4Q8GA 3QJ3A 1HUCB 3MTNA 5EF4A 1F2CA 4YYUA 3E1ZB 1CS8A 1KHPA 5JH3A 3K24A 3O1GA 3N3KA 1VSNA 5K16A 1K3BB 2Y5BA 3KW9A 1BY8A 4PP2E 1ZCMA 2OZ2A 4YYWA 2FRQA 4X6HA 2VFCA 4YYQA 2HD5A 2GHUA 3CBJA 4XR7A 2FO5A 4BS6A 5A24A 1IWDA 1YK7A 4BPVA 1GX3A 2Y6EA 3BC3A 1TU6A 1M6DA 3O0UA 3S3RA 4AXLA 2AU1A 4K7CA 4QRGA 2R9NA 1SNKA 3C9EA 2DZZA 3ZUAA 3P5VA 1MDWA 2FTDA 1W5RA 1S4VA 1U9XA 1PE6A 3H7DA 2DJGB 1ATKA 1QDQA 1CVZA 3P5WA 4I04A 2DCAA 6PADA 2BSZA 1ME3A 5CVMA 1PPPA 3BWKA 2AYNA 3WXGA 3BOWA 2P86A 3WXFA 4YYSA 3F75A 1ME4A 3KSEA 4HWYA 2R6NA 1EWOA 3LXSA 4DMXA 2F1GA 5EGWA 3K8UA 4I05A 2PADA 3IHPA 2BDLA 4FK5A 1AYUA 1CPJA 3H89A 1PPNA 1NPZA 3BCNA 4BSQA 1JQPA 1W4TA 4CDFB 5F02A 4QBBA 4B55A 1THEA 3MORA 3PW3A 4QRVA 5PADA 1EWLA 3D9WA 4YV8A 4QH6A 1PPDA 4CDEB 2IBIA 1QMYA 1F2AA 2R9OA 1X9YA 3GCBA 2VHSA 5J94A 1PADA 2FT2A 1CV8A 4BS5A 1MHWA 2WBFX 1F2BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MEM A;  2E01 A;  1NL6 A;  2BDZ A;  2R9M A;  3PNR A;  3S3Q A;  3B79 A;  3AI8 A;  1U9V A;  2XU4 A;  3QT4 A;  4OEM A;  1F29 A;  5CHV A;  4BQV A;  1A6R A;  1CJL A;  1QOL A;  5CVN B;  4W5B A;  2G8J A;  1EWM A;  4N8W A;  2AVW A;  4P6G A;  1GCB A;  1Y08 A;  2XU5 A;  1Q6K A;  2DC8 A;  3DF0 A;  1PBH A;  3KWB X;  3HHI A;  2DCD A;  2G8E A;  3LFY A;  1ICF A;  2O6X A;  1VJV A;  2DC9 A;  4I07 A;  5CVO B;  3BPM A;  1GLO A;  1TLO A;  4W5C A;  3OIS A;  2E03 A;  2DZY A;  1YVB A;  2VHF A;  3H8B A;  1AU3 A;  5FPW A;  2IPP B;  5CHT A;  1GEC E;  3D6S A;  1AU0 A;  2AS8 A;  4FJC A;  1GMY A;  1AU2 A;  2P0R A;  1MS6 A;  4P6E A;  4CDC B;  2PBH A;  4DMY A;  1ZIV A;  2PRE A;  2NQA A;  1PPO A;  3NHE A;  1U9Q X;  4OEL A;  3F5V A;  4X6I A;  1SP4 B;  1Y4H A;  3I06 A;  2ARY A;  2AUX A;  1PIP A;  2PNS A;  1CB5 A;  1NQC A;  2C0Y A;  3I3T A;  3N3G A;  1U5I A;  3ERV A;  2FQ9 A;  2CB5 A;  3OVX A;  2AUZ A;  1PXV A;  2GFO A;  2OUL A;  1QXP A;  2R9F A;  1AEC A;  3RVW A;  1BGO A;  1YK8 A;  2AIM A;  2JQF R;  4RY2 A;  4KLB A;  2AYO A;  3BPF A;  3CBK A;  3USV A;  4MZS A;  4G54 A;  4YYV A;  3HWN A;  4YYR A;  3MHH A;  1DF0 A;  2E02 A;  3IUT A;  3PBH A;  1CTE A;  1MIR