1AU4A

Crystal structure of the cysteine protease human cathepsin k in complex with a covalent pyrrolidinone inhibitor
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformationally constrained 1,3-diamino ketones: a series of potent inhibitors of the cysteine protease cathepsin K.
pubmed doi rcsb
molecule keywords CATHEPSIN K
molecule tags Hydrolase
source organism Homo sapiens
total genus 56
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 1997-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1au4A00
4X6JA 1K3BB 1KFXL 2R9FA 1YK8A 7PCKA 2R6NA 3BC3A 1XKGA 3IMAA 3N3GA 4CDEB 3S3QA 2R9CA 2YJ8A 2DCBA 3BPFA 3P5WA 3PNRA 4Q8GA 2P86A 4CDCB 2CB5A 3MHSA 2YJ9A 2OP3A 1MEGA 2ATOA 4AXLA 2WBFX 4ZUXU 3IOQA 1CSBB 3OISA 2H7JA 2E02A 5F02A 3O0UA 1AYWA 2ACTA 1AU4A 3KKUA 2AUXA 4FK5A 4X6IA 1ITOA 9PAPA 2NQGA 1PCIA 2FYEA 2YJCA 2DC6A 2JQFR 3CH2X 1QDQA 4X6HA 1EWPA 3K9MA 2Y6EA 3QT4A 2FT2A 1NL6A 3WXEA 3H89A 1ME4A 1VJVA 5FPWA 1U9XA 1Y4HA 1PPDA 6PADA 2XU1A 2PNSA 5A24A 1KFUL 3BCNA 4YYQA 3F75A 1YT7A 1MEMA 4DMXA 1Y08A 2OZ2A 5PADA 4DMYA 1MDWA 2OULA 3KFQA 1PPNA 1QOLA 4XR7A 4N79A 3HD3A 2FO5A 2PBHA 3N3KA 4G54A 3IV2A 2P7UA 2NQAA 3LFYA 4YYUA 4CZWA 4YYSA 1CVZA 1POPA 1U5IA 2B1NA 3WXGA 1ME3A 4W5CA 1YK7A 3RVWA 2Y5BA 1PE6A 2VHSA 4QRXA 2YJBA 2DC8A 1M6DA 1NLJA 3O1GA 3H7DA 3H8BA 2R9MA 1GLOA 3WXFA 4YYVA 2VHFA 4HWYA 4P6GA 1AYUA 1CTEA 2CIOA 2DJFB 4I04A 3IEJA 1U9QX 3PBHA 4W5BA 3H8CA 2DZZA 3V6EA 1O0EA 1F2CA 1CV8A 2GFOA 2FQ9A 3LXSA 3QSDA 1EWMA 1A6RA 1GECE 2AYNA 4W4UA 4YYWA 4CDFB 2G8EA 1PXVA 1CQDA 1PPPA 3D6SA 1FH0A 3B79A 4QBBA 5CHTA 4BSQA 3ERVA 1NB3A 4YYRA 1F29A 3I3TA 1NB5A 4OEMA 2IBIA 4AXMA 5CVNB 2BDZA 2P0RA 3QJ3A 4I05A 1NQCA 1KHPA 2AIMA 1PBHA 4Q8HA 1KXRA 4MZOA 3OF8A 3BOWA 1KHQA 3ZUAA 3MTNA 1THEA 2FRQA 4YV8A 2JQGR 3OVZA 2E01A 1GCBA 5EGWA 2YJ2A 3PW3A 1TU6A 3OVXA 1S4VA 1BP4A 1AECA 3HHAA 1YALA 3KSEA 3C9EA 1NPZA 8PCHA 3V6CA 4BS5A 3CBJA 1AYVA 1AU3A 1DF0A 5K16A 3RVVA 3K24A 3CH3X 4PP1A 3KW9A 1PIPA 3IHPA 3MHHA 1ZCMA 2FUDA 1EWOA 5EF4A 2GHUA 1AU0A 3HWNA 1ICFA 1IWDA 2FRAA 4QRVA 3PDFA 5CVOB 1SNKA 2ARYA 3DF0A 1TLOA 3P5VA 2AVWA 3RVXA 3F5VA 1AIMA 1QMYA 4BS6A 2F7DA 1EF7A 2HH5A 4QRGA 3KX1A 2G6DA 2NQIA 3KWBX 2DCDA 4KLBA 5J94A 1AU2A 2XU5A 4MZSA 2DCAA 1X9YA 2AYOA 4I07A 2G7YA 2XU4A 2AS8A 2HD5A 1JQPA 4N8WA 5CHVA 1CJLA 5CVMA 2C0YA 2HXZA 2DC7A 4RY2A 5JH3A 2DC9A 3TNXA 1SP4B 4BQVA 4MSXA 4XUIA 1BQIA 5JA7A 1F2AA 4FIPA 3GCBA 3BPMA 3M99A 2DCCA 1U9VA 3I06A 3MORA 1HUCB 1CB5A 2F1GA 1F2BA 2B1MA 2XU3A 4PADA 1PPOA 1QXPA 2AUZA 