1NB5A

Crystal structure of stefin a in complex with cathepsin h
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
220
structure length
220
Chain Sequence
YPPSMDWRKKGNFVSPVKNQGSCGSCWTFSTTGALESAVAIATGKMLSLAEQQLVDCAQNFNNHGCQGGLPSQAFEYIRYNKGIMGEDTYPYKGQDDHCKFQPDKAIAFVKDVANITMNDEEAMVEAVALYNPVSFAFEVTNDFLMYRKGIYSSTSCHKTPDKVNHAVLAVGYGEENGIPYWIVKNSWGPQWGMNGYFLIERGKNMCGLAACASYPIPLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of stefin A in complex with cathepsin H: N-terminal residues of inhibitors can adapt to the active sites of endo- and exopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cathepsin H
total genus 55
structure length 220
sequence length 220
chains with identical sequence B, C, D
ec nomenclature ec 3.4.22.16: Cathepsin H.
pdb deposition date 2002-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1nb5A00
1QXPA 1CJLA 3P5WA 2G8EA 1ZIVA 1QMYA 2R9MA 4X6IA 2O6XA 7PCKA 4BSQA 4FIPA 1PPOA 4N8WA 3PBHA 3K9MA 3OISA 3OF8A 1NB3A 1POPA 2DCCA 2HHNA 4Q8GA 3KSEA 1IWDA 3CH3X 1EWPA 1U9WA 4X6JA 1SNKA 4K7CA 1PE6A 2R9FA 1PPDA 2DCDA 3WXFA 2FTDA 2ACTA 3P5XA 2DJFB 2BDLA 5JA7A 4N79A 3RVVA 1QDQA 1Y08A 4DMXA 8PCHA 1EWLA 3H89A 1BP4A 4QRVA 9PAPA 4YVAA 5JH3A 3CBJA 1SP4B 2DZYA 1ATKA 1U9VA 2WBFX 3D6SA 4P6GA 1VJVA 1QOLA 2C0YA 2Y6EA 3IEJA 4MSXA 4CDFB 3U8EA 3F75A 1F2CA 1PBHA 1NQCA 1S4VA 3IMAA 2GHUA 1YK7A 3OVXA 2PREA 5FPWA 5EF4A 3E1ZB 2FQ9A 2AUZA 2R9NA 4P6EA 2R9OA 2G6DA 3ZUAA 2VHSA 5K16A 3BOWA 2HD5A 3MHSA 3AI8A 1U9QX 2IPPB 1M6DA 2H7JA 2VHFA 1HUCB 2Y5BA 1JQPA 2JQFR 3V6CA 1MS6A 3F5VA 1AYWA 3H7DA 3TNXA 3NHEA 3PDFA 4AXMA 1KXRA 3LFYA 3K8UA 2NQGA 5EGWA 3QSDA 3KWZA 2FO5A 1AU3A 5CVOB 1THEA 4YV8A 3B79A 2B1NA 1PIPA 2JQGR 2YJ9A 1TU6A 3MHHA 4YYUA 1FH0A 4QBBA 3P5VA 1CV8A 4BS5A 1CTEA 1AYUA 2PBHA 4FJCA 3WXEA 4YYWA 1CB5A 2YJ2A 3I06A 5CVNB 3S3QA 1MHWA 4CZWA 1F2AA 3HWNA 4WA6A 4QH6A 1NLJA 2F1GA 2YJBA 1PCIA 2G7YA 1YALA 2HH5A 3BPFA 1K3BB 1GCBA 1ME3A 2AS8A 2E02A 4OELA 1BGOA 3MTNA 4I05A 2YJCA 1CSBB 2F7DA 3M99A 2NQIA 1PPNA 1ME4A 3K24A 5J94A 2E03A 1KHQA 1KFXL 1F2BA 2XU5A 4YYQA 3N3GA 1DF0A 3IOQA 1U5IA 4YYVA 1ICFA 1AU0A 3CH2X 4PI3A 2AU1A 3P5UA 1Q6KA 3O1GA 2DC7A 4MZSA 3S3RA 1YK8A 4QRXA 1O0EA 3BCNA 3C9EA 4YYSA 1YVBA 1VSNA 4N4ZA 2DC6A 3V6EA 2FRAA 1BQIA 3QJ3A 2P7UA 1EWMA 1BY8A 1F29A 4W5CA 1GLOA 2DC9A 3HHIA 4CDEB 2ARYA 1ITOA 2E01A 3DF0A 3KKUA 1PADA 1MIRA 1U9XA 3MORA 2NQAA 2DJGB 1XKGA 2DCAA 1EF7A 4PP1A 4CDDB 1TLOA 3RVXA 1AU4A 2OULA 3BPMA 2FUDA 3USVA 4PADA 3LXSA 3KFQA 1GMYA 4AXLA 1CVZA 2CIOA 4KLBA 1AU2A 1X9YA 4X6HA 2AYOA 2FYEA 3IV2A 