3PRPA

Structural analysis of a viral otu domain protease from the crimean-congo hemorrhagic fever virus in complex with human ubiquitin
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
161
structure length
161
Chain Sequence
DFLRSLDWTQVIAGQYVSNPRFNISDYFEIVRQPGDGNCFYHSIAELTMPNKTDHSYHYIKRLTESAARKYYQEEPEARLVGLSLEDYLKRMLSDNEWGSTLEASMLAKEMGITIIIWTVAASDEVEAGIKFGDGDVFTAVNLLHSGQTHFDALRILPQFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase
molecule keywords L protein
publication title Structural analysis of a viral ovarian tumor domain protease from the crimean-congo hemorrhagic Fever virus in complex with covalently bonded ubiquitin.
pubmed doi rcsb
source organism Crimean-congo hemorrhagic fever virus
total genus 47
structure length 161
sequence length 161
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.80 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3prpA00
4BOPA 3TMPA 3ZNHA 5JZEA 3PRMA 4HXDB 3PHWA 3C0RA 3BY4A 3PHXA 3PRPA 4BOSA 4BOQA 4BOZA 3PT2A 3PHUA 4BOUA 3PSEA
chains in the Genus database with same CATH superfamily
1CTEA 4Q8GA 4IUMA 1MDWA 1PBHA 4YYWA 4P6EA 1YT7A 2DCAA 3WXGA 2DCDA 3LXSA 2AS8A 4Q8HA 4FK5A 2AYOA 1VSNA 4QRVA 2E02A 5K16A 2DZYA 1ICFA 2JQGR 3OF9A 1VJVA 3E1ZB 3MJ5A 2BDLA 1CS8A 4YYUA 2G8JA 1BQIA 1QDQA 2XU4A 1PPDA 3MHSA 4GUAA 2PBHA 3S3QA 2FQ9A 2Y6EA 2B1NA 5PADA 2IPPB 3P5WA 1QXPA 2R9FA 2BU3A 3MP2A 4ZTBA 6PADA 1Y08A 2HXZA 4P6GA 4YYRA 3CBKA 2R9OA 1YK7A 3ERVA 3H89A 1UKFA 2HHNA 2NQDB 1A6RA 2E03A 2PADA 4D8BA 3KWBX 2VHSA 1ATKA 4XZXA 4QRXA 2J7QC 4WURA 2AUZA 3USVA 2YJCA 1MEGA 1PE6A 1FH0A 1PPPA 3WXEA 4QRGA 1MS6A 1U9VA 2R6NA 3KX1A 4AXLA 1HUCB 1U9WA 2DJGB 2JQFR 1EWMA 3TNXA 1EWPA 3CH3X 1U9QX 2ARYA 3KSEA 3O0UA 2DC7A 3QT4A 2FO5A 3AI8A 2FRQA 2XU5A 3BC3A 2ACTA 3OQCA 4N4ZA 1KFUL 4CZWA 4N79A 3C9EA 4MZSA 4MSXA 1AIMA 1DKIA 3CH2X 3I06A 2R9CA 2DZZA 2DCCA 2FE8A 2J7QA 4G54A 3BY4A 2O6XA 1DF0A 5FPWA 5CVMA 5EZQA 3S3RA 1U9XA 1MIRA 1TU6A 4MZOA 1GLOA 3KW9A 