3U8EA 1U9WA 1PADA 1BY8A 4YVAA 2PREA 3P5XA 1MS6A 2PADA 1EWLA 1GMYA 2O6XA 4QH6A 2IPPB 4CDDB 2BDLA 4PI3A 1MHWA 2HHNA 3N4CA 2AU1A 3IUTA 3S3RA 2DZYA 2E03A 1CPJA 4PP2E 4P6EA 4WA6A 3K8UA 2E00A 3P5UA 1MIRA 4BPVA 1ATKA 3CBKA 2FTDA 3AI8A 3USVA 4N4ZA 1Q6KA 1CS8A 1TL9A 3OF9A 1DEUA 1ZIVA 1YVBA 1BGOA 2DJGB 1VSNA 3BWKA 4OELA 2NQDB 3H6SA 4FJCA 2R9OA 3HHIA 2G8JA 1STFE 3KWZA 3NHEA 2R9NA 4K7CA 3E1ZB
chains in the Genus database with same CATH superfamily
4X6JA 1K3BB 1KFXL 2R9FA 1YK8A 7PCKA 2BU3A 3PHWA 2R6NA 3BC3A 1XKGA 3IMAA 3N3GA 4CDEB 3S3QA 2R9CA 2YJ8A 2DCBA 3BPFA 3P5WA 4D8BA 3PNRA 3W31A 4Q8GA 4WURA 2P86A 4CDCB 2CB5A 3TMPA 3MHSA 2YJ9A 2BTWB 2OP3A 1MEGA 2ATOA 4AXLA 4OVZB 4D8IA 2WBFX 4ZUXU 4XZXA 3IOQA 1CSBB 3TRKA 3OISA 2H7JA 2E02A 5F02A 3O0UA 4P16A 1AYWA 4MI7A 2ACTA 1AU4A 3KKUA 2AUXA 4FK5A 4X6IA 4BOQA 1ITOA 4R3DA 9PAPA 4MM3B 2NQGA 1PCIA 2FYEA 2YJCA 2DC6A 2JQFR 3CH2X 1QDQA 4X6HA 1EWPA 5EZSA 3K9MA 2Y6EA 3QT4A 2FT2A 1NL6A 3WXEA 2J7QC 2JRIA 3H89A 1ME4A 2Z84A 1VJVA 5FPWA 1U9XA 1Y4HA 1PPDA 6PADA 2XU1A 2PNSA 5A24A 1KFUL 3BCNA 4YYQA 3F75A 1YT7A 1MEMA 3PHUA 4DMXA 1Y08A 2OZ2A 3MTVA 5PADA 4DMYA 1MDWA 2OULA 3KFQA 1PPNA 1QOLA 4XR7A 4N79A 4PT5A 3HD3A 2FO5A 2PBHA 3N3KA 4G54A 3IV2A 2P7UA 2NQAA 3LFYA 4YYUA 3PRMA 4CZWA 4YYSA 1CVZA 1POPA 1U5IA 2B1NA 3WXGA 1ME3A 4W5CA 1YK7A 3RVWA 2Y5BA 1PE6A 2VHSA 4QRXA 2YJBA 2DC8A 1M6DA 3BBAA 1NLJA 3O1GA 3H7DA 3H8BA 2R9MA 1GLOA 3WXFA 4YYVA 2VHFA 4HWYA 4P6GA 1AYUA 1CTEA 2CIOA 2BTWA 2DJFB 4I04A 4OVZA 3IEJA 1U9QX 3PBHA 4W5BA 3H8CA 2DZZA 3V6EA 1O0EA 2FE8A 1F2CA 5EZQA 1CV8A 2GFOA 2FQ9A 3LXSA 3QSDA 1EWMA 1A6RA 4A5UA 1GECE 2AYNA 4W4UA 4YYWA 2J7QA 4CDFB 2G8EA 1PXVA 1CQDA 1PPPA 3D6SA 1FH0A 3B79A 3PRPA 4QBBA 5CHTA 4BSQA 3ERVA 3RNVA 1NB3A 4YYRA 1F29A 3I3TA 1NB5A 4OEMA 2IBIA 4REZA 4AXMA 5CVNB 2BDZA 2P0RA 3QJ3A 4I05A 1NQCA 1KHPA 2AIMA 1PBHA 4Q8HA 4IP3A 1KXRA 4BOSA 4MZOA 3OF8A 3BOWA 1KHQA 3ZUAA 3MTNA 1THEA 2FRQA 4YV8A 4OW0A 2JQGR 3OVZA 2E01A 1GCBA 3BY4A 4RF1A 5EGWA 2YJ2A 3PW3A 1TU6A 3OVXA 1S4VA 1BP4A 1AECA 3HHAA 3MJ5A 1YALA 3KSEA 3C9EA 1NPZA 8PCHA 3BB7A 3V6CA 4BS5A 3CBJA 1AYVA 1AU3A 2UZJA 1DF0A 5K16A 3RVVA 3K24A 3CH3X 4PP1A 3KW9A 1PIPA 3IHPA 3MHHA 1ZCMA 2FUDA 1EWOA 5EF4A 2GHUA 1DKIA 4RNAA 1AU0A 3HWNA 2JTCA 1ICFA 4BOPA 1IWDA 2FRAA 4QRVA 3PDFA 5CVOB 1SNKA 2ARYA 3DF0A 1TLOA 3P5VA 2AVWA 3RVXA 3F5VA 1AIMA 1QMYA 4BS6A 2F7DA 1EF7A 2HH5A 4QRGA 4IUMA 3KX1A 2G6DA 2NQIA 3KWBX 2DCDA 4KLBA 5J94A 1AU2A 5KO3A 2XU5A 4MZSA 2AGAA 2DCAA 1X9YA 2AYOA 4I07A 2G7YA 2XU4A 2AS8A 2HD5A 3E9SA 1JQPA 