1AU4A

Crystal structure of the cysteine protease human cathepsin k in complex with a covalent pyrrolidinone inhibitor
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformationally constrained 1,3-diamino ketones: a series of potent inhibitors of the cysteine protease cathepsin K.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords CATHEPSIN K
total genus 56
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 1997-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1au4A00
4Q8GA 2DCCA 3BOWA 4W5CA 4QRGA 1PXVA 3N4CA 1PE6A 2Y5BA 4CDDB 3MTNA 2NQDB 1YK8A 1NB5A 2C0YA 3TNXA 3RVWA 4CDCB 3F5VA 4CDFB 2NQIA 1MHWA 2B1MA 1CQDA 2DC9A 4MSXA 4PADA 4YYUA 3KW9A 9PAPA 1SP4B 3RVXA 5JA7A 2R9MA 4QRVA 1KFUL 3ERVA 3PBHA 1ME3A 1EWMA 2DCDA 1EF7A 2DC7A 2PADA 3DF0A 1U5IA 4AXMA 1KHPA 2F7DA 2R9NA 1AIMA 3WXEA 1POPA 4BSQA 2IPPB 4PP2E 2BDLA 1A6RA 1PBHA 2XU5A 1BP4A 1PCIA 4RY2A 3KWBX 3H6SA 1DF0A 1NLJA 1CSBB 2E02A 2YJ9A 2FUDA 3V6EA 1AECA 2YJCA 2FT2A 1MS6A 5CVNB 1THEA 1ME4A 3K9MA 4BQVA 4X6HA 4CDEB 1ATKA 3E1ZB 1GECE 3WXGA 3N3KA 4AXLA 3IUTA 3V6CA 8PCHA 2XU1A 1PPDA 1O0EA 1QOLA 2F1GA 1BY8A 3H89A 4YV8A 3RVVA 2H7JA 3H7DA 2P7UA 2B1NA 3C9EA 1TU6A 2G8JA 1Q6KA 4N79A 4HWYA 2R6NA 3CH2X 1NPZA 1KXRA 2DZYA 2HD5A 5CVOB 3I3TA 1ZCMA 1CVZA 2FRQA 3QSDA 2DC8A 1KFXL 4FJCA 3IEJA 4X6IA 4MZSA 1CS8A 2HHNA 3CBJA 3HWNA 3BPMA 2YJ2A 3N3GA 1Y4HA 1MIRA 3KFQA 2VHSA 2FO5A 2PNSA 3S3RA 4QBBA 4BS6A 3OF9A 2OP3A 2E01A 1M6DA 3I06A 2BDZA 3P5VA 3OVZA 3IHPA 3USVA 1AU2A 4BPVA 2DCAA 3K24A 4DMYA 2PBHA 1YK7A 5CHVA 3QJ3A 1ITOA 3IOQA 1K3BB 1QXPA 2NQGA 1PADA 2VHFA 2HXZA 2R9CA 1CB5A 5EF4A 2IBIA 1Y08A 1GMYA 3BPFA 1YVBA 2R9FA 1GLOA 2AUXA 1ZIVA 2DC6A 2OZ2A 4YYVA 1MDWA 1U9VA 1CPJA 1PPPA 1AU3A 1ICFA 2CIOA 3HHAA 3LFYA 3P5UA 6PADA 5CVMA 5K16A 3U8EA 1IWDA 2R9OA 2XU3A 2XU4A 3B79A 4X6JA 1TLOA 4YYWA 3P5XA 1JQPA 3BWKA 4YVAA 2PREA 3ZUAA 1SNKA 3IMAA 4QH6A 2HH5A 1F29A 2Y6EA 4BS5A 3PDFA 2JQFR 4I05A 1F2CA 1U9QX 5J94A 1PPNA 1AU0A 1EWOA 5JH3A 3GCBA 1AYWA 2ACTA 2FRAA 1PPOA 1YALA 2DZZA 4QRXA 3KX1A 4YYRA 2NQAA 5F02A 1CTEA 4XR7A 3BC3A 1PIPA 4OELA 1AYVA 3P5WA 3D6SA 2AVWA 4FIPA 3PNRA 1MEMA 3LXSA 3CBKA 2AIMA 4G54A 1NB3A 1NL6A 1HUCB 2DJFB 2OULA 3WXFA 2JQGR 3S3QA 2G6DA 7PCKA 1VJVA 3F75A 3O0UA 4WA6A 3PW3A 3H8CA 2P0RA 1F2BA 4PP1A 3IV2A 2O6XA 1U9XA 1F2AA 1S4VA 1GCBA 4FK5A 5A24A 1CJLA 1AU4A 1NQCA 4ZUXU 4I04A 2AYNA 3KSEA 4XUIA 1TL9A 3QT4A 2YJ8A 2FTDA 2ARYA 3CH3X 