A;  3KFQ A;  3WXE A;  1O0E A;  1KXR A;  8PCH A;  2YJ8 A;  2DCB A;  3IOQ A;  3P5U A;  2NQG A;  3K9M A;  4Q8H A;  3RVV A;  2G6D A;  2CIO A;  3TNX A;  4AXM A;  2DCC A;  2HH5 A;  2YJ2 A;  4PP1 A;  2HXZ A;  2R9C A;  1U9W A;  1YAL A;  4X6J A;  1XKG A;  2XU1 A;  3H6S A;  4WA6 A;  1NB3 A;  3CH3 X;  3KWZ A;  4CZW A;  3HHA A;  1TL9 A;  3IEJ A;  3M99 A;  2ACT A;  2DC6 A;  1PCI A;  2NQD B;  3IV2 A;  1NB5 A;  3H8C A;  4FIP A;  1FH0 A;  1STF E;  2ATO A;  1MEG A;  1EF7 A;  1BP4 A;  2OP3 A;  3OF9 A;  2DJF B;  2FRA A;  3KX1 A;  1CQD A;  2F7D A;  1CSB B;  3OF8 A;  4N79 A;  1KFX L;  3N4C A;  3QSD A;  4W4U A;  4YVA A;  2E00 A;  1EWP A;  1DEU A;  4PAD A;  7PCK A;  1YT7 A;  4MSX A;  2YJB A;  1KFU L;  3U8E A;  4ZUX U;  4N4Z A;  4QRX A;  2B1N A;  2FUD A;  2HHN A;  3KKU A;  1ITO A;  2XU3 A;  3CH2 X;  2H7J A;  2JQG R;  2YJC A;  3PDF A;  2FYE A;  1POP A;  1KHQ A;  1NLJ A;  3MHS A;  2DC7 A;  9PAP A;  4MZO A;  4CDD B;  3IMA A;  3P5X A;  1AU4 A;  4PI3 A;  4XUI A;  5JA7 A;  1AYV A;  2B1M A;  2NQI A;  2P7U A;  1AYW A;  2G7Y A;  3RVX A;  1AIM A;  2YJ9 A;  3V6C A;  3HD3 A;  3V6E A;  1BQI A;  3OVZ A;  4Q8G A;  3QJ3 A;  1HUC B;  3MTN A;  5EF4 A;  1F2C A;  4YYU A;  3E1Z B;  1CS8 A;  1KHP A;  5JH3 A;  3K24 A;  3O1G A;  3N3K A;  1VSN A;  5K16 A;  1K3B B;  2Y5B A;  3KW9 A;  1BY8 A;  4PP2 E;  1ZCM A;  2OZ2 A;  4YYW A;  2FRQ A;  4X6H A;  4YYQ A;  2HD5 A;  2GHU A;  3CBJ A;  4XR7 A;  2FO5 A;  4BS6 A;  5A24 A;  1IWD A;  1YK7 A;  4BPV A;  2Y6E A;  3BC3 A;  1TU6 A;  1M6D A;  3O0U A;  3S3R A;  4AXL A;  2AU1 A;  4K7C A;  4QRG A;  2R9N A;  1SNK A;  3C9E A;  2DZZ A;  3ZUA A;  3P5V A;  1MDW A;  2FTD A;  1S4V A;  1U9X A;  1PE6 A;  3H7D A;  2DJG B;  1ATK A;  1QDQ A;  1CVZ A;  3P5W A;  4I04 A;  2DCA A;  6PAD A;  1ME3 A;  5CVM A;  1PPP A;  3BWK A;  2AYN A;  3WXG A;  3BOW A;  2P86 A;  3WXF A;  4YYS A;  3F75 A;  1ME4 A;  3KSE A;  4HWY A;  2R6N A;  1EWO A;  3LXS A;  4DMX A;  2F1G A;  5EGW A;  3K8U A;  4I05 A;  2PAD A;  3IHP A;  2BDL A;  4FK5 A;  1AYU A;  1CPJ A;  3H89 A;  1PPN A;  1NPZ A;  3BCN A;  4BSQ A;  1JQP A;  4CDF B;  5F02 A;  4QBB A;  1THE A;  3MOR A;  3PW3 A;  4QRV A;  5PAD A;  1EWL A;  4YV8 A;  4QH6 A;  1PPD A;  4CDE B;  2IBI A;  1QMY A;  1F2A A;  2R9O A;  1X9Y A;  3GCB A;  2VHS A;  5J94 A;  1PAD A;  2FT2 A;  1CV8 A;  4BS5 A;  1MHW A;  2WBF X;  1F2B A; 