2XU4A 4XR7A 3IUTA 2OP3A 4QRGA 3HHAA 2AYNA 2P0RA 2R9CA 2IBIA 3PW3A 3H6SA 2G8JA 3H8BA 2PADA 3OVZA 1CS8A 1TL9A 1AYVA 4BQVA 1STFE 3IHPA 3KWBX 2YJ8A 1EWOA 3BC3A 3KW9A 2DZZA 3BWKA 3KX1A 2AUXA 1MDWA 1AECA 1PXVA 3ERVA 1YT7A 4PP2E 2NQDB 5CVMA 4FK5A 2XU1A 4BPVA 1A6RA 1DEUA 2B1MA 3I3TA 4BS6A 4W4UA 4OEMA 4RY2A 2BDZA 4I07A 1NB5A 1MEGA 2FT2A 4G54A 1MEMA 2PNSA 2DCBA 4W5BA 3RVWA 1GECE 1NPZA 3N3KA 1CQDA 2E00A 5A24A 4YYRA 4DMYA 2XU3A 2CB5A 1ZCMA 3CBKA 4ZUXU 2ATOA 2AVWA 1KHPA 2OZ2A 1AIMA 2AIMA 1KFUL 3WXGA 1NL6A 3PNRA 2FRQA 5F02A 2GFOA 3H8CA 4Q8HA 4HWYA 3HD3A 4XUIA 2DC8A 5PADA 2R6NA 2HXZA 1PPPA 1CPJA 3N4CA 4CDCB 5CHVA 4MZOA 3OF9A 1Y4HA 3QT4A 4I04A 2P86A 3O0UA 5CHTA 6PADA 3GCBA
chains in the Genus database with same CATH superfamily
1QXPA 3B21A 4RF0A 3PT2A 1CJLA 3P5WA 2G8EA 1ZIVA 1QMYA 2R9MA 4X6IA 2O6XA 1DKIA 7PCKA 3TMPA 3BB7A 4BSQA 4FIPA 1PPOA 4N8WA 3PBHA 3K9MA 3OISA 3OF8A 1NB3A 1POPA 3BBAA 2DCCA 2HHNA 4Q8GA 3KSEA 1IWDA 3CH3X 1EWPA 4RF1A 4BOUA 4D8BA 1U9WA 4X6JA 4BOPA 3E9SA 1SNKA 4K7CA 1PE6A 2R9FA 1PPDA 2DCDA 3WXFA 2J7QA 2FTDA 2ACTA 3P5XA 2DJFB 3PHXA 2BDLA 5JA7A 4N79A 3RVVA 1QDQA 3W31A 1Y08A 4PT5A 4DMXA 8PCHA 1EWLA 3H89A 1BP4A 2BTWB 4WURA 4QRVA 9PAPA 4R3DA 4YVAA 5JH3A 3CBJA 1SP4B 2DZYA 1ATKA 1U9VA 2WBFX 3D6SA 4P6GA 1VJVA 3O65A 1QOLA 2C0YA 2Y6EA 3IEJA 4MSXA 4IP3A 4CDFB 4M0WA 3U8EA 3F75A 1F2CA 4ZTBA 1PBHA 1NQCA 1S4VA 3IMAA 2GHUA 1PVJA 1YK7A 3OVXA 2PREA 5FPWA 5EF4A 3E1ZB 2FQ9A 2AUZA 2R9NA 4P6EA 2R9OA 2G6DA 3ZUAA 2VHSA 5K16A 3BOWA 2HD5A 3IFUA 4D8EA 3PRMA 3MHSA 3AI8A 1U9QX 2IPPB 1M6DA 2H7JA 2VHFA 1HUCB 4MM3B 2Y5BA 3RNVA 1JQPA 2JQFR 1MS6A 3F5VA 3V6CA 1AYWA 3H7DA 3TNXA 3NHEA 3PDFA 4REZA 4AXMA 1KXRA 3LFYA 3PHWA 3K8UA 2NQGA 5EGWA 3QSDA 3KWZA 2FO5A 1AU3A 5CVOB 1THEA 4YV8A 2AGAA 3B79A 2B1NA 1PIPA 2JQGR 2YJ9A 1TU6A 3MHHA 4YYUA 1FH0A 4QBBA 3P5VA 1CV8A 4BS5A 1CTEA 1AYUA 2PBHA 4FJCA 3WXEA 4YYWA 1CB5A 2YJ2A 3I06A 5CVNB 3S3QA 1MHWA 4CZWA 2UZJA 1F2AA 2JTCA 3HWNA 3BY4A 4WA6A 4QH6A 1NLJA 2F1GA 2YJBA 1PCIA 2G7YA 1YALA 2HH5A 3BPFA 1K3BB 1GCBA 1ME3A 2AS8A 2E02A 4OELA 1BGOA 2FE8A 3MTNA 4I05A 2YJCA 4P16A 3MP2A 1CSBB 2F7DA 2BTWA 3M99A 2NQIA 1PPNA 1ME4A 3K24A 5J94A 2E03A 1KHQA 2BU3A 1KFXL 1YZBA 3OQCA 1F2BA 2XU5A 4RKXA 4YYQA 4OW0A 3N3GA 1DF0A 3IOQA 1U5IA 4YYVA 1ICFA 1AU0A 3CH2X 4PI3A 2AU1A 3P5UA 1Q6KA 3O1GA 2DC7A 4MZSA 3S3RA 1YK8A 4OVZB 4BOZA 3PHUA 4QRXA 1O0EA 3BCNA 3C9EA 4YYSA 1YVBA 1VSNA 4N4ZA 2DC6A 4RNAA 3V6EA 2FRAA 4IUMA 1BQIA 5KO3A 3QJ3A 2P7UA 1EWMA 5EZQA 1BY8A 1F29A 4W5CA 1GLOA 2DC9A 3HHIA 4MI7A 3ZNHA 4CDEB 2ARYA 1ITOA 2E01A 3DF0A 3KKUA 