3PRPA

Structural analysis of a viral otu domain protease from the crimean-congo hemorrhagic fever virus in complex with human ubiquitin
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
161
structure length
161
Chain Sequence
DFLRSLDWTQVIAGQYVSNPRFNISDYFEIVRQPGDGNCFYHSIAELTMPNKTDHSYHYIKRLTESAARKYYQEEPEARLVGLSLEDYLKRMLSDNEWGSTLEASMLAKEMGITIIIWTVAASDEVEAGIKFGDGDVFTAVNLLHSGQTHFDALRILPQFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of a viral ovarian tumor domain protease from the crimean-congo hemorrhagic Fever virus in complex with covalently bonded ubiquitin.
pubmed doi rcsb
source organism Crimean-congo hemorrhagic fever virus
molecule tags Hydrolase/hydrolase
molecule keywords L protein
total genus 47
structure length 161
sequence length 161
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.80 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3prpA00
3PRMA 3C0RA 3PRPA 3PSEA 3PT2A 3ZNHA 3PHWA 3PHXA 4BOQA 3PHUA 4BOPA 4BOZA 4HXDB 5JZEA 3BY4A 4BOUA 4BOSA 3TMPA
chains in the Genus database with same CATH superfamily
3BWKA 1CJLA 2E03A 4YV8A 3W30A 2AYOA 8PCHA 3USVA 4G54A 4I05A 3CH2X 1ATKA 1NQCA 2JQGR 1GLOA 1BY8A 1AIMA 1MEGA 4D8BA 2FE8A 1HUCB 4I04A 2AS8A 3MJ5A 2XU1A 4MI7A 1Y4HA 2E01A 2G7YA 4BSQA 2JQFR 3OF9A 2DC9A 3TRKA 4CDCB 2J7QC 1QDQA 1YZBA 1S4VA 2XU4A 3B21A 1MHWA 4HXDB 3MTNA 5J94A 4CDDB 2VHFA 3DF0A 4IUMA 3KWZA 4A5UA 3HHAA 1AU0A 3F5VA 3IV2A 1ICFA 1DKIA 5F02A 3CBKA 2YJCA 2AUXA 2OULA 3K8UA 2ARYA 7PCKA 2GFOA 1UKFA 3N3KA 4P6GA 1AU2A 3WXFA 4HWYA 2OZ2A 3K9MA 1DF0A 2DC7A 3KW9A 1KHQA 3TMPA 1F2AA 1MIRA 2BTWA 1K3BB 2R9MA 4YYWA 1PCIA 3IEJA 2R6NA 1QXPA 4KLBA 1YK7A 2HH5A 4MSXA 2YJ9A 1GCBA 1PPNA 4RKXA 1IWDA 2HWKA 1NLJA 3HD3A 2Y6EA 4AXLA 5EZSA 2NQGA 4N4ZA 4R3DA 1PPOA 5EGWA 3H6SA 3O1GA 4X6IA 2E00A 2DOSA 2CIOA 3PW3A 1DEUA 1YALA 4QH6A 2DZYA 2YJBA 2NQAA 1KFXL 3KX1A 2BDLA 3F75A 4W5BA 2P0RA 5EF4A 4GUAA 4ZTBA 4X6JA 3MORA 3S3QA 5JH3A 3H8BA 3BC3A 1AYUA 2YJ8A 3QSDA 