1BGOA 1U9WA 3NHEA 4P6GA 1AYUA 3OF8A 2AYOA 4CZWA 3MHSA 3MORA 1YT7A 3BCNA 4KLBA 4YYQA 4W4UA 2DCBA 5PADA 2AUZA 3OISA 2FYEA 4K7CA 5CHTA 2E03A 1KHQA 4N4ZA 4YYSA 2CB5A 3K8UA 1EWPA 4PI3A 3M99A 2DJGB 4I07A 1QDQA 1STFE 2FQ9A 1EWLA 1CV8A 2AU1A 4OEMA 1XKGA 2GFOA 3HD3A 1VSNA 3AI8A 4Q8HA 5EGWA 4MZOA 3OVXA 2YJBA 1FH0A 1X9YA 3HHIA 4P6EA 4DMXA 2G7YA 3O1GA 1QMYA 3H8BA 1DEUA 5FPWA 3KKUA 2G8EA 4W5BA 1BQIA 2P86A 1MEGA 2ATOA 2AS8A 2E00A 3MHHA 2GHUA 3KWZA 4N8WA 2WBFX
chains in the Genus database with same CATH superfamily
3O65A 4Q8GA 4BOZA 2DCCA 3BOWA 4ZTBA 4W5CA 4QRGA 3PT2A 1PXVA 3N4CA 2DOSA 1PE6A 2Y5BA 4CDDB 3MTNA 2NQDB 1YK8A 2FE8A 4GUAA 1NB5A 2C0YA 3TNXA 3RVWA 2BTWA 4CDCB 3F5VA 4CDFB 2NQIA 1MHWA 2B1MA 1CQDA 2DC9A 4MSXA 4PADA 4YYUA 3KW9A 9PAPA 1SP4B 3RVXA 5JA7A 2R9MA 2AGAA 1KFUL 4QRVA 3ERVA 3PBHA 1ME3A 1EWMA 2DCDA 1EF7A 2DC7A 2PADA 3DF0A 1U5IA 4AXMA 3TRKA 1KHPA 2F7DA 2R9NA 1AIMA 3E9SA 3WXEA 1POPA 4BSQA 2IPPB 4PP2E 2BDLA 4R3DA 1A6RA 1PBHA 2XU5A 1BP4A 5JZEA 1PCIA 4RY2A 3KWBX 3H6SA 1DF0A 1NLJA 3PRMA 4MM3B 1CSBB 2E02A 2YJ9A 2FUDA 3W30A 3V6EA 3MP2A 1AECA 2YJCA 4PT5A 2FT2A 4BOPA 1MS6A 5CVNB 4XZXA 1THEA 1ME4A 3K9MA 4BQVA 4X6HA 4CDEB 1ATKA 3E1ZB 3ZNHA 1GECE 3WXGA 3N3KA 3B21A 3MJ5A 4AXLA 3IUTA 3V6CA 8PCHA 2XU1A 1PPDA 2BTWB 1O0EA 1QOLA 3BBAA 2F1GA 1BY8A 3H89A 4YV8A 3RVVA 2H7JA 3BY4A 3H7DA 2P7UA 2B1NA 3C9EA 3PHXA 1TU6A 2G8JA 1Q6KA 4N79A 4HWYA 2R6NA 5KO3A 1PVJA 3CH2X 1NPZA 1KXRA 2DZYA 2HD5A 5CVOB 3I3TA 1ZCMA 1CVZA 2FRQA 3PHWA 3QSDA 2DC8A 3PRPA 1KFXL 4FJCA 3IEJA 4X6IA 4MZSA 1CS8A 2HHNA 3CBJA 3HWNA 3BPMA 2YJ2A 3N3GA 1Y4HA 1MIRA 3KFQA 2VHSA 2FO5A 2PNSA 3S3RA 4QBBA 4BS6A 3OF9A 2OP3A 2E01A 1M6DA 3I06A 2BDZA 4MI7A 3P5VA 3OVZA 3IHPA 3USVA 1AU2A 2JTCA 4BPVA 2DCAA 3K24A 4DMYA 2PBHA 1YK7A 5CHVA 3QJ3A 3TMPA 2HWKA 1DKIA 1ITOA 3IOQA 1K3BB 1QXPA 2NQGA 1PADA 2VHFA 2HXZA 2R9CA 1CB5A 5EF4A 2IBIA 1Y08A 1GMYA 3BPFA 2UZJA 1YVBA 2R9FA 1GLOA 2AUXA 3BB7A 1ZIVA 2DC6A 2OZ2A 4YYVA 1MDWA 3C0RA 1CPJA 1PPPA 1AU3A 1U9VA 1ICFA 2CIOA 3HHAA 3LFYA 4BOUA 3P5UA 4A5UA 6PADA 5CVMA 5K16A 3U8EA 1IWDA 2R9OA 2XU3A 2XU4A 3B79A 4X6JA 5E6JA 3W31A 1TLOA 4YYWA 3P5XA 1JQPA 3BWKA 4YVAA 2PREA 3ZUAA 1SNKA 3IMAA 4QH6A 2HH5A 1F29A 2Y6EA 4BS5A 3PDFA 2JQFR 4P16A 4I05A 1F2CA 1U9QX 5J94A 1PPNA 1AU0A 1EWOA 5JH3A 4BOQA 3GCBA 1AYWA 2ACTA 2FRAA 1PPOA 1YALA 2DZZA 4QRXA 3KX1A 4YYRA 2NQAA 5F02A 1CTEA 4XR7A 3BC3A 1PIPA 4OELA 1AYVA 3P5WA 3D6SA 2AVWA 