1PADA 4OVZA 1MIRA 3TRKA 1U9XA 3MORA 2NQAA 3W30A 3MTVA 2DJGB 1XKGA 2DCAA 1EF7A 4PP1A 4D8IA 4CDDB 1TLOA 3RVXA 1AU4A 2OULA 3BPMA 2FUDA 3USVA 4BOQA 4PADA 3LXSA 3KFQA 3PRPA 1GMYA 4AXLA 1CVZA 2CIOA 4KLBA 5EZSA 1AU2A 1X9YA 2AYOA 4X6HA 2FYEA 3IV2A 2XU4A 4XR7A 3IUTA 2OP3A 4QRGA 2J7QC 3HHAA 1UKFA 2AYNA 3MJ5A 2P0RA 2R9CA 2IBIA 3PW3A 3H6SA 2G8JA 3H8BA 2PADA 3OVZA 4HXDB 1CS8A 1TL9A 1AYVA 4BQVA 1STFE 5E6JA 3IHPA 3KWBX 2YJ8A 1EWOA 3BC3A 3KW9A 2DZZA 3BWKA 3KX1A 2AUXA 1MDWA 1AECA 1PXVA 3ERVA 1YT7A 3PSEA 2NQDB 4PP2E 5CVMA 4FK5A 2XU1A 4BPVA 1A6RA 1DEUA 2B1MA 3I3TA 4BS6A 4W4UA 4OEMA 4RY2A 2BDZA 4I07A 1NB5A 1MEGA 2FT2A 4G54A 1MEMA 2PNSA 2DCBA 4W5BA 3RVWA 1GECE 1NPZA 3N3KA 1CQDA 5JZEA 2E00A 5A24A 4YYRA 4DMYA 2DOSA 2XU3A 2CB5A 1ZCMA 3CBKA 4ZUXU 2ATOA 4XZXA 2AVWA 1KHPA 2OZ2A 1AIMA 2AIMA 2JRIA 1KFUL 3WXGA 1NL6A 4BOSA 3PNRA 2FRQA 5F02A 2GFOA 3H8CA 4Q8HA 2Z84A 4HWYA 3HD3A 4XUIA 2DC8A 5PADA 2R6NA 2HXZA 1PPPA 3C0RA 1CPJA 3N4CA 4CDCB 5CHVA 2HWKA 4MZOA 3OF9A 1Y4HA 3QT4A 4I04A 2P86A 3O0UA 4GUAA 5CHTA 4A5UA 6PADA 3GCBA
chains in the Genus database with same CATH topology
1QXPA 1CJLA 3P5WA 2G8EA 1ZIVA 1QMYA 2R9MA 4X6IA 2O6XA 7PCKA 4BSQA 4FIPA 1PPOA 4N8WA 4NV8A 3PBHA 3K9MA 3OISA 3OF8A 1NB3A 1POPA 2VFBA 2DCCA 2HHNA 4Q8GA 3KSEA 1IWDA 3CH3X 1EWPA 1U9WA 4X6JA 1SNKA 4K7CA 1PE6A 1W5RA 2R9FA 1PPDA 2DCDA 3WXFA 2FTDA 2ACTA 3P5XA 2DJFB 2BDLA 5JA7A 4N79A 3RVVA 1QDQA 3D9WA 1Y08A 4DMXA 8PCHA 1EWLA 3H89A 1BP4A 4QRVA 1GX3A 9PAPA 4YVAA 5JH3A 3CBJA 1SP4B 2DZYA 1ATKA 1U9VA 2WBFX 3D6SA 4P6GA 1VJVA 1QOLA 2C0YA 2Y6EA 3IEJA 4MSXA 4CDFB 3U8EA 3F75A 1F2CA 1PBHA 1NQCA 1S4VA 3IMAA 2GHUA 1YK7A 3OVXA 2PREA 4BGFA 5FPWA 5EF4A 3E1ZB 2FQ9A 4B55A 2AUZA 2R9NA 4P6EA 2R9OA 2G6DA 3ZUAA 2VHSA 5K16A 3BOWA 2HD5A 3MHSA 3AI8A 1U9QX 2IPPB 1M6DA 2H7JA 2VHFA 1HUCB 2Y5BA 1JQPA 2JQFR 1MS6A 2VFCA 3F5VA 3V6CA 1AYWA 3H7DA 3TNXA 3NHEA 3PDFA 4AXMA 1KXRA 3LFYA 3K8UA 2NQGA 5EGWA 3QSDA 3KWZA 2FO5A 1AU3A 5CVOB 1THEA 4YV8A 3B79A 2B1NA 1PIPA 2JQGR 2YJ9A 1TU6A 3MHHA 4YYUA 1FH0A 4QBBA 3P5VA 1CV8A 4BS5A 1CTEA 1AYUA 2PBHA 4FJCA 3WXEA 4YYWA 1CB5A 2YJ2A 3I06A 5CVNB 3S3QA 1MHWA 4CZWA 1F2AA 3HWNA 4WA6A 4QH6A 1NLJA 2F1GA 2YJBA 1PCIA 2G7YA 1YALA 2HH5A 3BPFA 1K3BB 1GCBA 1ME3A 2AS8A 2E02A 4OELA 1BGOA 3MTNA 4I05A 2YJCA 1CSBB 2F7DA 3M99A 2NQIA 1PPNA 1ME4A 3K24A 5J94A 2E03A 1KHQA 1KFXL 2BSZA 1F2BA 2XU5A 4YYQA 3N3GA 1DF0A 3IOQA 1U5IA 4YYVA 1ICFA 1AU0A 3CH2X 4PI3A 2AU1A 3P5UA 1Q6KA 3O1GA 2DC7A 4MZSA 3S3RA 1YK8A 4QRXA 1O0EA 3BCNA 1E2TA 3C9EA 4YYSA 1YVBA 1VSNA 4N4ZA 2DC6A 3V6EA 4C5PA 2FRAA 1BQIA 3QJ3A 