#chains in the Genus database with same CATH topology
 1MEM A;  2E01 A;  1NL6 A;  2BDZ A;  2R9M A;  3PNR A;  3S3Q A;  3B79 A;  3AI8 A;  1U9V A;  2XU4 A;  3QT4 A;  4OEM A;  5KO3 A;  1F29 A;  5CHV A;  4BQV A;  1A6R A;  1CJL A;  1QOL A;  3PHU A;  5CVN B;  4W5B A;  2G8J A;  1EWM A;  4N8W A;  2AVW A;  4P6G A;  1GCB A;  1Y08 A;  2XU5 A;  1Q6K A;  2J7Q C;  2DC8 A;  3DF0 A;  1PBH A;  3KWB X;  4MI7 A;  3HHI A;  2DCD A;  2G8E A;  3LFY A;  5EZQ A;  3IFU A;  1ICF A;  2O6X A;  1VJV A;  2DC9 A;  4I07 A;  5CVO B;  3BPM A;  1GLO A;  1TLO A;  4W5C A;  3OIS A;  2E03 A;  3TRK A;  2DZY A;  1YVB A;  2VHF A;  3H8B A;  1AU3 A;  5FPW A;  2IPP B;  5CHT A;  1GEC E;  3D6S A;  1AU0 A;  2AS8 A;  4FJC A;  1GMY A;  4OVZ B;  1AU2 A;  2P0R A;  4BOZ A;  1MS6 A;  4P6E A;  4CDC B;  2PBH A;  4DMY A;  1ZIV A;  2PRE A;  2NQA A;  1PPO A;  4A5U A;  3W31 A;  3PHX A;  3NHE A;  1U9Q X;  4OEL A;  3F5V A;  4X6I A;  1SP4 B;  1Y4H A;  3I06 A;  2ARY A;  2AUX A;  1PIP A;  3PSE A;  2PNS A;  1CB5 A;  1NQC A;  2C0Y A;  3I3T A;  3N3G A;  1U5I A;  4BOQ A;  3ERV A;  2FQ9 A;  2CB5 A;  3OVX A;  2AUZ A;  1PXV A;  2GFO A;  2OUL A;  1QXP A;  2R9F A;  1AEC A;  3RVW A;  1BGO A;  1YK8 A;  2AIM A;  2JQF R;  4RY2 A;  4KLB A;  2AYO A;  3PT2 A;  3BPF A;  3CBK A;  3USV A;  4MZS A;  4G54 A;  4YYV A;  3HWN A;  4YYR A;  3MTV A;  3MHH A;  1DF0 A;  2E02 A;  3IUT A;  3PBH A;  1CTE A;  1MIR A;  3RNV A;  3KFQ A;  3WXE A;  1O0E A;  1KXR A;  8PCH A;  2YJ8 A;  2DCB A;  3IOQ A;  3P5U A;  2NQG A;  3K9M A;  4Q8H A;  3RVV A;  2G6D A;  2CIO A;  3TNX A;  4AXM A;  2DCC A;  2HH5 A;  4OVZ A;  2YJ2 A;  4PP1 A;  3B21 A;  2HXZ A;  2R9C A;  1U9W A;  4R3D A;  4IP3 A;  1YAL A;  4X6J A;  1XKG A;  2XU1 A;  3H6S A;  4WA6 A;  1NB3 A;  3CH3 X;  4OW0 A;  2JRI A;  3KWZ A;  4CZW A;  2BU3 A;  3HHA A;  1TL9 A;  3IEJ A;  3M99 A;  