4YYVA 4PT5A 1PIPA 4P6EA 1MS6A 3CBJA 5PADA 1YVBA 3QJ3A 1SP4B 1NPZA 4X6HA 3IFUA 4BOPA 1ME3A 4YYQA 2WBFX 2IPPB 2CB5A 2DC8A 3CH3X 3C0RA 2ACTA 3W31A 2HD5A 4XUIA 2JRIA 2R9NA 4XR7A 5JZEA 4BS6A 2DCBA 3PRMA 5JA7A 2DCCA 1KXRA 3I3TA 1AYVA 1X9YA 4YYRA 1CB5A 4BOZA 1NB3A 5CVOB 2G8JA 2AGAA 2DCDA 1F2BA 2JTCA 2XU3A 3O65A 4Q8GA 4OVZB 5E6JA 3C9EA 2P7UA 2YJ2A 3RVXA 2FO5A 3LFYA 1ZIVA 1TU6A 3KWBX 5CHVA 1NB5A 3BOWA 4DMYA 3GCBA 1PBHA 3P5WA 3BY4A 1O0EA 1CPJA 1U9XA 1Y08A 1NL6A 3K24A 2DCAA 1EWMA 1CSBB 4REZA 3ERVA 2VHSA 1KFUL 1U9QX 3N4CA 3S3RA 9PAPA 2AVWA 3TNXA 1U5IA 3HHIA 4Q8HA 1CQDA 1BP4A 5EZQA 2DJFB 1FH0A 3PNRA 2R9OA 2Z84A 1QMYA 2DZZA 1CS8A 2GHUA 3PDFA 1CV8A 3OQCA 4OVZA 4W5CA 3E9SA 4QRGA 2E02A 3PSEA 1Q6KA 4W4UA 2HHNA 1PVJA 3E1ZB 6PADA 4CZWA 4RNAA 2FTDA 3OISA 3PHWA 2H7JA 1YT7A 3ZUAA 4MM3B 3PBHA 2BTWB 1CVZA 3PHUA 3KKUA 1EWPA 1ME4A 5CVMA 4CDFB 2IBIA 1BQIA 1THEA 3IMAA 2C0YA 2FRAA 1GMYA 4I07A 4WA6A 3RVVA 1ITOA 3OVZA 4PADA 4MZSA 4RF0A 3PRPA 2OP3A 3KFQA 4BS5A 1M6DA 4BOUA 2O6XA 2P86A 3LXSA 1AYWA 3V6CA 1PPDA 3HWNA 3P5UA 4M0WA 4P16A 1U9VA 3IUTA 3RNVA 1QOLA 4WURA 4IP3A 1GECE 4FK5A 4DMXA 1AU4A 4BOQA 3RVWA 5CHTA 2PADA 4RY2A 1AU3A 3MHHA 2G8EA 4FIPA 5CVNB 1TLOA 4BOSA 4OEMA 4FJCA 3BB7A 5A24A 3WXGA 1BGOA 4QBBA 2AIMA 2AU1A 2G6DA 1JQPA 2F7DA 1VJVA 5KO3A 3KSEA 1F29A 4QRVA 3V6EA 3MHSA 1F2CA 3AI8A 4PP1A 2FRQA 2PNSA 4YYUA 2DJGB 1PPPA 3MTVA 4YVAA 1EWOA 2ATOA 4OW0A 4BPVA 2F1GA 3ZNHA 4D8EA 1POPA 2FT2A 3IOQA 3M99A 3I06A 4PI3A 3PT2A 2NQDB 1AECA 3PHXA 2XU5A 3B79A 3H89A 5FPWA 2FYEA 4K7CA 1XKGA 1PXVA 1CTEA 3BPMA 2FQ9A 4PP2E 4N8WA 4YYSA 3N3GA 4MZOA 1MEMA 1EF7A 1YK8A 5K16A 2HXZA 3OVXA 1ZCMA 2B1NA 2DC6A 2AYNA 3MP2A 1PE6A 2PREA 2BU3A 1SNKA 3WXEA 2PBHA 3NHEA 3H7DA 4CDEB 2FUDA 3D6SA 3P5VA 4RF1A 1KHPA 4QRXA 3QT4A 2NQIA 2AUZA 2BDZA 4D8IA 3BPFA 3IHPA 3U8EA 3H8CA 4XZXA 4N79A 2J7QA 1U9WA 2B1MA 3BCNA 2UZJA 4AXMA 1STFE 4OELA 3BBAA 2R9FA 3O0UA 1TL9A 1EWLA 1VSNA 3P5XA 2R9CA 4BQVA 2Y5BA 3OF8A 1PADA 1MDWA 4ZUXU 1A6RA