4N8WA 5CHVA 3B21A 3W30A 1CJLA 5CVMA 2C0YA 2HXZA 1UKFA 1PVJA 2DC7A 4RY2A 5JH3A 2DC9A 3TNXA 1SP4B 4BQVA 4MSXA 4XUIA 1BQIA 5JA7A 1F2AA 4FIPA 2DOSA 3GCBA 3BPMA 3M99A 2DCCA 1U9VA 3I06A 3MORA 3ZNHA 1HUCB 1CB5A 2F1GA 1F2BA 2B1MA 2XU3A 4PADA 4ZTBA 1PPOA 3O65A 1QXPA 2AUZA 3U8EA 1U9WA 1PADA 1BY8A 4YVAA 2PREA 3P5XA 1MS6A 4GUAA 2PADA 3MP2A 1EWLA 1GMYA 2O6XA 5E6JA 4QH6A 2IPPB 4CDDB 4RKXA 2BDLA 4BOUA 4PI3A 1MHWA 2HHNA 4D8EA 3N4CA 2AU1A 3IUTA 3S3RA 2DZYA 3PT2A 2E03A 1CPJA 4PP2E 4P6EA 4HXDB 4WA6A 3K8UA 2HWKA 2E00A 3P5UA 1MIRA 4RF0A 4BPVA 1ATKA 3CBKA 2FTDA 3AI8A 3C0RA 3USVA 4N4ZA 5JZEA 3OQCA 1Q6KA 1CS8A 3PSEA 1TL9A 3OF9A 1DEUA 1ZIVA 1YVBA 1BGOA 2DJGB 1VSNA 3BWKA 4OELA 2NQDB 3H6SA 4FJCA 2R9OA 1YZBA 3HHIA 2G8JA 1STFE 3KWZA 3IFUA 3NHEA 2R9NA 3PHXA 4K7CA 4M0WA 3E1ZB 4BOZA
chains in the Genus database with same CATH topology
4X6JA 1K3BB 1KFXL 2R9FA 1YK8A 7PCKA 2R6NA 3BC3A 1XKGA 3IMAA 3N3GA 4CDEB 3S3QA 2R9CA 2YJ8A 2DCBA 3BPFA 3P5WA 3PNRA 4Q8GA 2P86A 4CDCB 2CB5A 3MHSA 2YJ9A 2OP3A 1MEGA 2ATOA 4AXLA 2WBFX 4ZUXU 3IOQA 1CSBB 3OISA 2BSZA 2H7JA 2E02A 5F02A 3O0UA 1AYWA 2ACTA 1AU4A 3KKUA 2AUXA 4FK5A 4X6IA 1ITOA 9PAPA 2NQGA 1PCIA 2FYEA 2YJCA 2DC6A 2JQFR 3CH2X 1QDQA 4X6HA 1EWPA 3K9MA 2Y6EA 3QT4A 2FT2A 1NL6A 3WXEA 3H89A 1ME4A 2VFCA 1VJVA 5FPWA 1U9XA 1Y4HA 1PPDA 6PADA 2XU1A 2PNSA 5A24A 1KFUL 3BCNA 1W5RA 4YYQA 3F75A 1YT7A 1MEMA 4DMXA 4GUZA 1Y08A 2OZ2A 5PADA 4DMYA 1MDWA 2OULA 3KFQA 1PPNA 1QOLA 4XR7A 4N79A 3HD3A 2FO5A 2PBHA 3N3KA 4G54A 3IV2A 2P7UA 2NQAA 3LFYA 4YYUA 4CZWA 4YYSA 1CVZA 1POPA 1U5IA 2B1NA 3WXGA 1ME3A 4W5CA 1YK7A 3RVWA 2Y5BA 1PE6A 2VHSA 4QRXA 2YJBA 2DC8A 1M6DA 1E2TA 1NLJA 3O1GA 3H7DA 3H8BA 2R9MA 1GLOA 3WXFA 4YYVA 2VHFA 4HWYA 4P6GA 1AYUA 1CTEA 2CIOA 2DJFB 4I04A 3IEJA 3LTWA 1U9QX 3PBHA 4W5BA 3H8CA 2DZZA 3V6EA 1O0EA 1F2CA 1CV8A 2GFOA 2FQ9A 3LXSA 3QSDA 1EWMA 1A6RA 1GECE 2AYNA 4W4UA 4YYWA 4CDFB 2G8EA 1PXVA 1CQDA 1PPPA 3D6SA 1GX3A 1FH0A 3B79A 4QBBA 5CHTA 4BSQA 3ERVA 1NB3A 4YYRA 1F29A 3I3TA 1NB5A 4OEMA 2IBIA 4AXMA 5CVNB 2BDZA 2P0RA 3QJ3A 4I05A 1NQCA 1KHPA 2AIMA 1W6FA 1PBHA 4Q8HA 1KXRA 4MZOA 3OF8A 3BOWA 1KHQA 3ZUAA 3MTNA 1THEA 2FRQA 4YV8A 2JQGR 3OVZA 2E01A 1GCBA 5EGWA 2YJ2A 3PW3A 1TU6A 3OVXA 1S4VA 1BP4A 1AECA 3HHAA 1YALA 3KSEA 3C9EA 1NPZA 8PCHA 3V6CA 4BS5A 3CBJA 1AYVA 1AU3A 1DF0A 5K16A 3RVVA 3K24A 3CH3X 4PP1A 3KW9A 1PIPA 3IHPA 3MHHA 1ZCMA 4BGFA 2FUDA 1EWOA 5EF4A 2GHUA 1AU0A 3HWNA 1ICFA 1IWDA 2FRAA 4QRVA 3PDFA 5CVOB 1SNKA 2ARYA 3DF0A 1TLOA 3P5VA 2AVWA 3RVXA 3F5VA 1AIMA 1QMYA 4BS6A 2F7DA 