2ACT A;  2DC6 A;  1PCI A;  2NQD B;  3IV2 A;  1NB5 A;  3H8C A;  4FIP A;  1FH0 A;  1STF E;  2ATO A;  2HWK A;  1MEG A;  1EF7 A;  1BP4 A;  2OP3 A;  3OF9 A;  2DJF B;  2FRA A;  3KX1 A;  1CQD A;  2F7D A;  1CSB B;  4MM3 B;  2FE8 A;  3OF8 A;  4N79 A;  1KFX L;  3N4C A;  3QSD A;  4W4U A;  4YVA A;  2E00 A;  3C0R A;  3PRM A;  1EWP A;  1DEU A;  2BTW B;  4PAD A;  7PCK A;  1YT7 A;  3PHW A;  4MSX A;  2YJB A;  1KFU L;  3U8E A;  4ZUX U;  4N4Z A;  4QRX A;  2DOS A;  4REZ A;  2B1N A;  2FUD A;  4GUA A;  2HHN A;  3KKU A;  1ITO A;  2XU3 A;  3O65 A;  3CH2 X;  2H7J A;  2JQG R;  2YJC A;  3PDF A;  2FYE A;  1POP A;  3BY4 A;  1KHQ A;  1NLJ A;  3MHS A;  2DC7 A;  9PAP A;  4MZO A;  4CDD B;  3IMA A;  3P5X A;  1AU4 A;  4PI3 A;  4PT5 A;  4XUI A;  5JA7 A;  1AYV A;  2B1M A;  2NQI A;  2P7U A;  1AYW A;  2G7Y A;  3RVX A;  1AIM A;  2YJ9 A;  3V6C A;  2J7Q A;  2UZJ A;  3HD3 A;  3V6E A;  1BQI A;  4BOP A;  3OVZ A;  4Q8G A;  3QJ3 A;  1DKI A;  1HUC B;  3MTN A;  5EF4 A;  1F2C A;  4YYU A;  3E1Z B;  3E9S A;  1CS8 A;  1KHP A;  3W30 A;  5JH3 A;  4WUR A;  3K24 A;  3O1G A;  3N3K A;  4ZTB A;  1VSN A;  5K16 A;  1K3B B;  2Y5B A;  3KW9 A;  1BY8 A;  4PP2 E;  4RKX A;  1ZCM A;  2OZ2 A;  4YYW A;  2FRQ A;  4X6H A;  3ZNH A;  4D8B A;  4YYQ A;  2HD5 A;  4RF1 A;  2GHU A;  3CBJ A;  4XR7 A;  2FO5 A;  4BS6 A;  5A24 A;  1IWD A;  1YK7 A;  2AGA A;  4BPV A;  2Y6E A;  3BC3 A;  1TU6 A;  4D8I A;  3BBA A;  1M6D A;  3O0U A;  3S3R A;  4AXL A;  2AU1 A;  1YZB A;  4K7C A;  4QRG A;  2R9N A;  1SNK A;  3C9E A;  1PVJ A;  2DZZ A;  3ZUA A;  3P5V A;  1MDW A;  2FTD A;  1S4V A;  1U9X A;  5EZS A;  1PE6 A;  3H7D A;  2DJG B;  4BOS A;  1ATK A;  1QDQ A;  3MJ5 A;  1CVZ A;  2JTC A;  3P5W A;  4I04 A;  1UKF A;  2DCA A;  6PAD A;  3BB7 A;  1ME3 A;  2Z84 A;  5CVM A;  1PPP A;  3BWK A;  2AYN A;  3WXG A;  3BOW A;  2P86 A;  3WXF A;  4YYS A;  3F75 A;  1ME4 A;  3KSE A;  4HWY A;  4HXD B;  2R6N A;  1EWO A;  3LXS A;  3PRP A;  4DMX A;  2F1G A;  3TMP A;  5EGW A;  3K8U A;  4D8E A;  4I05 A;  2PAD A;  3IHP A;  2BDL A;  4FK5 A;  1AYU A;  1CPJ A;  3OQC A;  3H89 A;  1PPN A;  1NPZ A;  4RNA