3PRPA

Structural analysis of a viral otu domain protease from the crimean-congo hemorrhagic fever virus in complex with human ubiquitin
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
161
structure length
161
Chain Sequence
DFLRSLDWTQVIAGQYVSNPRFNISDYFEIVRQPGDGNCFYHSIAELTMPNKTDHSYHYIKRLTESAARKYYQEEPEARLVGLSLEDYLKRMLSDNEWGSTLEASMLAKEMGITIIIWTVAASDEVEAGIKFGDGDVFTAVNLLHSGQTHFDALRILPQFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L protein
publication title Structural analysis of a viral ovarian tumor domain protease from the crimean-congo hemorrhagic Fever virus in complex with covalently bonded ubiquitin.
pubmed doi rcsb
source organism Crimean-congo hemorrhagic fever virus
molecule tags Hydrolase/hydrolase
total genus 47
structure length 161
sequence length 161
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.80 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3prpA00
3PSEA 4BOPA 3PT2A 4BOSA 5JZEA 3PRMA 3PHWA 3PHUA 4BOQA 4BOZA 4HXDB 3TMPA 3BY4A 3PHXA 3ZNHA 3PRPA 4BOUA 3C0RA
chains in the Genus database with same CATH superfamily
1U9QX 3MJ5A 1TL9A 3K8UA 1DKIA 5PADA 2OULA 2DC9A 4XZXA 1S4VA 3PRMA 1F29A 3KKUA 3B79A 5J94A 2HWKA 2G6DA 3LFYA 4ZUXU 2DC7A 4BS6A 3TMPA 2ATOA 1JQPA 4CDFB 4I07A 1AU0A 2FO5A 4D8EA 1MDWA 3KSEA 5JH3A 2AUXA 3IOQA 1EWPA 2Z84A 2HH5A 3MP2A 3OVXA 5EZSA 4W5BA 3GCBA 4PP1A 2OZ2A 1AECA 4BOSA 2J7QA 4PADA 3HHIA 1ICFA 3S3QA 2R9CA 4XUIA 4YYQA 1CSBB 2DJFB 1THEA 1VSNA 1XKGA 2VHFA 4YVAA 1UKFA 3N3GA 7PCKA 3PHXA 2G8JA 3PT2A 1KHPA 1QOLA 2B1MA 3RNVA 1AYUA 3P5XA 4Q8GA 2AS8A 4BQVA 1BGOA 2DC8A 1ITOA 4N8WA 1PPDA 3B21A 4MSXA 1EF7A 4MZOA 4RF1A 3LXSA 3O1GA 2NQIA 3ZNHA 3QT4A 3OF8A 2G8EA 2PNSA 1Y4HA 2F1GA 3PW3A 1CVZA 4BPVA 2YJ8A 2JRIA 3H6SA 4X6JA 2AU1A 4PP2E 1KXRA 2HD5A 2R9NA 4OVZB 3WXGA 1NB5A 2J7QC 1DEUA 4YYVA 3N3KA 2OP3A 3MHSA 3CH3X 2BDLA 1YVBA 4RNAA 2FE8A 1TLOA 1F2AA 3H89A 3USVA 1U9XA 3PHUA 4YYUA 1K3BB 1EWLA 4CDEB 2CIOA 3QJ3A 4OELA 1U5IA 5CVMA 