2P7UA 1EWMA 1BY8A 1F29A 4W5CA 1GLOA 2DC9A 3HHIA 4CDEB 2ARYA 1ITOA 2E01A 3DF0A 3KKUA 1PADA 1MIRA 1U9XA 3MORA 2NQAA 3LTWA 1W6FA 2DJGB 1XKGA 2DCAA 1EF7A 4PP1A 4CDDB 1TLOA 3RVXA 1AU4A 2OULA 3BPMA 2FUDA 3USVA 4PADA 3LXSA 3KFQA 1GMYA 4AXLA 1CVZA 2CIOA 4KLBA 1AU2A 1X9YA 4X6HA 2AYOA 2FYEA 3IV2A 2XU4A 4XR7A 3IUTA 2OP3A 4QRGA 3HHAA 2AYNA 2P0RA 2R9CA 2IBIA 3PW3A 3H6SA 2G8JA 3H8BA 2PADA 3OVZA 1CS8A 1TL9A 1AYVA 4BQVA 1STFE 3IHPA 3KWBX 2YJ8A 1EWOA 3BC3A 3KW9A 2DZZA 3BWKA 3KX1A 2AUXA 1MDWA 1AECA 1PXVA 3ERVA 1YT7A 4PP2E 2NQDB 5CVMA 4FK5A 2XU1A 4BPVA 1A6RA 1DEUA 2B1MA 3I3TA 4BS6A 4W4UA 4OEMA 4RY2A 2BDZA 4I07A 1NB5A 1MEGA 2FT2A 4G54A 1MEMA 2PNSA 2DCBA 4W5BA 3RVWA 1GECE 1NPZA 3N3KA 1CQDA 2E00A 5A24A 4YYRA 4DMYA 2XU3A 1W4TA 2CB5A 1ZCMA 3CBKA 4ZUXU 2ATOA 2AVWA 1KHPA 2OZ2A 1AIMA 2AIMA 1KFUL 3WXGA 1NL6A 3PNRA 2FRQA 5F02A 2GFOA 3H8CA 4Q8HA 4HWYA 3HD3A 4XUIA 4GUZA 2DC8A 5PADA 2R6NA 2HXZA 1PPPA 1CPJA 3N4CA 4CDCB 5CHVA 4NV7A 4MZOA 3OF9A 1Y4HA 3QT4A 4I04A 2P86A 3O0UA 5CHTA 6PADA 3GCBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QXP A;  1CJL A;  3P5W A;  2G8E A;  1ZIV A;  1QMY A;  2R9M A;  4X6I A;  2O6X A;  7PCK A;  4BSQ A;  4FIP A;  1PPO A;  4N8W A;  3PBH A;  3K9M A;  3OIS A;  3OF8 A;  1NB3 A;  1POP A;  2DCC A;  2HHN A;  4Q8G A;  3KSE A;  1IWD A;  3CH3 X;  1EWP A;  1U9W A;  4X6J A;  1SNK A;  4K7C A;  1PE6 A;  2R9F A;  1PPD A;  2DCD A;  3WXF A;  2FTD A;  2ACT A;  3P5X A;  2DJF B;  2BDL A;  5JA7 A;  4N79 A;  3RVV A;  1QDQ A;  1Y08 A;  4DMX A;  8PCH A;  1EWL A;  3H89 A;  1BP4 A;  4QRV A;  9PAP A;  4YVA A;  5JH3 A;  3CBJ A;  1SP4 B;  2DZY A;  1ATK A;  1U9V A;  2WBF X;  3D6S A;  4P6G A;  1VJV A;  1QOL A;  2C0Y A;  2Y6E A;  3IEJ A;  4MSX A;  4CDF B;  3U8E A;  3F75 A;  1F2C A;  1PBH A;  1NQC A;  1S4V A;  3IMA A;  2GHU A;  1YK7 A;  3OVX A;  2PRE A;  5FPW A;  5EF4 A;  3E1Z B;  2FQ9 A;  2AUZ A;  2R9N A;  4P6E A;  2R9O A;  2G6D A;  3ZUA A;  2VHS A;  5K16 A;  3BOW A;  2HD5 A;  3MHS A;  3AI8 A;  1U9Q X;  2IPP B;  1M6D A;  2H7J A;  2VHF A;  1HUC B;  2Y5B A;  1JQP A;  2JQF R;  3V6C A;  1MS6 A;  3F5V A;  1AYW A;  3H7D A;  3TNX A;  3NHE A;  3PDF A;  4AXM A;  1KXR A;  3LFY A;  3K8U A;  2NQG A;  5EGW A;  3QSD A;  3KWZ A;  2FO5 A;  1AU3 A;  5CVO B;  1THE A;  4YV8 A;  3B79 A;  2B1N A;  1PIP A;  2JQG R;  2YJ9 A;  1TU6 A;  3MHH A;  4YYU A;  1FH0 A;  4QBB A;  3P5V A;  1CV8 A;  4BS5 A;  1CTE A;  1AYU A;  2PBH A;  4FJC A;  3WXE A;  4YYW A;  1CB5 A;  2YJ2 A;  3I06 A;  5CVN B;  3S3Q A;  1MHW A;  4CZW A;  1F2A A;  3HWN A;  4WA6 A;  4QH6 A;  