1GECE 1YVBA 3IHPA 2FT2A 3IV2A 4RKXA 2CB5A 1Y4HA 2DC8A 3OVXA 4REZA 4IP3A 3IFUA 4YYVA 4BOQA 4PT5A 3V6EA 1PPOA 4FJCA 3TRKA 1AECA 5J94A 1ITOA 2JTCA 2NQGA 2DJFB 2FTDA 3BOWA 4RNAA 1AYWA 1EF7A 5A24A 2OP3A 2P0RA 3QSDA 3W30A 4BPVA 1KHQA 3PBHA 3QJ3A 2HD5A 3KFQA 1SNKA 1CJLA 1S4VA 3O1GA 4FIPA 4MI7A 1AU4A 1NLJA 3N4CA 4CDDB 1F2CA 2FRAA 3HHAA 4YV8A 2UZJA 3H8CA 3PSEA 4KLBA 3P5VA 3N3GA 2XU1A 3RVVA 5EZSA 3MORA 2BTWA 3OISA 3KKUA 1AU0A 1CB5A 2AGAA 2E01A 4X6HA 4PP2E 2YJ2A 8PCHA 4I05A 1EWLA 1TL9A 4A5UA 4CDFB 1PVJA 1BY8A 5F02A 3C0RA 3PT2A 9PAPA 4DMXA 3IEJA 4I04A 1CSBB 3E9SA 3M99A 3B79A 5CVOB 4M0WA 1AU3A 1M6DA 2BTWB 2AU1A 2DCBA 3H6SA 1POPA 2R9MA 1O0EA 2NQAA 2P7UA 3NHEA 1KHPA 5JH3A 2YJ9A 3K9MA 1JQPA 2GFOA 4MM3B 5EF4A 5EGWA 2B1MA 1ME4A 1ME3A 3F5VA 1PXVA 3DF0A 4BOUA 2GHUA 4D8EA 4D8IA 3I3TA 4BOPA 1YZBA 2AVWA 2YJ8A 3RVWA 2JRIA 3HHIA 2PREA 4HWYA 2WBFX 4OVZB 2ATOA 2YJBA 1BP4A 1MEMA 3OF8A 4R3DA 1Q6KA 4OEMA 2IBIA 4AXMA 2C0YA 2NQIA 1PCIA 3BCNA 1CPJA 1YALA 2DOSA 4K7CA 3P5UA 1KXRA 1AU2A 2H7JA 2F1GA 4P16A 2DC6A 2G6DA 3W31A 1PPNA 4WA6A 4QBBA 5CVNB 5E6JA 2OULA 3PRPA 3GCBA 3IMAA 2DC9A 4PP1A 1QOLA 4I07A 3WXFA 3D6SA 4XUIA 1IWDA 2G7YA 3V6CA 4PADA 4PI3A 3MTVA 2VHFA 2PNSA 7PCKA 2AUXA 3K8UA 4BS6A 1BGOA 1NPZA 3BBAA 1SP4B 3RNVA 3ZUAA 2FUDA 3TMPA 5CHTA 1CV8A 3PHXA 2AIMA 2Z84A 1THEA 5JZEA 5KO3A 3PHWA 4X6IA 2F7DA 3BPFA 5CHVA 1PADA 3U8EA 3B21A 2OZ2A 3BB7A 4CDCB 3PRMA 1EWOA 4YYQA 3RVXA 3ZNHA 1KFXL 4CDEB 3IUTA 1NB5A 1TLOA 4QH6A 3HWNA 3P5XA 4W5CA 1K3BB 1PIPA 1AYUA 2AYNA 4N8WA 2P86A 4OELA 4RF1A 1STFE 2FYEA 3OVZA 3HD3A 1CVZA 4YVAA 2Y5BA 4HXDB 2HH5A 1ZIVA 4BOZA 1U5IA 2HWKA 1F2AA 2R9NA 3CBJA 2BDZA 3F75A 3BPMA 3BWKA 4RF0A 4OVZA 3O65A 3PW3A 1GCBA 2XU3A 1MHWA 4W4UA 4BS5A 4BSQA 3MHHA 2CIOA 1F2BA 1GMYA 1CQDA 4OW0A 4RY2A 1DEUA 3H7DA 4BOSA 3H8BA 3PNRA 4DMYA 4BQVA 1AYVA 3PDFA 4X6JA 3K24A 1XKGA 1X9YA 1NB3A 4YYSA 1YK8A 1NL6A 1ZCMA 3N3KA 2G8EA 4ZUXU 1QMYA 2E00A 3LFYA 3PHUA 4W5BA 5JA7A 3KWZA 4XR7A 1NQCA 1F29A 3IOQA 3MTNA