4HWYA 3KX1A 3P5WA 1U9WA 4GUAA 2DZZA 2YJ2A 1EWOA 1BP4A 3WXEA 4CDDB 1POPA 4QH6A 2PADA 3F75A 4XR7A 4AXMA 2IPPB 3N4CA 3MTNA 5EF4A 3PHWA 3H8BA 9PAPA 2XU3A 2GFOA 4DMXA 5CHVA 1NL6A 5CVOB 3BPMA 4QRVA 1F2BA 1ME3A 1AU4A 2Y6EA 3E9SA 2FRQA 2XU5A 4I05A 3I3TA 1MS6A 3TNXA 3E1ZB 3HWNA 5CVNB 2DCBA 5FPWA 3BY4A 3KWBX 4ZTBA 4BOQA 4BS5A 5A24A 2DCAA 2JQFR 1Q6KA 2E01A 3RVVA 1CS8A 4MZSA 4X6HA 4Q8HA 5EZQA 4FIPA 2FT2A 1YALA 3KFQA 2G7YA 4D8IA 1AYWA 3PRPA 3PDFA 2FTDA 4WURA 2R9FA 2AYOA 3QSDA 5E6JA 2UZJA 3O65A 2BTWA 1DF0A 3U8EA 1PPOA 3M99A 4X6IA 3OF9A 4FK5A 2DCDA 4PT5A 2P0RA 4IP3A 2AUZA 2O6XA 1CJLA 2ARYA 3RVWA 1QMYA 4REZA 4MM3B 5CHTA 3C0RA 6PADA 3NHEA 2AGAA 2CB5A 2VHSA 1GECE 4OVZA 1IWDA 3CH2X 1ATKA 1BY8A 1PIPA 1NLJA 4QRGA 3P5VA 4P6EA 4FJCA 3WXFA 4OEMA 4AXLA 4W4UA 3PNRA 1CB5A 3BOWA 1NQCA 2DCCA 2WBFX 1PCIA 3H7DA 4CDCB 4I04A 4N4ZA 4A5UA 2R9MA 4BOPA 2NQDB 4M0WA 2E03A 3I06A 1MEGA 1GCBA 3F5VA 5JZEA 3P5UA 3W30A 3BPFA 3K24A 4P16A 3PBHA 3D6SA 1F2CA 5EGWA 4YYWA 1AU3A 1STFE 3OISA 1VJVA 3V6CA 4RY2A 3HHAA 4BSQA 1KFXL 3S3RA 2AVWA 1GMYA 2GHUA 1ME4A 4CZWA 1NPZA 1YK7A 2FUDA 2C0YA 3HD3A 1SP4B 2XU4A 4WA6A 1TU6A 3TRKA 1PE6A 2ACTA 2PREA 1QXPA 2BU3A 2Y5BA 1NB3A 1PPPA 2H7JA 1PBHA 1HUCB 2P7UA 2P86A 1GLOA 4RKXA 2NQGA 3OQCA 4HXDB 1A6RA 1YK8A 2FRAA 2XU1A 3BB7A 3MHHA 1AU2A 2R6NA 3CBJA 3CBKA 4BOUA 3BC3A 3ERVA 5JA7A 1KFUL 2F7DA 4BOZA 3H8CA 8PCHA 2IBIA 3PSEA 2E00A 4G54A 2YJCA 2JTCA 4RF0A 1U9VA 4MI7A 2YJBA 3IEJA 4YV8A 2PBHA 2HHNA 5K16A 3AI8A 4N79A 1CV8A 3BWKA 4KLBA 2JQGR 3MTVA 3O0UA 3W31A 2FYEA 3BCNA 1PXVA 5F02A 2B1NA 4P6GA 4QBBA 2BTWB 1MIRA 2NQAA 2FQ9A 4IUMA 1X9YA 4R3DA 3RVXA 2DC6A 1YT7A 1SNKA 1O0EA 2AIMA 2DZYA 2DOSA 1CPJA 2DJGB 1Y08A 2BDZA 1BQIA 1M6DA 3BBAA 3KW9A 4D8BA 4PI3A 1MEMA 2AYNA 1EWMA 3V6EA 2YJ9A 1ZCMA 1KHQA 3KWZA 1CTEA 1MHWA 2R9OA 4YYSA 1PPNA 4K7CA 1FH0A 2E02A 1CQDA 4DMYA 1PVJA 3DF0A 3OVZA 1YZBA 4QRXA 1QDQA 3IMAA 3IUTA 3MORA 4YYRA 3IFUA 3IV2A 1ZIVA 1AIMA 1PADA 5KO3A 3K9MA 4OW0A 1AYVA 3ZUAA 3IHPA 3C9EA 4W5CA 2HXZA