1NLJ A;  2F1G A;  2YJB A;  1PCI A;  2G7Y A;  1YAL A;  2HH5 A;  3BPF A;  1K3B B;  1GCB A;  1ME3 A;  2AS8 A;  2E02 A;  4OEL A;  1BGO A;  3MTN A;  4I05 A;  2YJC A;  1CSB B;  2F7D A;  3M99 A;  2NQI A;  1PPN A;  1ME4 A;  3K24 A;  5J94 A;  2E03 A;  1KHQ A;  1KFX L;  1F2B A;  2XU5 A;  4YYQ A;  3N3G A;  1DF0 A;  3IOQ A;  1U5I A;  4YYV A;  1ICF A;  1AU0 A;  3CH2 X;  4PI3 A;  2AU1 A;  3P5U A;  1Q6K A;  3O1G A;  2DC7 A;  4MZS A;  3S3R A;  1YK8 A;  4QRX A;  1O0E A;  3BCN A;  3C9E A;  4YYS A;  1YVB A;  1VSN A;  4N4Z A;  2DC6 A;  3V6E A;  2FRA A;  1BQI A;  3QJ3 A;  2P7U A;  1EWM A;  1BY8 A;  1F29 A;  4W5C A;  1GLO A;  2DC9 A;  3HHI A;  4CDE B;  2ARY A;  1ITO A;  2E01 A;  3DF0 A;  3KKU A;  1PAD A;  1MIR A;  1U9X A;  3MOR A;  2NQA A;  2DJG B;  1XKG A;  2DCA A;  1EF7 A;  4PP1 A;  4CDD B;  1TLO A;  3RVX A;  1AU4 A;  2OUL A;  3BPM A;  2FUD A;  3USV A;  4PAD A;  3LXS A;  3KFQ A;  1GMY A;  4AXL A;  1CVZ A;  2CIO A;  4KLB A;  1AU2 A;  1X9Y A;  4X6H A;  2AYO A;  2FYE A;  3IV2 A;  2XU4 A;  4XR7 A;  3IUT A;  2OP3 A;  4QRG A;  3HHA A;  2AYN A;  2P0R A;  2R9C A;  2IBI A;  3PW3 A;  3H6S A;  2G8J A;  3H8B A;  2PAD A;  3OVZ A;  1CS8 A;  1TL9 A;  1AYV A;  4BQV A;  1STF E;  3IHP A;  3KWB X;  2YJ8 A;  1EWO A;  3BC3 A;  3KW9 A;  2DZZ A;  3BWK A;  3KX1 A;  2AUX A;  1MDW A;  1AEC A;  1PXV A;  3ERV A;  1YT7 A;  4PP2 E;  2NQD B;  5CVM A;  4FK5 A;  2XU1 A;  4BPV A;  1A6R A;  1DEU A;  2B1M A;  3I3T A;  4BS6 A;  4W4U A;  4OEM A;  4RY2 A;  2BDZ A;  4I07 A;  1NB5 A;  1MEG A;  2FT2 A;  4G54 A;  1MEM A;  2PNS A;  2DCB A;  4W5B A;  3RVW A;  1GEC E;  1NPZ A;  3N3K A;  1CQD A;  2E00 A;  5A24 A;  4YYR A;  4DMY A;  2XU3 A;  2CB5 A;  1ZCM A;  3CBK A;  4ZUX U;  2ATO A;  2AVW A;  1KHP A;  2OZ2 A;  1AIM A;  2AIM A;  1KFU L;  3WXG A;  1NL6 A;  3PNR A;  2FRQ A;  5F02 A;  2GFO A;  3H8C A;  4Q8H A;  4HWY A;  3HD3 A;  4XUI A;  2DC8 A;  5PAD A;  2R6N A;  2HXZ A;  1PPP A;  1CPJ A;  3N4C A;  4CDC B;  5CHV A;  4MZO A;  3OF9 A;  1Y4H A;  3QT4 A;  4I04 A;  2P86 A;  3O0U A;  5CHT A;  6PAD A;  3GCB A; 
#chains in the Genus database with same CATH topology
 1QXP A;  3B21 A;  4RF0 A;  3PT2 A;  1CJL A;  3P5W A;  2G8E A;  1ZIV A;  1QMY A;  2R9M A;  4X6I A;  2O6X A;  1DKI A;  7PCK A;  3TMP A;  3BB7 A;  4BSQ A;  4FIP A;  1PPO A;  4N8W A;  3PBH A;  3K9M A;  3OIS A;  3OF8 A;  1NB3 A;  1POP A;  3BBA A;  2DCC A;  2HHN A;  4Q8G A;  3KSE A;  1IWD A;  3CH3 X;  1EWP A;  4RF1 A;  4BOU A;  4D8B A;  1U9W A;  4X6J A;  4BOP A;  3E9S A;  1SNK A;  4K7C A;  1PE6 A;  2R9F A;  