4FIPA 4RKXA 3PNRA 1MEMA 3LXSA 3CBKA 2AIMA 4G54A 1NB3A 1NL6A 1HUCB 2DJFB 2OULA 4OW0A 3WXFA 2JQGR 3S3QA 2G6DA 7PCKA 2Z84A 1VJVA 3F75A 3O0UA 4WA6A 3PW3A 3H8CA 2P0RA 1F2BA 4PP1A 3IV2A 2O6XA 4M0WA 3PSEA 1U9XA 1F2AA 1S4VA 4HXDB 1GCBA 4FK5A 5A24A 1CJLA 3MTVA 2J7QA 1AU4A 1NQCA 3OQCA 4D8EA 4ZUXU 4I04A 2AYNA 3KSEA 4XUIA 4BOSA 1TL9A 3QT4A 2YJ8A 2BU3A 2JRIA 2FTDA 4RNAA 2ARYA 3CH3X 1BGOA 1U9WA 3NHEA 4REZA 4P6GA 1AYUA 3OF8A 2AYOA 4CZWA 3MHSA 3MORA 1YT7A 3BCNA 4KLBA 4YYQA 4W4UA 2DCBA 5PADA 2AUZA 4D8BA 3OISA 2FYEA 4K7CA 5CHTA 2E03A 1KHQA 4N4ZA 4YYSA 2CB5A 3K8UA 1EWPA 4PI3A 4OVZB 3M99A 2DJGB 4I07A 1QDQA 1STFE 5EZSA 3RNVA 2FQ9A 1EWLA 1CV8A 2AU1A 4OEMA 1XKGA 2GFOA 4D8IA 4IUMA 3HD3A 5EZQA 1VSNA 3AI8A 4Q8HA 5EGWA 4MZOA 3OVXA 2YJBA 1FH0A 1YZBA 1X9YA 3HHIA 4RF1A 4P6EA 4RF0A 4OVZA 3PHUA 4DMXA 2G7YA 3O1GA 4IP3A 1QMYA 3H8BA 1UKFA 1DEUA 5FPWA 3KKUA 2G8EA 2J7QC 4W5BA 1BQIA 2P86A 1MEGA 2ATOA 2AS8A 2E00A 3MHHA 4WURA 3IFUA 2GHUA 3KWZA 4N8WA 2WBFX
chains in the Genus database with same CATH topology
4Q8GA 2DCCA 3BOWA 4W5CA 2VFCA 4QRGA 1PXVA 3N4CA 1PE6A 2Y5BA 4CDDB 3MTNA 2NQDB 1YK8A 1NB5A 2C0YA 3TNXA 3RVWA 4CDCB 3F5VA 4CDFB 2NQIA 1MHWA 2B1MA 1CQDA 2DC9A 4MSXA 4PADA 4YYUA 3KW9A 9PAPA 1SP4B 3RVXA 5JA7A 2R9MA 4QRVA 1KFUL 3ERVA 3PBHA 1ME3A 1EWMA 2DCDA 1EF7A 2DC7A 2PADA 3DF0A 1U5IA 4AXMA 1KHPA 2F7DA 2R9NA 1AIMA 3WXEA 1POPA 4BSQA 2IPPB 4PP2E 2BDLA 1A6RA 1PBHA 2XU5A 1BP4A 1PCIA 4RY2A 3KWBX 3H6SA 1DF0A 1NLJA 1CSBB 2E02A 2YJ9A 2FUDA 3V6EA 1AECA 2YJCA 2FT2A 1MS6A 5CVNB 1THEA 1ME4A 3K9MA 4BQVA 4X6HA 4CDEB 1ATKA 3E1ZB 1GECE 3WXGA 3N3KA 4AXLA 3IUTA 3V6CA 8PCHA 2XU1A 4GUZA 1PPDA 1O0EA 1QOLA 2F1GA 1BY8A 3H89A 4YV8A 2BSZA 3RVVA 2H7JA 3H7DA 2P7UA 2B1NA 3C9EA 1TU6A 2G8JA 1Q6KA 4N79A 4HWYA 2R6NA 3CH2X 1NPZA 1KXRA 2DZYA 2HD5A 5CVOB 3I3TA 1ZCMA 1CVZA 2FRQA 3QSDA 2DC8A 1KFXL 4FJCA 3IEJA 4X6IA 4MZSA 1CS8A 2HHNA 3CBJA 3HWNA 3BPMA 2YJ2A 3N3GA 1Y4HA 1MIRA 3KFQA 2VHSA 2FO5A 2PNSA 3S3RA 4QBBA 4BS6A 3OF9A 2OP3A 2E01A 1M6DA 1GX3A 3I06A 2BDZA 3P5VA 3OVZA 3IHPA 3USVA 1AU2A 4BPVA 2DCAA 3K24A 4DMYA 2PBHA 1YK7A 5CHVA 3QJ3A 1W5RA 1ITOA 3IOQA 1K3BB 1QXPA 2NQGA 1PADA 2VHFA 2HXZA 2R9CA 1CB5A 5EF4A 2IBIA 1Y08A 1GMYA 3BPFA 1YVBA 2R9FA 1GLOA 2AUXA 1ZIVA 2DC6A 2OZ2A 4YYVA 1MDWA 1U9VA 1CPJA 1PPPA 1AU3A 1ICFA 2CIOA 3HHAA 3LFYA 3P5UA 6PADA 5CVMA 5K16A 3U8EA 1IWDA 2R9OA 2XU3A 2XU4A 3B79A 4X6JA 1TLOA 4YYWA 3P5XA 1JQPA 3BWKA 4YVAA 4C5PA 