chains in the Genus database with same CATH topology
3RNVA 3MJ5A 2AGAA 4RNAA 3MTVA 3PHWA 2Z84A 4XZXA 4WURA 2J7QA 2JTCA 4IP3A 3BB7A 3O65A 4OW0A 3IFUA 2UZJA 4MI7A 4OVZB 5E6JA 3W30A 4BOPA 4BOQA 3ZNHA 4REZA 4MM3B 4D8EA 3MP2A 1UKFA 3BBAA 3TRKA 3OQCA 4OVZA 4RKXA 3E9SA 2BTWB 4RF0A 2J7QC 2HWKA 2BU3A 3C0RA 3PRPA 3PT2A 1YZBA 3PSEA 4GUAA 4ZTBA 5EZSA 3PHXA 3W31A 2JRIA 3PHUA 4R3DA 5KO3A 3B21A 4HXDB 3TMPA 5JZEA 2BTWA 4BOUA 4RF1A 4BOSA 3PRMA 4IUMA 1PVJA 4D8BA 2FE8A 4PT5A 4A5UA 5EZQA 1DKIA 4D8IA 4BOZA 2DOSA 3BY4A 4P16A 4M0WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PRM A;  3C0R A;  3PRP A;  3PSE A;  3PT2 A;  3ZNH A;  3PHW A;  3PHX A;  4BOQ A;  3PHU A;  4BOP A;  4BOZ A;  4HXD B;  5JZE A;  3BY4 A;  4BOU A;  4BOS A;  3TMP A; 
#chains in the Genus database with same CATH topology
 3BWK A;  1CJL A;  2E03 A;  4YV8 A;  3W30 A;  2AYO A;  8PCH A;  3USV A;  4G54 A;  4I05 A;  3CH2 X;  1ATK A;  1NQC A;  2JQG R;  1GLO A;  1BY8 A;  1AIM A;  1MEG A;  4D8B A;  2FE8 A;  1HUC B;  4I04 A;  2AS8 A;  3MJ5 A;  2XU1 A;  4MI7 A;  1Y4H A;  2E01 A;  2G7Y A;  4BSQ A;  2JQF R;  3OF9 A;  2DC9 A;  3TRK A;  4CDC B;  2J7Q C;  1QDQ A;  1YZB A;  1S4V A;  2XU4 A;  3B21 A;  1MHW A;  4HXD B;  3MTN A;  5J94 A;  4CDD B;  2VHF A;  3DF0 A;  4IUM A;  3KWZ A;  4A5U A;  3HHA A;  1AU0 A;  3F5V A;  3IV2 A;  1ICF A;  1DKI A;  5F02 A;  3CBK A;  2YJC A;  2AUX A;  2OUL A;  3K8U A;  2ARY A;  7PCK A;  2GFO A;  1UKF A;  3N3K A;  4P6G A;  1AU2 A;  3WXF A;  4HWY A;  2OZ2 A;  3K9M A;  1DF0 A;  2DC7 A;  3KW9 A;  1KHQ A;  3TMP A;  1F2A A;  1MIR A;  2BTW A;  1K3B B;  2R9M A;  4YYW A;  1PCI A;  3IEJ A;  2R6N A;  1QXP A;  4KLB A;  1YK7 A;  2HH5 A;  4MSX A;  2YJ9 A;  1GCB A;  1PPN A;  4RKX A;  1IWD A;  2HWK A;  1NLJ A;  3HD3 A;  2Y6E A;  4AXL A;  5EZS A;  2NQG A;  4N4Z A;  4R3D A;  1PPO A;  5EGW A;  3H6S A;  3O1G A;  4X6I A;  2E00 A;  2DOS A;  2CIO A;  3PW3 A;  1DEU A;  1YAL A;  4QH6 A;  2DZY A;  2YJB A;  2NQA A;  1KFX L;  