1PPD A;  2DCD A;  3WXF A;  2J7Q A;  2FTD A;  2ACT A;  3P5X A;  2DJF B;  3PHX A;  2BDL A;  5JA7 A;  4N79 A;  3RVV A;  1QDQ A;  3W31 A;  1Y08 A;  4PT5 A;  4DMX A;  8PCH A;  1EWL A;  3H89 A;  1BP4 A;  2BTW B;  4WUR A;  4QRV A;  9PAP A;  4R3D A;  4YVA A;  5JH3 A;  3CBJ A;  1SP4 B;  2DZY A;  1ATK A;  1U9V A;  2WBF X;  3D6S A;  4P6G A;  1VJV A;  3O65 A;  1QOL A;  2C0Y A;  2Y6E A;  3IEJ A;  4MSX A;  4IP3 A;  4CDF B;  4M0W A;  3U8E A;  3F75 A;  1F2C A;  4ZTB A;  1PBH A;  1NQC A;  1S4V A;  3IMA A;  2GHU A;  1PVJ A;  1YK7 A;  3OVX A;  2PRE A;  5FPW A;  5EF4 A;  3E1Z B;  2FQ9 A;  2AUZ A;  2R9N A;  4P6E A;  2R9O A;  2G6D A;  3ZUA A;  2VHS A;  5K16 A;  3BOW A;  2HD5 A;  3IFU A;  4D8E A;  3PRM A;  3MHS A;  3AI8 A;  1U9Q X;  2IPP B;  1M6D A;  2H7J A;  2VHF A;  1HUC B;  4MM3 B;  2Y5B A;  3RNV A;  1JQP A;  2JQF R;  1MS6 A;  3F5V A;  3V6C A;  1AYW A;  3H7D A;  3TNX A;  3NHE A;  3PDF A;  4REZ A;  4AXM A;  1KXR A;  3LFY A;  3PHW A;  3K8U A;  2NQG A;  5EGW A;  3QSD A;  3KWZ A;  2FO5 A;  1AU3 A;  5CVO B;  1THE A;  4YV8 A;  2AGA A;  3B79 A;  2B1N A;  1PIP A;  2JQG R;  2YJ9 A;  1TU6 A;  3MHH A;  4YYU A;  1FH0 A;  4QBB A;  3P5V A;  1CV8 A;  4BS5 A;  1CTE A;  1AYU A;  2PBH A;  4FJC A;  3WXE A;  4YYW A;  1CB5 A;  2YJ2 A;  3I06 A;  5CVN B;  3S3Q A;  1MHW A;  4CZW A;  2UZJ A;  1F2A A;  2JTC A;  3HWN A;  3BY4 A;  4WA6 A;  4QH6 A;  1NLJ A;  2F1G A;  2YJB A;  1PCI A;  2G7Y A;  1YAL A;  2HH5 A;  3BPF A;  1K3B B;  1GCB A;  1ME3 A;  2AS8 A;  2E02 A;  4OEL A;  1BGO A;  2FE8 A;  3MTN A;  4I05 A;  2YJC A;  4P16 A;  3MP2 A;  1CSB B;  2F7D A;  2BTW A;  3M99 A;  2NQI A;  1PPN A;  1ME4 A;  3K24 A;  5J94 A;  2E03 A;  1KHQ A;  2BU3 A;  1KFX L;  1YZB A;  3OQC A;  1F2B A;  2XU5 A;  4RKX A;  4YYQ A;  4OW0 A;  3N3G A;  1DF0 A;  3IOQ A;  1U5I A;  4YYV A;  1ICF A;  1AU0 A;  3CH2 X;  4PI3 A;  2AU1 A;  3P5U A;  1Q6K A;  3O1G A;  2DC7 A;  4MZS A;  3S3R A;  1YK8 A;  4OVZ B;  4BOZ A;  3PHU A;  4QRX A;  1O0E A;  3BCN A;  3C9E A;  4YYS A;  1YVB A;  1VSN A;  4N4Z A;  2DC6 A;  4RNA A;  3V6E A;  2FRA A;  4IUM A;  1BQI A;  5KO3 A;  3QJ3 A;  2P7U A;  1EWM A;  5EZQ A;  1BY8 A;  1F29 A;  4W5C A;  1GLO A;  2DC9 A;  3HHI A;  4MI7 A;  3ZNH A;  4CDE B;  2ARY A;  1ITO A;  2E01 A;  3DF0 A;  3KKU A;  1PAD A;  4OVZ A;  1MIR A;  3TRK A;  1U9X A;  3MOR A;  2NQA A;  3W30 A;  3MTV A;  2DJG B;  1XKG A;  2DCA A;  1EF7 A;  4PP1 A;  4D8I A;  4CDD B;  1TLO A;  3RVX A;  1AU4 A;  2OUL A;  3BPM A;  2FUD A;  3USV A;  4BOQ A;  4PAD A;  3LXS A;  3KFQ A;  3PRP A;  1GMY A;  4AXL