2PREA 3ZUAA 1SNKA 3IMAA 4QH6A 2HH5A 1F29A 2Y6EA 4BS5A 3PDFA 2JQFR 4I05A 1F2CA 1U9QX 5J94A 1PPNA 1AU0A 1EWOA 5JH3A 3GCBA 1AYWA 2ACTA 2FRAA 1PPOA 1YALA 2DZZA 4QRXA 3KX1A 4YYRA 2NQAA 5F02A 1CTEA 4XR7A 3BC3A 1PIPA 4OELA 1AYVA 3P5WA 3D6SA 2AVWA 4FIPA 3PNRA 1MEMA 3LXSA 3CBKA 2AIMA 4G54A 1NB3A 1NL6A 1HUCB 2DJFB 2OULA 3WXFA 4BGFA 2JQGR 3S3QA 2G6DA 7PCKA 1VJVA 3F75A 3O0UA 4WA6A 3PW3A 3H8CA 2P0RA 1F2BA 4PP1A 3IV2A 2O6XA 1U9XA 1F2AA 1S4VA 1GCBA 4FK5A 4B55A 5A24A 1CJLA 1AU4A 1NQCA 4ZUXU 4I04A 2AYNA 3KSEA 4XUIA 1TL9A 3QT4A 1W4TA 2YJ8A 2FTDA 2ARYA 3CH3X 1BGOA 1U9WA 3NHEA 4P6GA 1AYUA 3OF8A 2AYOA 4CZWA 3MHSA 3MORA 1YT7A 3BCNA 4KLBA 4YYQA 4W4UA 2DCBA 5PADA 2VFBA 2AUZA 3OISA 4NV7A 2FYEA 4K7CA 5CHTA 2E03A 1KHQA 4N4ZA 3D9WA 4YYSA 2CB5A 3K8UA 3LTWA 1EWPA 4PI3A 3M99A 2DJGB 4I07A 1QDQA 1STFE 2FQ9A 1EWLA 1CV8A 2AU1A 4OEMA 1XKGA 2GFOA 3HD3A 1VSNA 3AI8A 4Q8HA 5EGWA 4MZOA 1E2TA 3OVXA 2YJBA 1FH0A 1X9YA 3HHIA 4P6EA 4DMXA 2G7YA 3O1GA 4NV8A 1QMYA 3H8BA 1DEUA 5FPWA 1W6FA 3KKUA 2G8EA 4W5BA 1BQIA 2P86A 1MEGA 2ATOA 2AS8A 2E00A 3MHHA 2GHUA 3KWZA 4N8WA 2WBFX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q8G A;  2DCC A;  3BOW A;  4W5C A;  4QRG A;  1PXV A;  3N4C A;  1PE6 A;  2Y5B A;  4CDD B;  3MTN A;  2NQD B;  1YK8 A;  1NB5 A;  2C0Y A;  3TNX A;  3RVW A;  4CDC B;  3F5V A;  4CDF B;  2NQI A;  1MHW A;  2B1M A;  1CQD A;  2DC9 A;  4MSX A;  4PAD A;  4YYU A;  3KW9 A;  9PAP A;  1SP4 B;  3RVX A;  5JA7 A;  2R9M A;  4QRV A;  1KFU L;  3ERV A;  3PBH A;  1ME3 A;  1EWM A;  2DCD A;  1EF7 A;  2DC7 A;  2PAD A;  3DF0 A;  1U5I A;  4AXM A;  1KHP A;  2F7D A;  2R9N A;  1AIM A;  3WXE A;  1POP A;  4BSQ A;  2IPP B;  4PP2 E;  2BDL A;  1A6R A;  1PBH A;  2XU5 A;  1BP4 A;  1PCI A;  4RY2 A;  3KWB X;  3H6S A;  1DF0 A;  1NLJ A;  1CSB B;  2E02 A;  2YJ9 A;  2FUD A;  3V6E A;  1AEC A;  2YJC A;  2FT2 A;  1MS6 A;  5CVN B;  1THE A;  1ME4 A;  3K9M A;  4BQV A;  4X6H A;  4CDE B;  1ATK A;  3E1Z B;  1GEC E;  3WXG A;  3N3K A;  4AXL A;  3IUT A;  3V6C A;  8PCH A;  2XU1 A;  1PPD A;  1O0E A;  1QOL A;  2F1G A;  1BY8 A;  3H89 A;  4YV8 A;  3RVV A;  2H7J A;  3H7D A;  2P7U A;  2B1N A;  3C9E A;  1TU6 A;  2G8J A;  1Q6K A;  4N79 A;  4HWY A;  2R6N A;  3CH2 X;  1NPZ A;  1KXR A;  2DZY A;  2HD5 A;  5CVO B;  3I3T A;  1ZCM A;  1CVZ A;  2FRQ A;  3QSD A;  2DC8 A;  1KFX L;  4FJC A;  3IEJ A;  4X6I A;  4MZS A;  1CS8 A;  2HHN A;  3CBJ A;  3HWN A;  3BPM A;  