chains in the Genus database with same CATH topology
3MJ5A 3BB7A 1DKIA 4RNAA 4BOUA 4PT5A 4IP3A 2FE8A 4XZXA 3PRMA 3PHUA 4BOZA 4REZA 4MM3B 3C0RA 3PSEA 2HWKA 3TMPA 2JTCA 4RF0A 2AGAA 4MI7A 4OVZA 4D8EA 4GUAA 2Z84A 3MP2A 3MTVA 3W31A 5EZSA 4BOSA 3PHWA 2J7QA 2BTWB 4IUMA 4A5UA 4R3DA 4BOPA 4M0WA 5JZEA 1UKFA 2DOSA 3W30A 3PHXA 3E9SA 3PT2A 4P16A 3BBAA 4D8BA 3RNVA 3BY4A 3B21A 4ZTBA 4RF1A 4BOQA 3ZNHA 5EZQA 1PVJA 1YZBA 4D8IA 3IFUA 3TRKA 3PRPA 2BU3A 2JRIA 5KO3A 4WURA 4OW0A 5E6JA 2UZJA 3O65A 4RKXA 4OVZB 2BTWA 3OQCA 4HXDB 2J7QC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PSE A;  4BOP A;  3PT2 A;  4BOS A;  5JZE A;  3PRM A;  3PHW A;  3PHU A;  4BOQ A;  4BOZ A;  4HXD B;  3TMP A;  3BY4 A;  3PHX A;  3ZNH A;  3PRP A;  4BOU A;  3C0R A; 
#chains in the Genus database with same CATH topology
 1U9Q X;  3MJ5 A;  1TL9 A;  3K8U A;  1DKI A;  5PAD A;  2OUL A;  2DC9 A;  4XZX A;  1S4V A;  3PRM A;  1F29 A;  3KKU A;  3B79 A;  5J94 A;  2HWK A;  2G6D A;  3LFY A;  4ZUX U;  2DC7 A;  4BS6 A;  3TMP A;  2ATO A;  1JQP A;  4CDF B;  4I07 A;  1AU0 A;  2FO5 A;  4D8E A;  1MDW A;  3KSE A;  5JH3 A;  2AUX A;  3IOQ A;  1EWP A;  2Z84 A;  2HH5 A;  3MP2 A;  3OVX A;  5EZS A;  4W5B A;  3GCB A;  4PP1 A;  2OZ2 A;  1AEC A;  4BOS A;  2J7Q A;  4PAD A;  3HHI A;  1ICF A;  3S3Q A;  2R9C A;  4XUI A;  4YYQ A;  1CSB B;  2DJF B;  1THE A;  1VSN A;  1XKG A;  2VHF A;  4YVA A;  1UKF A;  3N3G A;  7PCK A;  3PHX A;  2G8J A;  3PT2 A;  1KHP A;  1QOL A;  2B1M A;  3RNV A;  1AYU A;  3P5X A;  4Q8G A;  2AS8 A;  4BQV A;  1BGO A;  2DC8 A;  1ITO A;  4N8W A;  1PPD A;  3B21 A;  4MSX A;  1EF7 A;  4MZO A;  4RF1 A;  3LXS A;  3O1G A;  2NQI A;  3ZNH A;  3QT4 A;  3OF8 A;  2G8E A;  2PNS A;  1Y4H A;  2F1G A;  3PW3 A;  1CVZ A;  4BPV A;  2YJ8 A;  2JRI A;  3H6S A;  4X6J A;  2AU1 A;  4PP2 E;  1KXR A;  2HD5 A;  2R9N A;  4OVZ B;  3WXG A;  1NB5 A;  2J7Q C;  1DEU A;  4YYV A;  3N3K A;  2OP3 A;  3MHS A;  3CH3 X;  2BDL A;  1YVB A;  4RNA A;  2FE8 A;  