A;  3BCN A;  4BSQ A;  1JQP A;  4CDF B;  5F02 A;  4BOU A;  4QBB A;  1THE A;  5E6J A;  3MOR A;  3PW3 A;  5JZE A;  4QRV A;  5PAD A;  1EWL A;  4YV8 A;  4QH6 A;  4XZX A;  1PPD A;  4CDE B;  4RF0 A;  2IBI A;  1QMY A;  1F2A A;  2R9O A;  1X9Y A;  3GCB A;  2VHS A;  5J94 A;  3MP2 A;  1PAD A;  2BTW A;  2FT2 A;  4M0W A;  1CV8 A;  4P16 A;  4BS5 A;  1MHW A;  2WBF X;  1F2B A;  4IUM A; 
#chains in the Genus database with same CATH homology
 1MEM A;  2E01 A;  1NL6 A;  2BDZ A;  2R9M A;  3PNR A;  3S3Q A;  3B79 A;  3AI8 A;  1U9V A;  2XU4 A;  3QT4 A;  4OEM A;  1F29 A;  5CHV A;  4BQV A;  1A6R A;  1CJL A;  1QOL A;  5CVN B;  4W5B A;  2G8J A;  1EWM A;  4N8W A;  2AVW A;  4P6G A;  1GCB A;  1Y08 A;  2XU5 A;  1Q6K A;  2DC8 A;  3DF0 A;  1PBH A;  3KWB X;  3HHI A;  2DCD A;  2G8E A;  3LFY A;  1ICF A;  2O6X A;  1VJV A;  2DC9 A;  4I07 A;  5CVO B;  3BPM A;  1GLO A;  1TLO A;  4W5C A;  3OIS A;  2E03 A;  2DZY A;  1YVB A;  2VHF A;  3H8B A;  1AU3 A;  5FPW A;  2IPP B;  5CHT A;  1GEC E;  3D6S A;  1AU0 A;  2AS8 A;  4FJC A;  1GMY A;  1W6F A;  1AU2 A;  2P0R A;  1MS6 A;  4P6E A;  4CDC B;  2PBH A;  4DMY A;  1ZIV A;  2PRE A;  2NQA A;  1PPO A;  3NHE A;  4NV7 A;  1U9Q X;  4OEL A;  3F5V A;  4X6I A;  1SP4 B;  1Y4H A;  3I06 A;  2ARY A;  2AUX A;  1PIP A;  2PNS A;  1CB5 A;  1NQC A;  2C0Y A;  3I3T A;  3N3G A;  1U5I A;  3ERV A;  2FQ9 A;  2CB5 A;  3OVX A;  2AUZ A;  1PXV A;  2GFO A;  2OUL A;  1QXP A;  2R9F A;  1AEC A;  3RVW A;  1BGO A;  1YK8 A;  2AIM A;  2JQF R;  4RY2 A;  4KLB A;  2AYO A;  3BPF A;  3CBK A;  3USV A;  4MZS A;  4G54 A;  4YYV A;  3HWN A;  4YYR A;  3MHH A;  1DF0 A;  2E02 A;  3IUT A;  3PBH A;  1CTE A;  1MIR A;  3KFQ A;  3WXE A;  1O0E A;  1KXR A;  8PCH A;  2YJ8 A;  2DCB A;  3IOQ A;  3P5U A;  2NQG A;  3K9M A;  2VFB A;  4Q8H A;  3RVV A;  2G6D A;  2CIO A;  3TNX A;  4AXM A;  2DCC A;  2HH5 A;  2YJ2 A;  4PP1 A;  2HXZ A;  2R9C A;  1U9W A;  1YAL A;  4X6J A;  1XKG A;  2XU1 A;  3H6S A;  4WA6 A;  1NB3 A;  3CH3 X;  3KWZ A;  4CZW A;  3HHA A;  1TL9 A;  3IEJ A;  3M99 A;  2ACT A;  2DC6 A;  1PCI A;  2NQD B;  3IV2 A;  1NB5 A;  3H8C A;  