3PRPA

Structural analysis of a viral otu domain protease from the crimean-congo hemorrhagic fever virus in complex with human ubiquitin
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
161
structure length
161
Chain Sequence
b'DFLRSLDWTQVIAGQYVSNPRFNISDYFEIVRQPGDGNCFYHSIAELTMPNKTDHSYHYIKRLTESAARKYYQEEPEARLVGLSLEDYLKRMLSDNEWGSTLEASMLAKEMGITIIIWTVAASDEVEAGIKFGDGDVFTAVNLLHSGQTHFDALRILPQFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L protein
publication title Structural analysis of a viral ovarian tumor domain protease from the crimean-congo hemorrhagic Fever virus in complex with covalently bonded ubiquitin.
pubmed doi rcsb
source organism Crimean-congo hemorrhagic fever virus
molecule tags Hydrolase/hydrolase
total genus 47
structure length 161
sequence length 161
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.80 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3prpA00
4BOQA 3PHWA 3C0RA 3PRPA 4BOUA 3PHXA 3PRMA 3PT2A 3TMPA 4BOZA 5JZEA 3PHUA 3PSEA 4HXDB 4BOSA 4BOPA 3ZNHA 3BY4A
chains in the Genus database with same CATH superfamily
2P7UA 1AU3A 2WBFX 4OELA 3O1GA 4BOSA 4QRGA 3OISA 1VSNA 3MJ5A 3E1ZB 3USVA 3D6SA 3H8CA 2YJ9A 1MEMA 3IV2A 4X6JA 5CVOB 2HHNA 2HXZA 1K3BB 1MHWA 3RVVA 2R6NA 4QRXA 1X9YA 4OVZB 1SP4B 3IEJA 2VHFA 3E9SA 3KX1A 1ME4A 2YJCA 2IPPB 4P6GA 1CPJA 3N3KA 3PRMA 2AYNA 4YV8A 1YVBA 4WURA 1QOLA 4AXLA 4MZSA 4Q8HA 3O0UA 5CHTA 1PXVA 1U9XA 3BWKA 2R9FA 3BPMA 2FE8A 2VHSA 1TL9A 2XU3A 1YALA 1ZCMA 1ITOA 5F02A 2J7QA 2AUXA 8PCHA 1HUCB 2CIOA 4BOZA 5CVMA 2NQAA 4OEMA 2JTCA 4BS6A 2OZ2A 1O0EA 2DC8A 4G54A 4A5UA 5A24A 1MIRA 2BTWB 2FT2A 1PPOA 1F29A 3WXFA 3PHWA 3PW3A 1DEUA 4RNAA 4YYSA 4HXDB 1CB5A 2G6DA 2B1MA 3M99A 1F2AA 2XU4A 1DKIA 3MHHA 2NQGA 4XUIA 1EF7A 4YYVA 3ERVA 2BDZA 4QH6A 2DCBA 2C0YA 1JQPA 4DMXA 4ZUXU 1MEGA 3N3GA 3IHPA 2AS8A 1PE6A 3BY4A 1AU2A 3C0RA 3KW9A 3O65A 4BOUA 3PNRA 4CDFB 1QMYA 3PRPA 2FYEA 5E6JA 2DCAA 3B79A 1Q6KA 2AGAA 2FRAA 3F5VA 1M6DA 3TMPA 