A;  1CVZ A;  2CIO A;  4KLB A;  5EZS A;  1AU2 A;  1X9Y A;  2AYO A;  4X6H A;  2FYE A;  3IV2 A;  2XU4 A;  4XR7 A;  3IUT A;  2OP3 A;  4QRG A;  2J7Q C;  3HHA A;  1UKF A;  2AYN A;  3MJ5 A;  2P0R A;  2R9C A;  2IBI A;  3PW3 A;  3H6S A;  2G8J A;  3H8B A;  2PAD A;  3OVZ A;  4HXD B;  1CS8 A;  1TL9 A;  1AYV A;  4BQV A;  1STF E;  5E6J A;  3IHP A;  3KWB X;  2YJ8 A;  1EWO A;  3BC3 A;  3KW9 A;  2DZZ A;  3BWK A;  3KX1 A;  2AUX A;  1MDW A;  1AEC A;  1PXV A;  3ERV A;  1YT7 A;  3PSE A;  2NQD B;  4PP2 E;  5CVM A;  4FK5 A;  2XU1 A;  4BPV A;  1A6R A;  1DEU A;  2B1M A;  3I3T A;  4BS6 A;  4W4U A;  4OEM A;  4RY2 A;  2BDZ A;  4I07 A;  1NB5 A;  1MEG A;  2FT2 A;  4G54 A;  1MEM A;  2PNS A;  2DCB A;  4W5B A;  3RVW A;  1GEC E;  1NPZ A;  3N3K A;  1CQD A;  5JZE A;  2E00 A;  5A24 A;  4YYR A;  4DMY A;  2DOS A;  2XU3 A;  2CB5 A;  1ZCM A;  3CBK A;  4ZUX U;  2ATO A;  4XZX A;  2AVW A;  1KHP A;  2OZ2 A;  1AIM A;  2AIM A;  2JRI A;  1KFU L;  3WXG A;  1NL6 A;  4BOS A;  3PNR A;  2FRQ A;  5F02 A;  2GFO A;  3H8C A;  4Q8H A;  2Z84 A;  4HWY A;  3HD3 A;  4XUI A;  2DC8 A;  5PAD A;  2R6N A;  2HXZ A;  1PPP A;  3C0R A;  1CPJ A;  3N4C A;  4CDC B;  5CHV A;  2HWK A;  4MZO A;  3OF9 A;  1Y4H A;  3QT4 A;  4I04 A;  2P86 A;  3O0U A;  4GUA A;  5CHT A;  4A5U A;  6PAD A;  3GCB A; 
#chains in the Genus database with same CATH homology
 1QXP A;  1CJL A;  3P5W A;  2G8E A;  1ZIV A;  1QMY A;  2R9M A;  4X6I A;  2O6X A;  7PCK A;  4BSQ A;  4FIP A;  1PPO A;  4N8W A;  4NV8 A;  3PBH A;  3K9M A;  3OIS A;  3OF8 A;  1NB3 A;  1POP A;  2VFB A;  2DCC A;  2HHN A;  4Q8G A;  3KSE A;  1IWD A;  3CH3 X;  1EWP A;  1U9W A;  4X6J A;  1SNK A;  4K7C A;  1PE6 A;  1W5R A;  2R9F A;  1PPD A;  2DCD A;  3WXF A;  2FTD A;  2ACT A;  3P5X A;  2DJF B;  2BDL A;  5JA7 A;  4N79 A;  3RVV A;  1QDQ A;  3D9W A;  1Y08 A;  4DMX A;  8PCH A;  1EWL A;  3H89 A;  1BP4 A;  4QRV A;  1GX3 A;  9PAP A;  4YVA A;  5JH3 A;  3CBJ A;  1SP4 B;  2DZY A;  1ATK A;  1U9V A;  2WBF X;  3D6S A;  4P6G A;  1VJV A;  1QOL A;  2C0Y A;  2Y6E A;  3IEJ A;  4MSX A;  4CDF B;  3U8E A;  3F75 A;  1F2C A;  1PBH A;  1NQC A;  1S4V A;  3IMA A;  2GHU A;  1YK7 A;  3OVX A;  2PRE A;  4BGF A;  5FPW A;  5EF4 A;  3E1Z B;  2FQ9 A;  4B55 A;  2AUZ A;  2R9N A;  4P6E A;  2R9O A;  2G6D A;  3ZUA A;  2VHS A;  5K16 A;  3BOW A;  2HD5 A;  3MHS A;  3AI8 A;  1U9Q X;  2IPP B;  1M6D A;  2H7J A;  2VHF A;  1HUC B;  2Y5B A;  1JQP A;  2JQF R;  1MS6 A;  2VFC A;  3F5V A;  3V6C A;  1AYW A;  3H7D A;  3TNX A;  3NHE A;  3PDF A;  4AXM A;  1KXR A;  3LFY A;  3K8U A;  2NQG A;  