3LTW A;  4FIP A;  4NV8 A;  1FH0 A;  1STF E;  2ATO A;  4BGF A;  1MEG A;  1EF7 A;  1BP4 A;  2OP3 A;  3OF9 A;  2DJF B;  2FRA A;  3KX1 A;  1CQD A;  2F7D A;  1CSB B;  3OF8 A;  4N79 A;  1KFX L;  3N4C A;  3QSD A;  4W4U A;  4YVA A;  2E00 A;  1EWP A;  1DEU A;  4PAD A;  7PCK A;  1YT7 A;  4MSX A;  2YJB A;  1KFU L;  3U8E A;  4ZUX U;  4N4Z A;  4QRX A;  2B1N A;  2FUD A;  2HHN A;  3KKU A;  1ITO A;  2XU3 A;  3CH2 X;  2H7J A;  2JQG R;  2YJC A;  3PDF A;  2FYE A;  1E2T A;  4C5P A;  1POP A;  1KHQ A;  1NLJ A;  3MHS A;  4GUZ A;  2DC7 A;  9PAP A;  4MZO A;  4CDD B;  3IMA A;  3P5X A;  1AU4 A;  4PI3 A;  4XUI A;  5JA7 A;  1AYV A;  2B1M A;  2NQI A;  2P7U A;  1AYW A;  2G7Y A;  3RVX A;  1AIM A;  2YJ9 A;  3V6C A;  3HD3 A;  3V6E A;  1BQI A;  3OVZ A;  4Q8G A;  3QJ3 A;  1HUC B;  3MTN A;  5EF4 A;  1F2C A;  4YYU A;  3E1Z B;  1CS8 A;  1KHP A;  5JH3 A;  3K24 A;  3O1G A;  3N3K A;  1VSN A;  5K16 A;  1K3B B;  2Y5B A;  3KW9 A;  1BY8 A;  4PP2 E;  1ZCM A;  2OZ2 A;  4YYW A;  2FRQ A;  4X6H A;  2VFC A;  4YYQ A;  2HD5 A;  2GHU A;  3CBJ A;  4XR7 A;  2FO5 A;  4BS6 A;  5A24 A;  1IWD A;  1YK7 A;  4BPV A;  1GX3 A;  2Y6E A;  3BC3 A;  1TU6 A;  1M6D A;  3O0U A;  3S3R A;  4AXL A;  2AU1 A;  4K7C A;  4QRG A;  2R9N A;  1SNK A;  3C9E A;  2DZZ A;  3ZUA A;  3P5V A;  1MDW A;  2FTD A;  1W5R A;  1S4V A;  1U9X A;  1PE6 A;  3H7D A;  2DJG B;  1ATK A;  1QDQ A;  1CVZ A;  3P5W A;  4I04 A;  2DCA A;  6PAD A;  2BSZ A;  1ME3 A;  5CVM A;  1PPP A;  3BWK A;  2AYN A;  3WXG A;  3BOW A;  2P86 A;  3WXF A;  4YYS A;  3F75 A;  1ME4 A;  3KSE A;  4HWY A;  2R6N A;  1EWO A;  3LXS A;  4DMX A;  2F1G A;  5EGW A;  3K8U A;  4I05 A;  2PAD A;  3IHP A;  2BDL A;  4FK5 A;  1AYU A;  1CPJ A;  3H89 A;  1PPN A;  1NPZ A;  3BCN A;  4BSQ A;  1JQP A;  1W4T A;  4CDF B;  5F02 A;  4QBB A;  4B55 A;  1THE A;  3MOR A;  3PW3 A;  4QRV A;  5PAD A;  1EWL A;  3D9W A;  4YV8 A;  4QH6 A;  1PPD A;  4CDE B;  2IBI A;  1QMY A;  1F2A A;  2R9O A;  1X9Y A;  3GCB A;  2VHS A;  5J94 A;  1PAD A;  2FT2 A;  1CV8 A;  4BS5 A;  1MHW A;  2WBF X;  1F2B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...