2YJ2 A;  3N3G A;  1Y4H A;  1MIR A;  3KFQ A;  2VHS A;  2FO5 A;  2PNS A;  3S3R A;  4QBB A;  4BS6 A;  3OF9 A;  2OP3 A;  2E01 A;  1M6D A;  3I06 A;  2BDZ A;  3P5V A;  3OVZ A;  3IHP A;  3USV A;  1AU2 A;  4BPV A;  2DCA A;  3K24 A;  4DMY A;  2PBH A;  1YK7 A;  5CHV A;  3QJ3 A;  1ITO A;  3IOQ A;  1K3B B;  1QXP A;  2NQG A;  1PAD A;  2VHF A;  2HXZ A;  2R9C A;  1CB5 A;  5EF4 A;  2IBI A;  1Y08 A;  1GMY A;  3BPF A;  1YVB A;  2R9F A;  1GLO A;  2AUX A;  1ZIV A;  2DC6 A;  2OZ2 A;  4YYV A;  1MDW A;  1U9V A;  1CPJ A;  1PPP A;  1AU3 A;  1ICF A;  2CIO A;  3HHA A;  3LFY A;  3P5U A;  6PAD A;  5CVM A;  5K16 A;  3U8E A;  1IWD A;  2R9O A;  2XU3 A;  2XU4 A;  3B79 A;  4X6J A;  1TLO A;  4YYW A;  3P5X A;  1JQP A;  3BWK A;  4YVA A;  2PRE A;  3ZUA A;  1SNK A;  3IMA A;  4QH6 A;  2HH5 A;  1F29 A;  2Y6E A;  4BS5 A;  3PDF A;  2JQF R;  4I05 A;  1F2C A;  1U9Q X;  5J94 A;  1PPN A;  1AU0 A;  1EWO A;  5JH3 A;  3GCB A;  1AYW A;  2ACT A;  2FRA A;  1PPO A;  1YAL A;  2DZZ A;  4QRX A;  3KX1 A;  4YYR A;  2NQA A;  5F02 A;  1CTE A;  4XR7 A;  3BC3 A;  1PIP A;  4OEL A;  1AYV A;  3P5W A;  3D6S A;  2AVW A;  4FIP A;  3PNR A;  1MEM A;  3LXS A;  3CBK A;  2AIM A;  4G54 A;  1NB3 A;  1NL6 A;  1HUC B;  2DJF B;  2OUL A;  3WXF A;  2JQG R;  3S3Q A;  2G6D A;  7PCK A;  1VJV A;  3F75 A;  3O0U A;  4WA6 A;  3PW3 A;  3H8C A;  2P0R A;  1F2B A;  4PP1 A;  3IV2 A;  2O6X A;  1U9X A;  1F2A A;  1S4V A;  1GCB A;  4FK5 A;  5A24 A;  1CJL A;  1AU4 A;  1NQC A;  4ZUX U;  4I04 A;  2AYN A;  3KSE A;  4XUI A;  1TL9 A;  3QT4 A;  2YJ8 A;  2FTD A;  2ARY A;  3CH3 X;  1BGO A;  1U9W A;  3NHE A;  4P6G A;  1AYU A;  3OF8 A;  2AYO A;  4CZW A;  3MHS A;  3MOR A;  1YT7 A;  3BCN A;  4KLB A;  4YYQ A;  4W4U A;  2DCB A;  5PAD A;  2AUZ A;  3OIS A;  2FYE A;  4K7C A;  5CHT A;  2E03 A;  1KHQ A;  4N4Z A;  4YYS A;  2CB5 A;  3K8U A;  1EWP A;  4PI3 A;  3M99 A;  2DJG B;  4I07 A;  1QDQ A;  1STF E;  2FQ9 A;  1EWL A;  1CV8 A;  2AU1 A;  4OEM A;  1XKG A;  2GFO A;  3HD3 A;  1VSN A;  3AI8 A;  4Q8H A;  5EGW A;  4MZO A;  3OVX A;  2YJB A;  1FH0 A;  1X9Y A;  3HHI A;  4P6E A;  4DMX A;  2G7Y A;  3O1G A;  1QMY A;  3H8B A;  1DEU A;  5FPW A;  3KKU A;  2G8E A;  4W5B A;  1BQI A;  2P86 A;  1MEG A;  2ATO A;  2AS8 A;  2E00 A;  3MHH A;  2GHU A;  3KWZ A;  4N8W A;  2WBF X; 
#chains in the Genus database with same CATH topology