5EGW A;  3QSD A;  3KWZ A;  2FO5 A;  1AU3 A;  5CVO B;  1THE A;  4YV8 A;  3B79 A;  2B1N A;  1PIP A;  2JQG R;  2YJ9 A;  1TU6 A;  3MHH A;  4YYU A;  1FH0 A;  4QBB A;  3P5V A;  1CV8 A;  4BS5 A;  1CTE A;  1AYU A;  2PBH A;  4FJC A;  3WXE A;  4YYW A;  1CB5 A;  2YJ2 A;  3I06 A;  5CVN B;  3S3Q A;  1MHW A;  4CZW A;  1F2A A;  3HWN A;  4WA6 A;  4QH6 A;  1NLJ A;  2F1G A;  2YJB A;  1PCI A;  2G7Y A;  1YAL A;  2HH5 A;  3BPF A;  1K3B B;  1GCB A;  1ME3 A;  2AS8 A;  2E02 A;  4OEL A;  1BGO A;  3MTN A;  4I05 A;  2YJC A;  1CSB B;  2F7D A;  3M99 A;  2NQI A;  1PPN A;  1ME4 A;  3K24 A;  5J94 A;  2E03 A;  1KHQ A;  1KFX L;  2BSZ A;  1F2B A;  2XU5 A;  4YYQ A;  3N3G A;  1DF0 A;  3IOQ A;  1U5I A;  4YYV A;  1ICF A;  1AU0 A;  3CH2 X;  4PI3 A;  2AU1 A;  3P5U A;  1Q6K A;  3O1G A;  2DC7 A;  4MZS A;  3S3R A;  1YK8 A;  4QRX A;  1O0E A;  3BCN A;  1E2T A;  3C9E A;  4YYS A;  1YVB A;  1VSN A;  4N4Z A;  2DC6 A;  3V6E A;  4C5P A;  2FRA A;  1BQI A;  3QJ3 A;  2P7U A;  1EWM A;  1BY8 A;  1F29 A;  4W5C A;  1GLO A;  2DC9 A;  3HHI A;  4CDE B;  2ARY A;  1ITO A;  2E01 A;  3DF0 A;  3KKU A;  1PAD A;  1MIR A;  1U9X A;  3MOR A;  2NQA A;  3LTW A;  1W6F A;  2DJG B;  1XKG A;  2DCA A;  1EF7 A;  4PP1 A;  4CDD B;  1TLO A;  3RVX A;  1AU4 A;  2OUL A;  3BPM A;  2FUD A;  3USV A;  4PAD A;  3LXS A;  3KFQ A;  1GMY A;  4AXL A;  1CVZ A;  2CIO A;  4KLB A;  1AU2 A;  1X9Y A;  4X6H A;  2AYO A;  2FYE A;  3IV2 A;  2XU4 A;  4XR7 A;  3IUT A;  2OP3 A;  4QRG A;  3HHA A;  2AYN A;  2P0R A;  2R9C A;  2IBI A;  3PW3 A;  3H6S A;  2G8J A;  3H8B A;  2PAD A;  3OVZ A;  1CS8 A;  1TL9 A;  1AYV A;  4BQV A;  1STF E;  3IHP A;  3KWB X;  2YJ8 A;  1EWO A;  3BC3 A;  3KW9 A;  2DZZ A;  3BWK A;  3KX1 A;  2AUX A;  1MDW A;  1AEC A;  1PXV A;  3ERV A;  1YT7 A;  4PP2 E;  2NQD B;  5CVM A;  4FK5 A;  2XU1 A;  4BPV A;  1A6R A;  1DEU A;  2B1M A;  3I3T A;  4BS6 A;  4W4U A;  4OEM A;  4RY2 A;  2BDZ A;  4I07 A;  1NB5 A;  1MEG A;  2FT2 A;  4G54 A;  1MEM A;  2PNS A;  2DCB A;  4W5B A;  3RVW A;  1GEC E;  1NPZ A;  3N3K A;  1CQD A;  2E00 A;  5A24 A;  4YYR A;  4DMY A;  2XU3 A;  1W4T A;  2CB5 A;  1ZCM A;  3CBK A;  4ZUX U;  2ATO A;  2AVW A;  1KHP A;  2OZ2 A;  1AIM A;  2AIM A;  1KFU L;  3WXG A;  1NL6 A;  3PNR A;  2FRQ A;  5F02 A;  2GFO A;  3H8C A;  4Q8H A;  4HWY A;  3HD3 A;  4XUI A;  4GUZ A;  2DC8 A;  5PAD A;  2R6N A;  2HXZ A;  1PPP A;  1CPJ A;  3N4C A;  4CDC B;  5CHV A;  4NV7 A;  4MZO A;  3OF9 A;  1Y4H A;  3QT4 A;  4I04 A;  2P86 A;  3O0U A;  5CHT A;  6PAD A;  3GCB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...