3KX1 A;  2BDL A;  3F75 A;  4W5B A;  2P0R A;  5EF4 A;  4GUA A;  4ZTB A;  4X6J A;  3MOR A;  3S3Q A;  5JH3 A;  3H8B A;  3BC3 A;  1AYU A;  2YJ8 A;  3QSD A;  4YYV A;  4PT5 A;  1PIP A;  4P6E A;  1MS6 A;  3CBJ A;  5PAD A;  1YVB A;  3QJ3 A;  1SP4 B;  1NPZ A;  4X6H A;  3IFU A;  4BOP A;  1ME3 A;  4YYQ A;  2WBF X;  2IPP B;  2CB5 A;  2DC8 A;  3CH3 X;  3C0R A;  2ACT A;  3W31 A;  2HD5 A;  4XUI A;  2JRI A;  2R9N A;  4XR7 A;  5JZE A;  4BS6 A;  2DCB A;  3PRM A;  5JA7 A;  2DCC A;  1KXR A;  3I3T A;  1AYV A;  1X9Y A;  4YYR A;  1CB5 A;  4BOZ A;  1NB3 A;  5CVO B;  2G8J A;  2AGA A;  2DCD A;  1F2B A;  2JTC A;  2XU3 A;  3O65 A;  4Q8G A;  4OVZ B;  5E6J A;  3C9E A;  2P7U A;  2YJ2 A;  3RVX A;  2FO5 A;  3LFY A;  1ZIV A;  1TU6 A;  3KWB X;  5CHV A;  1NB5 A;  3BOW A;  4DMY A;  3GCB A;  1PBH A;  3P5W A;  3BY4 A;  1O0E A;  1CPJ A;  1U9X A;  1Y08 A;  1NL6 A;  3K24 A;  2DCA A;  1EWM A;  1CSB B;  4REZ A;  3ERV A;  2VHS A;  1KFU L;  1U9Q X;  3N4C A;  3S3R A;  9PAP A;  2AVW A;  3TNX A;  1U5I A;  3HHI A;  4Q8H A;  1CQD A;  1BP4 A;  5EZQ A;  2DJF B;  1FH0 A;  3PNR A;  2R9O A;  2Z84 A;  1QMY A;  2DZZ A;  1CS8 A;  2GHU A;  3PDF A;  1CV8 A;  3OQC A;  4OVZ A;  4W5C A;  3E9S A;  4QRG A;  2E02 A;  3PSE A;  1Q6K A;  4W4U A;  2HHN A;  1PVJ A;  3E1Z B;  6PAD A;  4CZW A;  4RNA A;  2FTD A;  3OIS A;  3PHW A;  2H7J A;  1YT7 A;  3ZUA A;  4MM3 B;  3PBH A;  2BTW B;  1CVZ A;  3PHU A;  3KKU A;  1EWP A;  1ME4 A;  5CVM A;  4CDF B;  2IBI A;  1BQI A;  1THE A;  3IMA A;  2C0Y A;  2FRA A;  1GMY A;  4I07 A;  4WA6 A;  3RVV A;  1ITO A;  3OVZ A;  4PAD A;  4MZS A;  4RF0 A;  3PRP A;  2OP3 A;  3KFQ A;  4BS5 A;  1M6D A;  4BOU A;  2O6X A;  2P86 A;  3LXS A;  1AYW A;  3V6C A;  1PPD A;  3HWN A;  3P5U A;  4M0W A;  4P16 A;  1U9V A;  3IUT A;  3RNV A;  1QOL A;  4WUR A;  4IP3 A;  1GEC E;  4FK5 A;  4DMX A;  1AU4 A;  4BOQ A;  3RVW A;  5CHT A;  2PAD A;  4RY2 A;  1AU3 A;  3MHH A;  2G8E A;  4FIP A;  5CVN B;  1TLO A;  4BOS A;  4OEM A;  4FJC