1EF7A 2HH5A 4QRGA 2VFBA 3KX1A 2G6DA 2NQIA 3KWBX 2DCDA 4KLBA 5J94A 1AU2A 2XU5A 4MZSA 2DCAA 1X9YA 2AYOA 4I07A 2G7YA 2XU4A 2AS8A 2HD5A 1JQPA 4N8WA 5CHVA 4NV7A 1CJLA 5CVMA 2C0YA 2HXZA 4NV8A 2DC7A 4RY2A 5JH3A 2DC9A 3TNXA 1SP4B 4BQVA 4MSXA 4XUIA 1BQIA 5JA7A 1F2AA 4FIPA 3GCBA 3BPMA 3M99A 2DCCA 1U9VA 3I06A 3MORA 1HUCB 1CB5A 2F1GA 1F2BA 2B1MA 2XU3A 4PADA 1PPOA 1QXPA 2AUZA 3U8EA 1U9WA 1PADA 1BY8A 4YVAA 2PREA 3P5XA 1MS6A 2PADA 1EWLA 1GMYA 2O6XA 4QH6A 2IPPB 4CDDB 2BDLA 4PI3A 1MHWA 2HHNA 3D9WA 2AU1A 3IUTA 3N4CA 3S3RA 2DZYA 2E03A 1CPJA 4PP2E 4P6EA 4WA6A 3K8UA 2E00A 3P5UA 1MIRA 4BPVA 1ATKA 3CBKA 2FTDA 3AI8A 3USVA 4N4ZA 1Q6KA 1CS8A 1TL9A 3OF9A 1DEUA 1ZIVA 1YVBA 1BGOA 2DJGB 1VSNA 3BWKA 4OELA 2NQDB 3H6SA 4C5PA 1W4TA 4FJCA 2R9OA 3HHIA 2G8JA 1STFE 3KWZA 3NHEA 2R9NA 4B55A 4K7CA 3E1ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X6J A;  1K3B B;  1KFX L;  2R9F A;  1YK8 A;  7PCK A;  2R6N A;  3BC3 A;  1XKG A;  3IMA A;  3N3G A;  4CDE B;  3S3Q A;  2R9C A;  2YJ8 A;  2DCB A;  3BPF A;  3P5W A;  3PNR A;  4Q8G A;  2P86 A;  4CDC B;  2CB5 A;  3MHS A;  2YJ9 A;  2OP3 A;  1MEG A;  2ATO A;  4AXL A;  2WBF X;  4ZUX U;  3IOQ A;  1CSB B;  3OIS A;  2H7J A;  2E02 A;  5F02 A;  3O0U A;  1AYW A;  2ACT A;  1AU4 A;  3KKU A;  2AUX A;  4FK5 A;  4X6I A;  1ITO A;  9PAP A;  2NQG A;  1PCI A;  2FYE A;  2YJC A;  2DC6 A;  2JQF R;  3CH2 X;  1QDQ A;  4X6H A;  1EWP A;  3K9M A;  2Y6E A;  3QT4 A;  2FT2 A;  1NL6 A;  3WXE A;  3H89 A;  1ME4 A;  1VJV A;  5FPW A;  1U9X A;  1Y4H A;  1PPD A;  6PAD A;  2XU1 A;  2PNS A;  5A24 A;  1KFU L;  3BCN A;  4YYQ A;  3F75 A;  1YT7 A;  1MEM A;  4DMX A;  1Y08 A;  2OZ2 A;  5PAD A;  4DMY A;  1MDW A;  2OUL A;  3KFQ A;  1PPN A;  1QOL A;  4XR7 A;  4N79 A;  3HD3 A;  2FO5 A;  2PBH A;  3N3K A;  4G54 A;  3IV2 A;  2P7U A;  2NQA A;  3LFY A;  4YYU A;  4CZW A;  4YYS A;  1CVZ A;  1POP A;  1U5I A;  2B1N A;  3WXG A;  1ME3 A;  4W5C A;  1YK7 A;  3RVW A;  2Y5B A;  1PE6 A;  2VHS A;  4QRX A;  2YJB A;  2DC8 A;  1M6D A;  1NLJ A;  3O1G A;  3H7D A;  3H8B A;  2R9M A;  1GLO A;  3WXF A;  4YYV A;  2VHF A;  4HWY A;  4P6G A;  1AYU A;  1CTE A;  2CIO A;  2DJF B;  4I04 A;  3IEJ A;  1U9Q X;  3PBH A;  4W5B A;  3H8C A;  2DZZ A;  3V6E A;  1O0E A;  1F2C A;  1CV8 A;  2GFO A;  2FQ9 A;  3LXS A;  3QSD A;  1EWM A;  1A6R A;  1GEC E;  2AYN A;  4W4U A;  4YYW A;  4CDF B;  2G8E A;  1PXV A;  1CQD A;  1PPP A;  3D6S A;  1FH0 A;  3B79 A;  4QBB A;  5CHT A;  4BSQ A;  3ERV A;  1NB3 A;  4YYR A;  1F29 A;  3I3T A;  1NB5 A;  4OEM A;  2IBI