4WA6A 1MDWA 3KWBX 2Y5BA 1CV8A 3OF8A 3QSDA 3KSEA 3KWZA 4MM3B 3I3TA 1Y08A 4IUMA 4PADA 3C9EA 4BSQA 2B1NA 2AVWA 4IP3A 4FIPA 3OVZA 4M0WA 1YZBA 1ATKA 1AU4A 1YT7A 1S4VA 2FTDA 1YK8A 2GFOA 1AYWA 2PBHA 4PP1A 4CZWA 3CH3X 1IWDA 4X6HA 5K16A 5JH3A 4N8WA 4RF0A 2UZJA 3TNXA 4QRVA 2FRQA 1POPA 3HWNA 2Z84A 1NB5A 1AYVA 3BCNA 4BS5A 2DCCA 3IUTA 4MSXA 4GUAA 2JQFR 3S3RA 5JA7A 1AIMA 2NQIA 7PCKA 3F75A 3MHSA 3OVXA 1THEA 2AUZA 3H7DA 1CSBB 3W31A 4BQVA 2R9OA 2OP3A 2H7JA 3AI8A 2YJ2A 2R9CA 4W5CA 1QXPA 2R9NA 3B21A 3HHAA 4PI3A 5EF4A 1U5IA 4I04A 3P5UA 3IFUA 1FH0A 1PBHA 3H89A 1AYUA 3OQCA 1BGOA 2IBIA 4D8IA 4W4UA 2XU1A 1U9WA 2DZYA 2BDLA 2F1GA 1PCIA 3MP2A 1PVJA 5EZQA 3HD3A 2FUDA 3CBKA 2J7QC 5EZSA 2O6XA 1ME3A 1ICFA 4YYRA 2P86A 3S3QA 5J94A 3RVXA 4OVZA 2BU3A 5JZEA 1UKFA 2DZZA 4D8BA 2FO5A 1PPDA 3PT2A 2YJBA 3N4CA 2OULA 3TRKA 3NHEA 1NQCA 3QJ3A 4P16A 2DC7A 1NPZA 1U9VA 4MZOA 3DF0A 2YJ8A 4QBBA 4XZXA 5EGWA 3BBAA 3P5VA 3RNVA 1GECE 4X6IA 4R3DA 2NQDB 2BTWA 4BOPA 2HD5A 2Y6EA 1STFE 4YYQA 3LFYA 1EWLA 2G8EA 3BOWA 2XU5A 4YYUA 3PHUA 1Y4HA 1EWMA 3CBJA 3BC3A 2G8JA 2DC9A 3GCBA 1SNKA 1CVZA 1ZIVA 1PPPA 3KKUA 3P5WA 3QT4A 5FPWA 3W30A 3P5XA 3H6SA 2ATOA 4FJCA 1F2CA 3WXGA 1DF0A 1CS8A 4W5BA 5CVNB 9PAPA 1TU6A 4YVAA 3K24A 3MTNA 1VJVA 2JRIA 1PPNA 4I05A 2G7YA 1CTEA 3PSEA 4CDEB 4KLBA 3RVWA 2ARYA 3H8BA 4ZTBA 1BY8A 4REZA 4AXMA 1QDQA 2DJFB 3WXEA 2AIMA 3MTVA 3U8EA 4DMYA 2DC6A 1U9QX 3CH2X 3HHIA 3PHXA 4XR7A 2AYOA 4BOQA 4D8EA 2JQGR 2E00A 4FK5A 2GHUA 2HWKA 3LXSA 4HWYA 1NB3A 4PT5A 4BPVA 1AU0A 1CQDA 2ACTA 2R9MA 2PREA 2F7DA 1CJLA 2DCDA 5PADA 4OW0A 1F2BA 1XKGA 2E02A 3KFQA 1BQIA 1GLOA 4Q8GA 1KFUL 4RF1A 2DJGB 1KFXL 2E03A 3ZNHA 3IMAA 1A6RA 3K9MA 1PADA 4RKXA 2P0RA 4MI7A 3V6CA 2HH5A 1NLJA 1EWPA 1PIPA 1MS6A 4PP2E 1AECA 1NL6A 4CDDB 2PNSA 1GCBA 3MORA 3ZUAA 3BPFA 2CB5A 1KHQA 1TLOA 1EWOA 4I07A 1BP4A 3I06A 5KO3A 4CDCB 3PBHA 4N4ZA 4K7CA 6PADA 2E01A 3IOQA 4P6EA 1KHPA 4RY2A 4YYWA 4N79A 2AU1A 1YK7A 3OF9A 1KXRA 3V6EA 1GMYA 3K8UA 2FQ9A 2PADA 5CHVA 2DOSA 3BB7A 3PDFA
chains in the Genus database with same CATH topology
3IFUA 3OQCA 3PSEA 4BOSA 3MJ5A 4ZTBA 4REZA 4D8IA 3BY4A 3C0RA 3MTVA 3MP2A 1PVJA 5EZQA 3O65A 4BOUA 2J7QC 5EZSA 3PRPA 3PHXA 5E6JA 4OVZA 2BU3A 4BOQA 4D8EA 2AGAA 2HWKA 4OVZB 1UKFA 3TMPA 4D8BA 5JZEA 3E9SA 3PT2A 4PT5A 4MM3B 4IUMA 3TRKA 3PRMA 4IP3A 4M0WA 4P16A 4OW0A 4WURA 1YZBA 4XZXA 3BBAA 3RNVA 4RF1A 4R3DA 2FE8A 2BTWA 4BOPA 3ZNHA 2J7QA 4RKXA 4MI7A 4RF0A 2UZJA 4BOZA 3PHUA 2JTCA 2Z84A 4A5UA 2BTWB 4GUAA 3W30A 5KO3A 3PHWA 4RNAA 3W31A 4HXDB 1DKIA 3B21A 2DOSA 3BB7A 2JRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BOQ A;  3PHW A;  3C0R A;  3PRP A;  4BOU A;  3PHX A;  3PRM A;  3PT2 A;  3TMP A;  4BOZ A;  5JZE A;  3PHU A;  3PSE A;  4HXD B;  4BOS A;  4BOP A;  3ZNH A;  3BY4 A; 
#chains in the Genus database with same CATH topology
 2P7U A;  1AU3 A;  2WBF X;  4OEL A;  3O1G A;  4BOS A;  4QRG A;  3OIS A;  1VSN A;  3MJ5 A;  3E1Z B;  3USV A;  3D6S A;  3H8C A;  2YJ9 A;  1MEM A;  3IV2 A;  4X6J A;  5CVO B;  2HHN A;  2HXZ A;  1K3B B;  1MHW A;  3RVV A;  2R6N A;  4QRX A;  1X9Y A;  4OVZ B;  1SP4 B;  3IEJ A;  2VHF A;  3E9S A;  3KX1 A;  1ME4 A;  2YJC A;  2IPP B;  4P6G A;  1CPJ A;  3N3K A;  3PRM A;  2AYN A;  4YV8 A;  1YVB A;  4WUR A;  1QOL A;  4AXL A;  4MZS A;  4Q8H A;  3O0U A;  5CHT A;  1PXV A;  1U9X A;  3BWK A;  2R9F A;  3BPM A;  2FE8 A;  2VHS A;  1TL9 A;  2XU3 A;  1YAL A;  1ZCM A;  1ITO A;  5F02 A;  2J7Q A;  2AUX A;  8PCH A;  1HUC B;  2CIO A;  4BOZ A;  5CVM A;  2NQA A;  4OEM A;  2JTC A;  4BS6 A;  2OZ2 A;  1O0E A;  2DC8 A;  4G54 A;  4A5U A;  5A24 A;  1MIR A;  2BTW B;  2FT2 A;  1PPO A;  1F29 A;  3WXF A;  3PHW A;  3PW3 A;  1DEU A;  4RNA A;  4YYS A;  4HXD B;  1CB5 A;  2G6D A;  2B1M A;  3M99 A;  1F2A A;  2XU4 A;  1DKI A;  3MHH A;  2NQG A;  4XUI A;  1EF7 A;  4YYV A;  3ERV A;  2BDZ A;  4QH6 A;  2DCB A;  2C0Y A;  1JQP A;  4DMX A;  4ZUX U;  1MEG A;  3N3G A;  3IHP A;  2AS8 A;  1PE6 A;  3BY4 A;  1AU2 A;  3C0R A;  3KW9 A;  3O65 A;  