A;  3BB7 A;  5A24 A;  3WXG A;  1BGO A;  4QBB A;  2AIM A;  2AU1 A;  2G6D A;  1JQP A;  2F7D A;  1VJV A;  5KO3 A;  3KSE A;  1F29 A;  4QRV A;  3V6E A;  3MHS A;  1F2C A;  3AI8 A;  4PP1 A;  2FRQ A;  2PNS A;  4YYU A;  2DJG B;  1PPP A;  3MTV A;  4YVA A;  1EWO A;  2ATO A;  4OW0 A;  4BPV A;  2F1G A;  3ZNH A;  4D8E A;  1POP A;  2FT2 A;  3IOQ A;  3M99 A;  3I06 A;  4PI3 A;  3PT2 A;  2NQD B;  1AEC A;  3PHX A;  2XU5 A;  3B79 A;  3H89 A;  5FPW A;  2FYE A;  4K7C A;  1XKG A;  1PXV A;  1CTE A;  3BPM A;  2FQ9 A;  4PP2 E;  4N8W A;  4YYS A;  3N3G A;  4MZO A;  1MEM A;  1EF7 A;  1YK8 A;  5K16 A;  2HXZ A;  3OVX A;  1ZCM A;  2B1N A;  2DC6 A;  2AYN A;  3MP2 A;  1PE6 A;  2PRE A;  2BU3 A;  1SNK A;  3WXE A;  2PBH A;  3NHE A;  3H7D A;  4CDE B;  2FUD A;  3D6S A;  3P5V A;  4RF1 A;  1KHP A;  4QRX A;  3QT4 A;  2NQI A;  2AUZ A;  2BDZ A;  4D8I A;  3BPF A;  3IHP A;  3U8E A;  3H8C A;  4XZX A;  4N79 A;  2J7Q A;  1U9W A;  2B1M A;  3BCN A;  2UZJ A;  4AXM A;  1STF E;  4OEL A;  3BBA A;  2R9F A;  3O0U A;  1TL9 A;  1EWL A;  1VSN A;  3P5X A;  2R9C A;  4BQV A;  2Y5B A;  3OF8 A;  1PAD A;  1MDW A;  4ZUX U;  1A6R A; 
#chains in the Genus database with same CATH homology
 3RNV A;  3MJ5 A;  2AGA A;  4RNA A;  3MTV A;  3PHW A;  2Z84 A;  4XZX A;  4WUR A;  2J7Q A;  2JTC A;  4IP3 A;  3BB7 A;  3O65 A;  4OW0 A;  3IFU A;  2UZJ A;  4MI7 A;  4OVZ B;  5E6J A;  3W30 A;  4BOP A;  4BOQ A;  3ZNH A;  4REZ A;  4MM3 B;  4D8E A;  3MP2 A;  1UKF A;  3BBA A;  3TRK A;  3OQC A;  4OVZ A;  4RKX A;  3E9S A;  2BTW B;  4RF0 A;  2J7Q C;  2HWK A;  2BU3 A;  3C0R A;  3PRP A;  3PT2 A;  1YZB A;  3PSE A;  4GUA A;  4ZTB A;  5EZS A;  3PHX A;  3W31 A;  2JRI A;  3PHU A;  4R3D A;  5KO3 A;  3B21 A;  4HXD B;  3TMP A;  5JZE A;  2BTW A;  4BOU A;  4RF1 A;  4BOS A;  3PRM A;  4IUM A;  1PVJ A;  4D8B A;  2FE8 A;  4PT5 A;  4A5U A;  5EZQ A;  1DKI A;  4D8I A;  4BOZ A;  2DOS A;  3BY4 A;  4P16 A;  4M0W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...