A;  4AXM A;  5CVN B;  2BDZ A;  2P0R A;  3QJ3 A;  4I05 A;  1NQC A;  1KHP A;  2AIM A;  1PBH A;  4Q8H A;  1KXR A;  4MZO A;  3OF8 A;  3BOW A;  1KHQ A;  3ZUA A;  3MTN A;  1THE A;  2FRQ A;  4YV8 A;  2JQG R;  3OVZ A;  2E01 A;  1GCB A;  5EGW A;  2YJ2 A;  3PW3 A;  1TU6 A;  3OVX A;  1S4V A;  1BP4 A;  1AEC A;  3HHA A;  1YAL A;  3KSE A;  3C9E A;  1NPZ A;  8PCH A;  3V6C A;  4BS5 A;  3CBJ A;  1AYV A;  1AU3 A;  1DF0 A;  5K16 A;  3RVV A;  3K24 A;  3CH3 X;  4PP1 A;  3KW9 A;  1PIP A;  3IHP A;  3MHH A;  1ZCM A;  2FUD A;  1EWO A;  5EF4 A;  2GHU A;  1AU0 A;  3HWN A;  1ICF A;  1IWD A;  2FRA A;  4QRV A;  3PDF A;  5CVO B;  1SNK A;  2ARY A;  3DF0 A;  1TLO A;  3P5V A;  2AVW A;  3RVX A;  3F5V A;  1AIM A;  1QMY A;  4BS6 A;  2F7D A;  1EF7 A;  2HH5 A;  4QRG A;  3KX1 A;  2G6D A;  2NQI A;  3KWB X;  2DCD A;  4KLB A;  5J94 A;  1AU2 A;  2XU5 A;  4MZS A;  2DCA A;  1X9Y A;  2AYO A;  4I07 A;  2G7Y A;  2XU4 A;  2AS8 A;  2HD5 A;  1JQP A;  4N8W A;  5CHV A;  1CJL A;  5CVM A;  2C0Y A;  2HXZ A;  2DC7 A;  4RY2 A;  5JH3 A;  2DC9 A;  3TNX A;  1SP4 B;  4BQV A;  4MSX A;  4XUI A;  1BQI A;  5JA7 A;  1F2A A;  4FIP A;  3GCB A;  3BPM A;  3M99 A;  2DCC A;  1U9V A;  3I06 A;  3MOR A;  1HUC B;  1CB5 A;  2F1G A;  1F2B A;  2B1M A;  2XU3 A;  4PAD A;  1PPO A;  1QXP A;  2AUZ A;  3U8E A;  1U9W A;  1PAD A;  1BY8 A;  4YVA A;  2PRE A;  3P5X A;  1MS6 A;  2PAD A;  1EWL A;  1GMY A;  2O6X A;  4QH6 A;  2IPP B;  4CDD B;  2BDL A;  4PI3 A;  1MHW A;  2HHN A;  3N4C A;  2AU1 A;  3IUT A;  3S3R A;  2DZY A;  2E03 A;  1CPJ A;  4PP2 E;  4P6E A;  4WA6 A;  3K8U A;  2E00 A;  3P5U A;  1MIR A;  4BPV A;  1ATK A;  3CBK A;  2FTD A;  3AI8 A;  3USV A;  4N4Z A;  1Q6K A;  1CS8 A;  1TL9 A;  3OF9 A;  1DEU A;  1ZIV A;  1YVB A;  1BGO A;  2DJG B;  1VSN A;  3BWK A;  4OEL A;  2NQD B;  3H6S A;  4FJC A;  2R9O A;  3HHI A;  2G8J A;  1STF E;  3KWZ A;  3NHE A;  2R9N A;  4K7C A;  3E1Z B; 
#chains in the Genus database with same CATH topology
 4X6J A;  1K3B B;  1KFX L;  2R9F A;  1YK8 A;  7PCK A;  2BU3 A;  3PHW A;  2R6N A;  3BC3 A;  1XKG A;  3IMA A;  3N3G A;  4CDE B;  3S3Q A;  2R9C A;  2YJ8 A;  2DCB A;  3BPF A;  3P5W A;  4D8B A;  3PNR A;  3W31 A;  4Q8G A;  4WUR A;  2P86 A;  4CDC B;  2CB5 A;  3TMP A;  3MHS A;  2YJ9 A;  2BTW B;  2OP3 A;  1MEG A;  2ATO A;  4AXL A;  4OVZ B;  4D8I A;  2WBF X;  4ZUX U;  4XZX A;  3IOQ A;  1CSB B;  3TRK A;  3OIS A;  2H7J A;  2E02 A;  5F02 A;  3O0U A;  4P16 A;  1AYW A;  4MI7 A;  2ACT A;  1AU4 A;  3KKU A;  2AUX A;  4FK5 A;  4X6I A;  4BOQ A;  1ITO A;  4R3D A;  9PAP A;  4MM3 B;  2NQG A;  1PCI A;  2FYE A;  2YJC A;  2DC6 A;  2JQF R;  3CH2 X;  1QDQ A;  4X6H A;  1EWP A;  5EZS A;  3K9M A;  2Y6E A;  3QT4 A;  2FT2 A;  1NL6 A;  3WXE A;  2J7Q C;  2JRI A;  3H89 A;  1ME4 A;  2Z84 A;  1VJV A;  5FPW A;  1U9X A;  1Y4H A;  1PPD A;  6PAD A;  2XU1 A;  2PNS A;  5A24 A;  1KFU L;  3BCN A;  4YYQ A;  3F75 A;  1YT7 A;  1MEM A;  3PHU A;  4DMX A;  1Y08 A;  2OZ2 A;  3MTV A;  5PAD A;  4DMY A;  1MDW A;  2OUL A;  3KFQ A;  1PPN A;  1QOL A;  4XR7 A;  4N79 A;  4PT5 A;  3HD3 A;  2FO5 A;  2PBH A;  3N3K A;  4G54 A;  3IV2 A;  2P7U A;  2NQA A;  3LFY A;  4YYU A;  3PRM A;  4CZW A;  4YYS A;  1CVZ A;  1POP A;  1U5I A;  2B1N A;  3WXG A;  1ME3 A;  4W5C A;  1YK7 A;  3RVW A;  2Y5B A;  1PE6 A;  2VHS A;  4QRX A;  2YJB A;  2DC8 A;  1M6D A;  3BBA A;  1NLJ A;  3O1G A;  3H7D A;  3H8B A;  2R9M A;  1GLO A;  3WXF A;  4YYV A;  2VHF A;  4HWY A;  4P6G A;  1AYU A;  1CTE A;  2CIO A;  2BTW A;  2DJF B;  4I04 A;  4OVZ A;  3IEJ A;  1U9Q X;  3PBH A;  4W5B A;  3H8C A;  2DZZ A;  3V6E A;  1O0E A;  2FE8 A;  1F2C A;  5EZQ A;  1CV8 A;  2GFO A;  2FQ9 A;  3LXS A;  3QSD A;  1EWM A;  1A6R A;  4A5U A;  1GEC E;  2AYN A;  4W4U A;  4YYW A;  2J7Q A;  4CDF B;  2G8E A;  1PXV A;  1CQD A;  1PPP A;  3D6S A;  1FH0 A;  3B79 A;  3PRP A;  4QBB A;  5CHT A;  4BSQ A;  3ERV A;  3RNV A;  1NB3 A;  4YYR A;  1F29 A;  3I3T A;  1NB5 A;  4OEM A;  2IBI A;  4REZ A;  4AXM A;  5CVN B;  2BDZ A;  2P0R A;  3QJ3 A;  4I05 A;  1NQC A;  1KHP A;  2AIM A;  1PBH A;  4Q8H A;  4IP3 A;  1KXR A;  4BOS A;  4MZO A;  3OF8 A;  3BOW A;  1KHQ A;  3ZUA A;  3MTN A;  1THE A;  2FRQ A;  4YV8 A;  4OW0 A;  2JQG R;  3OVZ A;  2E01 A;  1GCB A;  3BY4 A;  4RF1 A;  5EGW A;  2YJ2 A;  3PW3 A;  1TU6 A;  3OVX A;  1S4V A;  1BP4 A;  1AEC A;  3HHA A;  3MJ5 A;  1YAL A;  3KSE A;  3C9E A;  1NPZ A;  8PCH A;  3BB7 A;  3V6C A;  4BS5 A;  3CBJ A;  1AYV A;  1AU3 A;  2UZJ A;  1DF0 A;  5K16 A;  3RVV A;  3K24 A;  3CH3 X;  4PP1 A;  3KW9 A;  1PIP A;  3IHP A;  3MHH A;  1ZCM A;  2FUD A;  1EWO A;  5EF4 A;  2GHU A;  1DKI A;  4RNA A;  1AU0 A;  3HWN A;  2JTC A;  1ICF A;  4BOP A;  1IWD A;  2FRA A;  4QRV A;  3PDF A;  5CVO B;  1SNK A;  2ARY A;  3DF0 A;  1TLO A;  3P5V A;  2AVW A;  3RVX A;  3F5V A;  1AIM A;  1QMY A;  4BS6 A;  2F7D A;  1EF7 A;  2HH5 A;  4QRG A;  4IUM A;  3KX1 A;  2G6D A;  2NQI A;  3KWB X;  2DCD A;  4KLB A;  5J94 A;  1AU2 A;  5KO3 A;  2XU5 A;  4MZS A;  2AGA A;  2DCA A;  1X9Y A;  2AYO A;  4I07 A;  2G7Y A;  2XU4 A;  2AS8 A;  2HD5 A;  3E9S