4BOU A;  3PNR A;  4CDF B;  1QMY A;  3PRP A;  2FYE A;  5E6J A;  2DCA A;  3B79 A;  1Q6K A;  2AGA A;  2FRA A;  3F5V A;  1M6D A;  3TMP A;  4WA6 A;  1MDW A;  3KWB X;  2Y5B A;  1CV8 A;  3OF8 A;  3QSD A;  3KSE A;  3KWZ A;  4MM3 B;  3I3T A;  1Y08 A;  4IUM A;  4PAD A;  3C9E A;  4BSQ A;  2B1N A;  2AVW A;  4IP3 A;  4FIP A;  3OVZ A;  4M0W A;  1YZB A;  1ATK A;  1AU4 A;  1YT7 A;  1S4V A;  2FTD A;  1YK8 A;  2GFO A;  1AYW A;  2PBH A;  4PP1 A;  4CZW A;  3CH3 X;  1IWD A;  4X6H A;  5K16 A;  5JH3 A;  4N8W A;  4RF0 A;  2UZJ A;  3TNX A;  4QRV A;  2FRQ A;  1POP A;  3HWN A;  2Z84 A;  1NB5 A;  1AYV A;  3BCN A;  4BS5 A;  2DCC A;  3IUT A;  4MSX A;  4GUA A;  2JQF R;  3S3R A;  5JA7 A;  1AIM A;  2NQI A;  7PCK A;  3F75 A;  3MHS A;  3OVX A;  1THE A;  2AUZ A;  3H7D A;  1CSB B;  3W31 A;  4BQV A;  2R9O A;  2OP3 A;  2H7J A;  3AI8 A;  2YJ2 A;  2R9C A;  4W5C A;  1QXP A;  2R9N A;  3B21 A;  3HHA A;  4PI3 A;  5EF4 A;  1U5I A;  4I04 A;  3P5U A;  3IFU A;  1FH0 A;  1PBH A;  3H89 A;  1AYU A;  3OQC A;  1BGO A;  2IBI A;  4D8I A;  4W4U A;  2XU1 A;  1U9W A;  2DZY A;  2BDL A;  2F1G A;  1PCI A;  3MP2 A;  1PVJ A;  5EZQ A;  3HD3 A;  2FUD A;  3CBK A;  2J7Q C;  5EZS A;  2O6X A;  1ME3 A;  1ICF A;  4YYR A;  2P86 A;  3S3Q A;  5J94 A;  3RVX A;  4OVZ A;  2BU3 A;  5JZE A;  1UKF A;  2DZZ A;  4D8B A;  2FO5 A;  1PPD A;  3PT2 A;  2YJB A;  3N4C A;  2OUL A;  3TRK A;  3NHE A;  1NQC A;  3QJ3 A;  4P16 A;  2DC7 A;  1NPZ A;  1U9V A;  4MZO A;  3DF0 A;  2YJ8 A;  4QBB A;  4XZX A;  5EGW A;  3BBA A;  3P5V A;  3RNV A;  1GEC E;  4X6I A;  4R3D A;  2NQD B;  2BTW A;  4BOP A;  2HD5 A;  2Y6E A;  1STF E;  4YYQ A;  3LFY A;  1EWL A;  2G8E A;  3BOW A;  2XU5 A;  4YYU A;  3PHU A;  1Y4H A;  1EWM A;  3CBJ A;  3BC3 A;  2G8J A;  2DC9 A;  3GCB A;  1SNK A;  1CVZ A;  1ZIV A;  1PPP A;  3KKU A;  3P5W A;  3QT4 A;  5FPW A;  3W30 A;  3P5X A;  3H6S A;  2ATO A;  4FJC A;  1F2C A;  3WXG A;  1DF0 A;  1CS8 A;  4W5B A;  5CVN B;  9PAP A;  1TU6 A;  4YVA A;  3K24 A;  