1TLO A;  1F2A A;  3H89 A;  3USV A;  1U9X A;  3PHU A;  4YYU A;  1K3B B;  1EWL A;  4CDE B;  2CIO A;  3QJ3 A;  4OEL A;  1U5I A;  5CVM A;  4HWY A;  3KX1 A;  3P5W A;  1U9W A;  4GUA A;  2DZZ A;  2YJ2 A;  1EWO A;  1BP4 A;  3WXE A;  4CDD B;  1POP A;  4QH6 A;  2PAD A;  3F75 A;  4XR7 A;  4AXM A;  2IPP B;  3N4C A;  3MTN A;  5EF4 A;  3PHW A;  3H8B A;  9PAP A;  2XU3 A;  2GFO A;  4DMX A;  5CHV A;  1NL6 A;  5CVO B;  3BPM A;  4QRV A;  1F2B A;  1ME3 A;  1AU4 A;  2Y6E A;  3E9S A;  2FRQ A;  2XU5 A;  4I05 A;  3I3T A;  1MS6 A;  3TNX A;  3E1Z B;  3HWN A;  5CVN B;  2DCB A;  5FPW A;  3BY4 A;  3KWB X;  4ZTB A;  4BOQ A;  4BS5 A;  5A24 A;  2DCA A;  2JQF R;  1Q6K A;  2E01 A;  3RVV A;  1CS8 A;  4MZS A;  4X6H A;  4Q8H A;  5EZQ A;  4FIP A;  2FT2 A;  1YAL A;  3KFQ A;  2G7Y A;  4D8I A;  1AYW A;  3PRP A;  3PDF A;  2FTD A;  4WUR A;  2R9F A;  2AYO A;  3QSD A;  5E6J A;  2UZJ A;  3O65 A;  2BTW A;  1DF0 A;  3U8E A;  1PPO A;  3M99 A;  4X6I A;  3OF9 A;  4FK5 A;  2DCD A;  4PT5 A;  2P0R A;  4IP3 A;  2AUZ A;  2O6X A;  1CJL A;  2ARY A;  3RVW A;  1QMY A;  4REZ A;  4MM3 B;  5CHT A;  3C0R A;  6PAD A;  3NHE A;  2AGA A;  2CB5 A;  2VHS A;  1GEC E;  4OVZ A;  1IWD A;  3CH2 X;  1ATK A;  1BY8 A;  1PIP A;  1NLJ A;  4QRG A;  3P5V A;  4P6E A;  4FJC A;  3WXF A;  4OEM A;  4AXL A;  4W4U A;  3PNR A;  1CB5 A;  3BOW A;  1NQC A;  2DCC A;  2WBF X;  1PCI A;  3H7D A;  4CDC B;  4I04 A;  4N4Z A;  4A5U A;  2R9M A;  4BOP A;  2NQD B;  4M0W A;  2E03 A;  3I06 A;  1MEG A;  1GCB A;  3F5V A;  5JZE A;  3P5U A;  3W30 A;  3BPF A;  3K24 A;  4P16 A;  3PBH A;  3D6S A;  1F2C A;  5EGW A;  4YYW A;  1AU3 A;  1STF E;  3OIS A;  1VJV A;  3V6C A;  4RY2 A;  3HHA A;  4BSQ A;  1KFX L;  3S3R A;  2AVW A;  1GMY A;  2GHU A;  1ME4 A;  4CZW A;  1NPZ A;  1YK7 A;  2FUD A;  2C0Y A;  3HD3 A;  1SP4 B;  2XU4 A;  4WA6 A;  1TU6 A;  3TRK A;  1PE6 A;  2ACT A;  2PRE A;  1QXP A;  2BU3 A;  2Y5B A;  1NB3 A;  1PPP A;  2H7J A;  1PBH A;  1HUC B;  2P7U A;  2P86 A;  1GLO A;  