A;  1JQP A;  4N8W A;  5CHV A;  3B21 A;  3W30 A;  1CJL A;  5CVM A;  2C0Y A;  2HXZ A;  1UKF A;  1PVJ A;  2DC7 A;  4RY2 A;  5JH3 A;  2DC9 A;  3TNX A;  1SP4 B;  4BQV A;  4MSX A;  4XUI A;  1BQI A;  5JA7 A;  1F2A A;  4FIP A;  2DOS A;  3GCB A;  3BPM A;  3M99 A;  2DCC A;  1U9V A;  3I06 A;  3MOR A;  3ZNH A;  1HUC B;  1CB5 A;  2F1G A;  1F2B A;  2B1M A;  2XU3 A;  4PAD A;  4ZTB A;  1PPO A;  3O65 A;  1QXP A;  2AUZ A;  3U8E A;  1U9W A;  1PAD A;  1BY8 A;  4YVA A;  2PRE A;  3P5X A;  1MS6 A;  4GUA A;  2PAD A;  3MP2 A;  1EWL A;  1GMY A;  2O6X A;  5E6J A;  4QH6 A;  2IPP B;  4CDD B;  4RKX A;  2BDL A;  4BOU A;  4PI3 A;  1MHW A;  2HHN A;  4D8E A;  3N4C A;  2AU1 A;  3IUT A;  3S3R A;  2DZY A;  3PT2 A;  2E03 A;  1CPJ A;  4PP2 E;  4P6E A;  4HXD B;  4WA6 A;  3K8U A;  2HWK A;  2E00 A;  3P5U A;  1MIR A;  4RF0 A;  4BPV A;  1ATK A;  3CBK A;  2FTD A;  3AI8 A;  3C0R A;  3USV A;  4N4Z A;  5JZE A;  3OQC A;  1Q6K A;  1CS8 A;  3PSE A;  1TL9 A;  3OF9 A;  1DEU A;  1ZIV A;  1YVB A;  1BGO A;  2DJG B;  1VSN A;  3BWK A;  4OEL A;  2NQD B;  3H6S A;  4FJC A;  2R9O A;  1YZB A;  3HHI A;  2G8J A;  1STF E;  3KWZ A;  3IFU A;  3NHE A;  2R9N A;  3PHX A;  4K7C A;  4M0W A;  3E1Z B;  4BOZ A; 
#chains in the Genus database with same CATH homology
 4X6J A;  1K3B B;  1KFX L;  2R9F A;  1YK8 A;  7PCK A;  2R6N A;  3BC3 A;  1XKG A;  3IMA A;  3N3G A;  4CDE B;  3S3Q A;  2R9C A;  2YJ8 A;  2DCB A;  3BPF A;  3P5W A;  3PNR A;  4Q8G A;  2P86 A;  4CDC B;  2CB5 A;  3MHS A;  2YJ9 A;  2OP3 A;  1MEG A;  2ATO A;  4AXL A;  2WBF X;  4ZUX U;  3IOQ A;  1CSB B;  3OIS A;  2BSZ A;  2H7J A;  2E02 A;  5F02 A;  3O0U A;  1AYW A;  2ACT A;  1AU4 A;  3KKU A;  2AUX A;  4FK5 A;  4X6I A;  1ITO A;  9PAP A;  2NQG A;  1PCI A;  2FYE A;  2YJC A;  2DC6 A;  2JQF R;  3CH2 X;  1QDQ A;  4X6H A;  1EWP A;  3K9M A;  2Y6E A;  3QT4 A;  2FT2 A;  1NL6 A;  3WXE A;  3H89 A;  1ME4 A;  2VFC A;  1VJV A;  5FPW A;  1U9X A;  1Y4H A;  1PPD A;  6PAD A;  2XU1 A;  2PNS A;  5A24 A;  1KFU L;  3BCN A;  1W5R A;  4YYQ A;  3F75 A;  1YT7 A;  1MEM A;  4DMX A;  4GUZ A;  1Y08 A;  2OZ2 A;  5PAD A;  4DMY A;  1MDW A;  2OUL A;  3KFQ A;  1PPN A;  1QOL A;  4XR7 A;  4N79 A;  3HD3 A;  2FO5 A;  2PBH A;  3N3K A;  4G54 A;  3IV2 A;  2P7U A;  2NQA A;  3LFY A;  4YYU A;  4CZW A;  4YYS A;  1CVZ A;  1POP A;  1U5I A;  2B1N A;  3WXG A;  1ME3 A;  4W5C A;  1YK7 A;  3RVW A;  2Y5B A;  1PE6 A;  2VHS A;  4QRX A;  2YJB A;  2DC8 A;  1M6D A;  1E2T A;  1NLJ A;  3O1G A;  3H7D A;  3H8B A;  2R9M A;  1GLO A;  3WXF