3MTN A;  1VJV A;  2JRI A;  1PPN A;  4I05 A;  2G7Y A;  1CTE A;  3PSE A;  4CDE B;  4KLB A;  3RVW A;  2ARY A;  3H8B A;  4ZTB A;  1BY8 A;  4REZ A;  4AXM A;  1QDQ A;  2DJF B;  3WXE A;  2AIM A;  3MTV A;  3U8E A;  4DMY A;  2DC6 A;  1U9Q X;  3CH2 X;  3HHI A;  3PHX A;  4XR7 A;  2AYO A;  4BOQ A;  4D8E A;  2JQG R;  2E00 A;  4FK5 A;  2GHU A;  2HWK A;  3LXS A;  4HWY A;  1NB3 A;  4PT5 A;  4BPV A;  1AU0 A;  1CQD A;  2ACT A;  2R9M A;  2PRE A;  2F7D A;  1CJL A;  2DCD A;  5PAD A;  4OW0 A;  1F2B A;  1XKG A;  2E02 A;  3KFQ A;  1BQI A;  1GLO A;  4Q8G A;  1KFU L;  4RF1 A;  2DJG B;  1KFX L;  2E03 A;  3ZNH A;  3IMA A;  1A6R A;  3K9M A;  1PAD A;  4RKX A;  2P0R A;  4MI7 A;  3V6C A;  2HH5 A;  1NLJ A;  1EWP A;  1PIP A;  1MS6 A;  4PP2 E;  1AEC A;  1NL6 A;  4CDD B;  2PNS A;  1GCB A;  3MOR A;  3ZUA A;  3BPF A;  2CB5 A;  1KHQ A;  1TLO A;  1EWO A;  4I07 A;  1BP4 A;  3I06 A;  5KO3 A;  4CDC B;  3PBH A;  4N4Z A;  4K7C A;  6PAD A;  2E01 A;  3IOQ A;  4P6E A;  1KHP A;  4RY2 A;  4YYW A;  4N79 A;  2AU1 A;  1YK7 A;  3OF9 A;  1KXR A;  3V6E A;  1GMY A;  3K8U A;  2FQ9 A;  2PAD A;  5CHV A;  2DOS A;  3BB7 A;  3PDF A; 
#chains in the Genus database with same CATH homology
 3IFU A;  3OQC A;  3PSE A;  4BOS A;  3MJ5 A;  4ZTB A;  4REZ A;  4D8I A;  3BY4 A;  3C0R A;  3MTV A;  3MP2 A;  1PVJ A;  5EZQ A;  3O65 A;  4BOU A;  2J7Q C;  5EZS A;  3PRP A;  3PHX A;  5E6J A;  4OVZ A;  2BU3 A;  4BOQ A;  4D8E A;  2AGA A;  2HWK A;  4OVZ B;  1UKF A;  3TMP A;  4D8B A;  5JZE A;  3E9S A;  3PT2 A;  4PT5 A;  4MM3 B;  4IUM A;  3TRK A;  3PRM A;  4IP3 A;  4M0W A;  4P16 A;  4OW0 A;  4WUR A;  1YZB A;  4XZX A;  3BBA A;  3RNV A;  4RF1 A;  4R3D A;  2FE8 A;  2BTW A;  4BOP A;  3ZNH A;  2J7Q A;  4RKX A;  4MI7 A;  4RF0 A;  2UZJ A;  4BOZ A;  3PHU A;  2JTC A;  2Z84 A;  4A5U A;  2BTW B;  4GUA A;  3W30 A;  5KO3 A;  3PHW A;  4RNA A;  3W31 A;  4HXD B;  1DKI A;  3B21 A;  2DOS A;  3BB7 A;  2JRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...