4RKX A;  2NQG A;  3OQC A;  4HXD B;  1A6R A;  1YK8 A;  2FRA A;  2XU1 A;  3BB7 A;  3MHH A;  1AU2 A;  2R6N A;  3CBJ A;  3CBK A;  4BOU A;  3BC3 A;  3ERV A;  5JA7 A;  1KFU L;  2F7D A;  4BOZ A;  3H8C A;  8PCH A;  2IBI A;  3PSE A;  2E00 A;  4G54 A;  2YJC A;  2JTC A;  4RF0 A;  1U9V A;  4MI7 A;  2YJB A;  3IEJ A;  4YV8 A;  2PBH A;  2HHN A;  5K16 A;  3AI8 A;  4N79 A;  1CV8 A;  3BWK A;  4KLB A;  2JQG R;  3MTV A;  3O0U A;  3W31 A;  2FYE A;  3BCN A;  1PXV A;  5F02 A;  2B1N A;  4P6G A;  4QBB A;  2BTW B;  1MIR A;  2NQA A;  2FQ9 A;  4IUM A;  1X9Y A;  4R3D A;  3RVX A;  2DC6 A;  1YT7 A;  1SNK A;  1O0E A;  2AIM A;  2DZY A;  2DOS A;  1CPJ A;  2DJG B;  1Y08 A;  2BDZ A;  1BQI A;  1M6D A;  3BBA A;  3KW9 A;  4D8B A;  4PI3 A;  1MEM A;  2AYN A;  1EWM A;  3V6E A;  2YJ9 A;  1ZCM A;  1KHQ A;  3KWZ A;  1CTE A;  1MHW A;  2R9O A;  4YYS A;  1PPN A;  4K7C A;  1FH0 A;  2E02 A;  1CQD A;  4DMY A;  1PVJ A;  3DF0 A;  3OVZ A;  1YZB A;  4QRX A;  1QDQ A;  3IMA A;  3IUT A;  3MOR A;  4YYR A;  3IFU A;  3IV2 A;  1ZIV A;  1AIM A;  1PAD A;  5KO3 A;  3K9M A;  4OW0 A;  1AYV A;  3ZUA A;  3IHP A;  3C9E A;  4W5C A;  2HXZ A; 
#chains in the Genus database with same CATH homology
 3MJ5 A;  3BB7 A;  1DKI A;  4RNA A;  4BOU A;  4PT5 A;  4IP3 A;  2FE8 A;  4XZX A;  3PRM A;  3PHU A;  4BOZ A;  4REZ A;  4MM3 B;  3C0R A;  3PSE A;  2HWK A;  3TMP A;  2JTC A;  4RF0 A;  2AGA A;  4MI7 A;  4OVZ A;  4D8E A;  4GUA A;  2Z84 A;  3MP2 A;  3MTV A;  3W31 A;  5EZS A;  4BOS A;  3PHW A;  2J7Q A;  2BTW B;  4IUM A;  4A5U A;  4R3D A;  4BOP A;  4M0W A;  5JZE A;  1UKF A;  2DOS A;  3W30 A;  3PHX A;  3E9S A;  3PT2 A;  4P16 A;  3BBA A;  4D8B A;  3RNV A;  3BY4 A;  3B21 A;  4ZTB A;  4RF1 A;  4BOQ A;  3ZNH A;  5EZQ A;  1PVJ A;  1YZB A;  4D8I A;  3IFU A;  3TRK A;  3PRP A;  2BU3 A;  2JRI A;  5KO3 A;  4WUR A;  4OW0 A;  5E6J A;  2UZJ A;  3O65 A;  4RKX A;  4OVZ B;  2BTW A;  3OQC A;  4HXD B;  2J7Q C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...