chains in the Genus database with same CATH topology
3BBAA 4A5UA 4IUMA 3RNVA 1PVJA 3TMPA 3C0RA 3PHXA 3OQCA 3PT2A 2Z84A 5JZEA 5KO3A 3PHWA 3E9SA 1DKIA 4M0WA 3B21A 2BTWB 3BB7A 3PRMA 3ZNHA 2J7QA 2FE8A 3BY4A 3MJ5A 5EZQA 4MM3B 4RF1A 4GUAA 4BOUA 4RKXA 4HXDB 4D8EA 4D8IA 4REZA 4IP3A 4BOZA 3IFUA 4BOPA 1YZBA 4BOQA 2BU3A 2HWKA 4PT5A 3MP2A 4RF0A 4OVZA 4ZTBA 3O65A 3TRKA 2JRIA 4OVZB 2JTCA 4R3DA 4RNAA 4OW0A 2DOSA 3W30A 1UKFA 4P16A 4BOSA 4D8BA 3W31A 4XZXA 2J7QC 4WURA 5E6JA 3PRPA 4MI7A 2UZJA 3PSEA 3MTVA 5EZSA 2BTWA 3PHUA 2AGAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BOP A;  3TMP A;  3ZNH A;  5JZE A;  3PRM A;  4HXD B;  3PHW A;  3C0R A;  3BY4 A;  3PHX A;  3PRP A;  4BOS A;  4BOQ A;  4BOZ A;  3PT2 A;  3PHU A;  4BOU A;  3PSE A; 
#chains in the Genus database with same CATH topology
 1CTE A;  4Q8G A;  4IUM A;  1MDW A;  1PBH A;  4YYW A;  4P6E A;  1YT7 A;  2DCA A;  3WXG A;  2DCD A;  3LXS A;  2AS8 A;  4Q8H A;  4FK5 A;  2AYO A;  1VSN A;  4QRV A;  2E02 A;  5K16 A;  2DZY A;  1ICF A;  2JQG R;  3OF9 A;  1VJV A;  3E1Z B;  3MJ5 A;  2BDL A;  1CS8 A;  4YYU A;  2G8J A;  1BQI A;  1QDQ A;  2XU4 A;  1PPD A;  3MHS A;  4GUA A;  2PBH A;  3S3Q A;  2FQ9 A;  2Y6E A;  2B1N A;  5PAD A;  2IPP B;  3P5W A;  1QXP A;  2R9F A;  2BU3 A;  3MP2 A;  4ZTB A;  6PAD A;  1Y08 A;  2HXZ A;  4P6G A;  4YYR A;  3CBK A;  2R9O A;  1YK7 A;  3ERV A;  3H89 A;  1UKF A;  2HHN A;  2NQD B;  1A6R A;  2E03 A;  2PAD A;  4D8B A;  3KWB X;  2VHS A;  1ATK A;  4XZX A;  4QRX A;  2J7Q C;  4WUR A;  2AUZ A;  3USV A;  2YJC A;  1MEG A;  1PE6 A;  1FH0 A;  1PPP A;  3WXE A;  4QRG A;  1MS6 A;  1U9V A;  2R6N A;  3KX1 A;  4AXL A;  1HUC B;  1U9W A;  2DJG B;  2JQF R;  1EWM A;  3TNX A;  1EWP A;  3CH3 X;  1U9Q X;  2ARY A;  3KSE A;  3O0U A;  2DC7 A;  3QT4 A;  2FO5 A;  3AI8 A;  2FRQ A;  2XU5 A;  3BC3 A;  2ACT A;  3OQC A;  4N4Z A;  1KFU L;  4CZW A;  4N79 A;  3C9E A;  4MZS A;  4MSX A;  1AIM A;  1DKI A;  3CH2 X;  3I06 A;  2R9C A;  2DZZ A;  2DCC