A;  4YYV A;  2VHF A;  4HWY A;  4P6G A;  1AYU A;  1CTE A;  2CIO A;  2DJF B;  4I04 A;  3IEJ A;  3LTW A;  1U9Q X;  3PBH A;  4W5B A;  3H8C A;  2DZZ A;  3V6E A;  1O0E A;  1F2C A;  1CV8 A;  2GFO A;  2FQ9 A;  3LXS A;  3QSD A;  1EWM A;  1A6R A;  1GEC E;  2AYN A;  4W4U A;  4YYW A;  4CDF B;  2G8E A;  1PXV A;  1CQD A;  1PPP A;  3D6S A;  1GX3 A;  1FH0 A;  3B79 A;  4QBB A;  5CHT A;  4BSQ A;  3ERV A;  1NB3 A;  4YYR A;  1F29 A;  3I3T A;  1NB5 A;  4OEM A;  2IBI A;  4AXM A;  5CVN B;  2BDZ A;  2P0R A;  3QJ3 A;  4I05 A;  1NQC A;  1KHP A;  2AIM A;  1W6F A;  1PBH A;  4Q8H A;  1KXR A;  4MZO A;  3OF8 A;  3BOW A;  1KHQ A;  3ZUA A;  3MTN A;  1THE A;  2FRQ A;  4YV8 A;  2JQG R;  3OVZ A;  2E01 A;  1GCB A;  5EGW A;  2YJ2 A;  3PW3 A;  1TU6 A;  3OVX A;  1S4V A;  1BP4 A;  1AEC A;  3HHA A;  1YAL A;  3KSE A;  3C9E A;  1NPZ A;  8PCH A;  3V6C A;  4BS5 A;  3CBJ A;  1AYV A;  1AU3 A;  1DF0 A;  5K16 A;  3RVV A;  3K24 A;  3CH3 X;  4PP1 A;  3KW9 A;  1PIP A;  3IHP A;  3MHH A;  1ZCM A;  4BGF A;  2FUD A;  1EWO A;  5EF4 A;  2GHU A;  1AU0 A;  3HWN A;  1ICF A;  1IWD A;  2FRA A;  4QRV A;  3PDF A;  5CVO B;  1SNK A;  2ARY A;  3DF0 A;  1TLO A;  3P5V A;  2AVW A;  3RVX A;  3F5V A;  1AIM A;  1QMY A;  4BS6 A;  2F7D A;  1EF7 A;  2HH5 A;  4QRG A;  2VFB A;  3KX1 A;  2G6D A;  2NQI A;  3KWB X;  2DCD A;  4KLB A;  5J94 A;  1AU2 A;  2XU5 A;  4MZS A;  2DCA A;  1X9Y A;  2AYO A;  4I07 A;  2G7Y A;  2XU4 A;  2AS8 A;  2HD5 A;  1JQP A;  4N8W A;  5CHV A;  4NV7 A;  1CJL A;  5CVM A;  2C0Y A;  2HXZ A;  4NV8 A;  2DC7 A;  4RY2 A;  5JH3 A;  2DC9 A;  3TNX A;  1SP4 B;  4BQV A;  4MSX A;  4XUI A;  1BQI A;  5JA7 A;  1F2A A;  4FIP A;  3GCB A;  3BPM A;  3M99 A;  2DCC A;  1U9V A;  3I06 A;  3MOR A;  1HUC B;  1CB5 A;  2F1G A;  1F2B A;  2B1M A;  2XU3 A;  4PAD A;  1PPO A;  1QXP A;  2AUZ A;  3U8E A;  1U9W A;  1PAD A;  1BY8 A;  4YVA A;  2PRE A;  3P5X A;  1MS6 A;  2PAD A;  1EWL A;  1GMY A;  2O6X A;  4QH6 A;  2IPP B;  4CDD B;  2BDL A;  4PI3 A;  1MHW A;  2HHN A;  3D9W A;  2AU1 A;  3IUT A;  3N4C A;  3S3R A;  2DZY A;  2E03 A;  1CPJ A;  4PP2 E;  4P6E A;  4WA6 A;  3K8U A;  2E00 A;  3P5U A;  1MIR A;  4BPV A;  1ATK A;  3CBK A;  2FTD A;  3AI8 A;  3USV A;  4N4Z A;  1Q6K A;  1CS8 A;  1TL9 A;  3OF9 A;  1DEU A;  1ZIV A;  1YVB A;  1BGO A;  2DJG B;  1VSN A;  3BWK A;  4OEL A;  2NQD B;  3H6S A;  4C5P A;  1W4T A;  4FJC A;  2R9O A;  3HHI A;  2G8J A;  1STF E;  3KWZ A;  3NHE A;  2R9N A;  4B55 A;  4K7C A;  3E1Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...