 3O65 A;  4Q8G A;  4BOZ A;  2DCC A;  3BOW A;  4ZTB A;  4W5C A;  4QRG A;  3PT2 A;  1PXV A;  3N4C A;  2DOS A;  1PE6 A;  2Y5B A;  4CDD B;  3MTN A;  2NQD B;  1YK8 A;  2FE8 A;  4GUA A;  1NB5 A;  2C0Y A;  3TNX A;  3RVW A;  2BTW A;  4CDC B;  3F5V A;  4CDF B;  2NQI A;  1MHW A;  2B1M A;  1CQD A;  2DC9 A;  4MSX A;  4PAD A;  4YYU A;  3KW9 A;  9PAP A;  1SP4 B;  3RVX A;  5JA7 A;  2R9M A;  2AGA A;  1KFU L;  4QRV A;  3ERV A;  3PBH A;  1ME3 A;  1EWM A;  2DCD A;  1EF7 A;  2DC7 A;  2PAD A;  3DF0 A;  1U5I A;  4AXM A;  3TRK A;  1KHP A;  2F7D A;  2R9N A;  1AIM A;  3E9S A;  3WXE A;  1POP A;  4BSQ A;  2IPP B;  4PP2 E;  2BDL A;  4R3D A;  1A6R A;  1PBH A;  2XU5 A;  1BP4 A;  5JZE A;  1PCI A;  4RY2 A;  3KWB X;  3H6S A;  1DF0 A;  1NLJ A;  3PRM A;  4MM3 B;  1CSB B;  2E02 A;  2YJ9 A;  2FUD A;  3W30 A;  3V6E A;  3MP2 A;  1AEC A;  2YJC A;  4PT5 A;  2FT2 A;  4BOP A;  1MS6 A;  5CVN B;  4XZX A;  1THE A;  1ME4 A;  3K9M A;  4BQV A;  4X6H A;  4CDE B;  1ATK A;  3E1Z B;  3ZNH A;  1GEC E;  3WXG A;  3N3K A;  3B21 A;  3MJ5 A;  4AXL A;  3IUT A;  3V6C A;  8PCH A;  2XU1 A;  1PPD A;  2BTW B;  1O0E A;  1QOL A;  3BBA A;  2F1G A;  1BY8 A;  3H89 A;  4YV8 A;  3RVV A;  2H7J A;  3BY4 A;  3H7D A;  2P7U A;  2B1N A;  3C9E A;  3PHX A;  1TU6 A;  2G8J A;  1Q6K A;  4N79 A;  4HWY A;  2R6N A;  5KO3 A;  1PVJ A;  3CH2 X;  1NPZ A;  1KXR A;  2DZY A;  2HD5 A;  5CVO B;  3I3T A;  1ZCM A;  1CVZ A;  2FRQ A;  3PHW A;  3QSD A;  2DC8 A;  3PRP A;  1KFX L;  4FJC A;  3IEJ A;  4X6I A;  4MZS A;  1CS8 A;  2HHN A;  3CBJ A;  3HWN A;  3BPM A;  2YJ2 A;  3N3G A;  1Y4H A;  1MIR A;  3KFQ A;  2VHS A;  2FO5 A;  2PNS A;  3S3R A;  4QBB A;  4BS6 A;  3OF9 A;  2OP3 A;  2E01 A;  1M6D A;  3I06 A;  2BDZ A;  4MI7 A;  3P5V A;  3OVZ A;  3IHP A;  3USV A;  1AU2 A;  2JTC A;  4BPV A;  2DCA A;  3K24 A;  4DMY A;  2PBH A;  1YK7 A;  5CHV A;  3QJ3 A;  3TMP A;  2HWK A;  1DKI A;  1ITO A;  3IOQ A;  1K3B B;  1QXP A;  2NQG A;  1PAD A;  2VHF A;  2HXZ A;  2R9C A;  1CB5 A;  5EF4 A;  2IBI A;  1Y08 A;  1GMY A;  3BPF A;  2UZJ A;  1YVB A;  2R9F A;  1GLO A;  2AUX A;  3BB7 A;  1ZIV A;  2DC6 A;  2OZ2 A;  4YYV A;  1MDW A;  3C0R A;  1CPJ A;  1PPP A;  1AU3 A;  1U9V A;  1ICF A;  2CIO A;  3HHA A;  3LFY A;  4BOU A;  3P5U A;  4A5U A;  6PAD A;  5CVM A;  5K16 A;  3U8E A;  1IWD A;  2R9O A;  2XU3 A;  2XU4 A;  3B79 A;  4X6J A;  5E6J A;  3W31 A;  1TLO A;  4YYW A;  3P5X A;  1JQP A;  3BWK A;  4YVA A;  2PRE A;  3ZUA A;  1SNK A;  3IMA A;  4QH6 A;  2HH5 A;  1F29 