A;  2FE8 A;  2J7Q A;  4G54 A;  3BY4 A;  2O6X A;  1DF0 A;  5FPW A;  5CVM A;  5EZQ A;  3S3R A;  1U9X A;  1MIR A;  1TU6 A;  4MZO A;  1GLO A;  3KW9 A;  1GEC E;  1YVB A;  3IHP A;  2FT2 A;  3IV2 A;  4RKX A;  2CB5 A;  1Y4H A;  2DC8 A;  3OVX A;  4REZ A;  4IP3 A;  3IFU A;  4YYV A;  4BOQ A;  4PT5 A;  3V6E A;  1PPO A;  4FJC A;  3TRK A;  1AEC A;  5J94 A;  1ITO A;  2JTC A;  2NQG A;  2DJF B;  2FTD A;  3BOW A;  4RNA A;  1AYW A;  1EF7 A;  5A24 A;  2OP3 A;  2P0R A;  3QSD A;  3W30 A;  4BPV A;  1KHQ A;  3PBH A;  3QJ3 A;  2HD5 A;  3KFQ A;  1SNK A;  1CJL A;  1S4V A;  3O1G A;  4FIP A;  4MI7 A;  1AU4 A;  1NLJ A;  3N4C A;  4CDD B;  1F2C A;  2FRA A;  3HHA A;  4YV8 A;  2UZJ A;  3H8C A;  3PSE A;  4KLB A;  3P5V A;  3N3G A;  2XU1 A;  3RVV A;  5EZS A;  3MOR A;  2BTW A;  3OIS A;  3KKU A;  1AU0 A;  1CB5 A;  2AGA A;  2E01 A;  4X6H A;  4PP2 E;  2YJ2 A;  8PCH A;  4I05 A;  1EWL A;  1TL9 A;  4A5U A;  4CDF B;  1PVJ A;  1BY8 A;  5F02 A;  3C0R A;  3PT2 A;  9PAP A;  4DMX A;  3IEJ A;  4I04 A;  1CSB B;  3E9S A;  3M99 A;  3B79 A;  5CVO B;  4M0W A;  1AU3 A;  1M6D A;  2BTW B;  2AU1 A;  2DCB A;  3H6S A;  1POP A;  2R9M A;  1O0E A;  2NQA A;  2P7U A;  3NHE A;  1KHP A;  5JH3 A;  2YJ9 A;  3K9M A;  1JQP A;  2GFO A;  4MM3 B;  5EF4 A;  5EGW A;  2B1M A;  1ME4 A;  1ME3 A;  3F5V A;  1PXV A;  3DF0 A;  4BOU A;  2GHU A;  4D8E A;  4D8I A;  3I3T A;  4BOP A;  1YZB A;  2AVW A;  2YJ8 A;  3RVW A;  2JRI A;  3HHI A;  2PRE A;  4HWY A;  2WBF X;  4OVZ B;  2ATO A;  2YJB A;  1BP4 A;  1MEM A;  3OF8 A;  4R3D A;  1Q6K A;  4OEM A;  2IBI A;  4AXM A;  2C0Y A;  2NQI A;  1PCI A;  3BCN A;  1CPJ A;  1YAL A;  2DOS A;  4K7C A;  3P5U A;  1KXR A;  1AU2 A;  2H7J A;  2F1G A;  4P16 A;  2DC6 A;  2G6D A;  3W31 A;  1PPN A;  4WA6 A;  4QBB A;  5CVN B;  5E6J A;  2OUL A;  3PRP A;  3GCB A;  3IMA A;  2DC9 A;  4PP1 A;  1QOL A;  4I07 A;  3WXF A;  3D6S A;  4XUI A;  1IWD A;  2G7Y A;  3V6C A;  4PAD A;  4PI3 A;  3MTV A;  2VHF A;  2PNS A;  7PCK A;  2AUX A;  