A;  2Y6E A;  4BS5 A;  3PDF A;  2JQF R;  4P16 A;  4I05 A;  1F2C A;  1U9Q X;  5J94 A;  1PPN A;  1AU0 A;  1EWO A;  5JH3 A;  4BOQ A;  3GCB A;  1AYW A;  2ACT A;  2FRA A;  1PPO A;  1YAL A;  2DZZ A;  4QRX A;  3KX1 A;  4YYR A;  2NQA A;  5F02 A;  1CTE A;  4XR7 A;  3BC3 A;  1PIP A;  4OEL A;  1AYV A;  3P5W A;  3D6S A;  2AVW A;  4FIP A;  4RKX A;  3PNR A;  1MEM A;  3LXS A;  3CBK A;  2AIM A;  4G54 A;  1NB3 A;  1NL6 A;  1HUC B;  2DJF B;  2OUL A;  4OW0 A;  3WXF A;  2JQG R;  3S3Q A;  2G6D A;  7PCK A;  2Z84 A;  1VJV A;  3F75 A;  3O0U A;  4WA6 A;  3PW3 A;  3H8C A;  2P0R A;  1F2B A;  4PP1 A;  3IV2 A;  2O6X A;  4M0W A;  3PSE A;  1U9X A;  1F2A A;  1S4V A;  4HXD B;  1GCB A;  4FK5 A;  5A24 A;  1CJL A;  3MTV A;  2J7Q A;  1AU4 A;  1NQC A;  3OQC A;  4D8E A;  4ZUX U;  4I04 A;  2AYN A;  3KSE A;  4XUI A;  4BOS A;  1TL9 A;  3QT4 A;  2YJ8 A;  2BU3 A;  2JRI A;  2FTD A;  4RNA A;  2ARY A;  3CH3 X;  1BGO A;  1U9W A;  3NHE A;  4REZ A;  4P6G A;  1AYU A;  3OF8 A;  2AYO A;  4CZW A;  3MHS A;  3MOR A;  1YT7 A;  3BCN A;  4KLB A;  4YYQ A;  4W4U A;  2DCB A;  5PAD A;  2AUZ A;  4D8B A;  3OIS A;  2FYE A;  4K7C A;  5CHT A;  2E03 A;  1KHQ A;  4N4Z A;  4YYS A;  2CB5 A;  3K8U A;  1EWP A;  4PI3 A;  4OVZ B;  3M99 A;  2DJG B;  4I07 A;  1QDQ A;  1STF E;  5EZS A;  3RNV A;  2FQ9 A;  1EWL A;  1CV8 A;  2AU1 A;  4OEM A;  1XKG A;  2GFO A;  4D8I A;  4IUM A;  3HD3 A;  5EZQ A;  1VSN A;  3AI8 A;  4Q8H A;  5EGW A;  4MZO A;  3OVX A;  2YJB A;  1FH0 A;  1YZB A;  1X9Y A;  3HHI A;  4RF1 A;  4P6E A;  4RF0 A;  4OVZ A;  3PHU A;  4DMX A;  2G7Y A;  3O1G A;  4IP3 A;  1QMY A;  3H8B A;  1UKF A;  1DEU A;  5FPW A;  3KKU A;  2G8E A;  2J7Q C;  4W5B A;  1BQI A;  2P86 A;  1MEG A;  2ATO A;  2AS8 A;  2E00 A;  3MHH A;  4WUR A;  3IFU A;  2GHU A;  3KWZ A;  4N8W A;  2WBF X; 
#chains in the Genus database with same CATH homology
 4Q8G A;  2DCC A;  3BOW A;  4W5C A;  2VFC A;  4QRG A;  1PXV A;  3N4C A;  1PE6 A;  2Y5B A;  4CDD B;  3MTN A;  2NQD B;  1YK8 A;  1NB5 A;  2C0Y A;  3TNX A;  3RVW A;  4CDC B;  3F5V A;  4CDF B;  2NQI A;  1MHW A;  2B1M A;  1CQD A;  2DC9 A;  4MSX A;  4PAD A;  4YYU A;  3KW9 A;  9PAP A;  1SP4 B;  3RVX A;  5JA7 A;  2R9M A;  4QRV A;  1KFU L;  3ERV A;  3PBH A;  1ME3 A;  1EWM A;  2DCD A;  1EF7 A;  2DC7 A;  2PAD A;  3DF0 A;  1U5I A;  4AXM A;  1KHP A;  2F7D A;  2R9N A;  1AIM A;  3WXE A;  1POP A;  4BSQ A;  2IPP B;  4PP2 E;  2BDL A;  1A6R