3K8U A;  4BS6 A;  1BGO A;  1NPZ A;  3BBA A;  1SP4 B;  3RNV A;  3ZUA A;  2FUD A;  3TMP A;  5CHT A;  1CV8 A;  3PHX A;  2AIM A;  2Z84 A;  1THE A;  5JZE A;  5KO3 A;  3PHW A;  4X6I A;  2F7D A;  3BPF A;  5CHV A;  1PAD A;  3U8E A;  3B21 A;  2OZ2 A;  3BB7 A;  4CDC B;  3PRM A;  1EWO A;  4YYQ A;  3RVX A;  3ZNH A;  1KFX L;  4CDE B;  3IUT A;  1NB5 A;  1TLO A;  4QH6 A;  3HWN A;  3P5X A;  4W5C A;  1K3B B;  1PIP A;  1AYU A;  2AYN A;  4N8W A;  2P86 A;  4OEL A;  4RF1 A;  1STF E;  2FYE A;  3OVZ A;  3HD3 A;  1CVZ A;  4YVA A;  2Y5B A;  4HXD B;  2HH5 A;  1ZIV A;  4BOZ A;  1U5I A;  2HWK A;  1F2A A;  2R9N A;  3CBJ A;  2BDZ A;  3F75 A;  3BPM A;  3BWK A;  4RF0 A;  4OVZ A;  3O65 A;  3PW3 A;  1GCB A;  2XU3 A;  1MHW A;  4W4U A;  4BS5 A;  4BSQ A;  3MHH A;  2CIO A;  1F2B A;  1GMY A;  1CQD A;  4OW0 A;  4RY2 A;  1DEU A;  3H7D A;  4BOS A;  3H8B A;  3PNR A;  4DMY A;  4BQV A;  1AYV A;  3PDF A;  4X6J A;  3K24 A;  1XKG A;  1X9Y A;  1NB3 A;  4YYS A;  1YK8 A;  1NL6 A;  1ZCM A;  3N3K A;  2G8E A;  4ZUX U;  1QMY A;  2E00 A;  3LFY A;  3PHU A;  4W5B A;  5JA7 A;  3KWZ A;  4XR7 A;  1NQC A;  1F29 A;  3IOQ A;  3MTN A; 
#chains in the Genus database with same CATH homology
 3BBA A;  4A5U A;  4IUM A;  3RNV A;  1PVJ A;  3TMP A;  3C0R A;  3PHX A;  3OQC A;  3PT2 A;  2Z84 A;  5JZE A;  5KO3 A;  3PHW A;  3E9S A;  1DKI A;  4M0W A;  3B21 A;  2BTW B;  3BB7 A;  3PRM A;  3ZNH A;  2J7Q A;  2FE8 A;  3BY4 A;  3MJ5 A;  5EZQ A;  4MM3 B;  4RF1 A;  4GUA A;  4BOU A;  4RKX A;  4HXD B;  4D8E A;  4D8I A;  4REZ A;  4IP3 A;  4BOZ A;  3IFU A;  4BOP A;  1YZB A;  4BOQ A;  2BU3 A;  2HWK A;  4PT5 A;  3MP2 A;  4RF0 A;  4OVZ A;  4ZTB A;  3O65 A;  3TRK A;  2JRI A;  4OVZ B;  2JTC A;  4R3D A;  4RNA A;  4OW0 A;  2DOS A;  3W30 A;  1UKF A;  4P16 A;  4BOS A;  4D8B A;  3W31 A;  4XZX A;  2J7Q C;  4WUR A;  5E6J A;  3PRP A;  4MI7 A;  2UZJ A;  3PSE A;  3MTV A;  5EZS A;  2BTW A;  3PHU A;  2AGA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...