A;  1PBH A;  2XU5 A;  1BP4 A;  1PCI A;  4RY2 A;  3KWB X;  3H6S A;  1DF0 A;  1NLJ A;  1CSB B;  2E02 A;  2YJ9 A;  2FUD A;  3V6E A;  1AEC A;  2YJC A;  2FT2 A;  1MS6 A;  5CVN B;  1THE A;  1ME4 A;  3K9M A;  4BQV A;  4X6H A;  4CDE B;  1ATK A;  3E1Z B;  1GEC E;  3WXG A;  3N3K A;  4AXL A;  3IUT A;  3V6C A;  8PCH A;  2XU1 A;  4GUZ A;  1PPD A;  1O0E A;  1QOL A;  2F1G A;  1BY8 A;  3H89 A;  4YV8 A;  2BSZ A;  3RVV A;  2H7J A;  3H7D A;  2P7U A;  2B1N A;  3C9E A;  1TU6 A;  2G8J A;  1Q6K A;  4N79 A;  4HWY A;  2R6N A;  3CH2 X;  1NPZ A;  1KXR A;  2DZY A;  2HD5 A;  5CVO B;  3I3T A;  1ZCM A;  1CVZ A;  2FRQ A;  3QSD A;  2DC8 A;  1KFX L;  4FJC A;  3IEJ A;  4X6I A;  4MZS A;  1CS8 A;  2HHN A;  3CBJ A;  3HWN A;  3BPM A;  2YJ2 A;  3N3G A;  1Y4H A;  1MIR A;  3KFQ A;  2VHS A;  2FO5 A;  2PNS A;  3S3R A;  4QBB A;  4BS6 A;  3OF9 A;  2OP3 A;  2E01 A;  1M6D A;  1GX3 A;  3I06 A;  2BDZ A;  3P5V A;  3OVZ A;  3IHP A;  3USV A;  1AU2 A;  4BPV A;  2DCA A;  3K24 A;  4DMY A;  2PBH A;  1YK7 A;  5CHV A;  3QJ3 A;  1W5R A;  1ITO A;  3IOQ A;  1K3B B;  1QXP A;  2NQG A;  1PAD A;  2VHF A;  2HXZ A;  2R9C A;  1CB5 A;  5EF4 A;  2IBI A;  1Y08 A;  1GMY A;  3BPF A;  1YVB A;  2R9F A;  1GLO A;  2AUX A;  1ZIV A;  2DC6 A;  2OZ2 A;  4YYV A;  1MDW A;  1U9V A;  1CPJ A;  1PPP A;  1AU3 A;  1ICF A;  2CIO A;  3HHA A;  3LFY A;  3P5U A;  6PAD A;  5CVM A;  5K16 A;  3U8E A;  1IWD A;  2R9O A;  2XU3 A;  2XU4 A;  3B79 A;  4X6J A;  1TLO A;  4YYW A;  3P5X A;  1JQP A;  3BWK A;  4YVA A;  4C5P A;  2PRE A;  3ZUA A;  1SNK A;  3IMA A;  4QH6 A;  2HH5 A;  1F29 A;  2Y6E A;  4BS5 A;  3PDF A;  2JQF R;  4I05 A;  1F2C A;  1U9Q X;  5J94 A;  1PPN A;  1AU0 A;  1EWO A;  5JH3 A;  3GCB A;  1AYW A;  2ACT A;  2FRA A;  1PPO A;  1YAL A;  2DZZ A;  4QRX A;  3KX1 A;  4YYR A;  2NQA A;  5F02 A;  1CTE A;  4XR7 A;  3BC3 A;  1PIP A;  4OEL A;  1AYV A;  3P5W A;  3D6S A;  2AVW A;  4FIP A;  3PNR A;  1MEM A;  3LXS A;  3CBK A;  2AIM A;  4G54 A;  1NB3 A;  1NL6 A;  1HUC B;  2DJF B;  2OUL A;  3WXF A;  4BGF A;  2JQG R;  3S3Q A;  2G6D A;  7PCK A;  1VJV A;  3F75 A;  3O0U A;  4WA6 A;  3PW3 A;  3H8C A;  2P0R A;  1F2B A;  4PP1 A;  3IV2 A;  2O6X A;  1U9X A;  1F2A A;  1S4V A;  1GCB A;  4FK5 A;  4B55 A;  5A24 A;  1CJL A;  1AU4 A;  1NQC A;  4ZUX U;  4I04 A;  2AYN A;  3KSE A;  4XUI A;  1TL9 A;  3QT4 A;  1W4T A;  2YJ8 A;  2FTD A;  2ARY A;  3CH3 X;  1BGO A;  1U9W A;  3NHE A;  4P6G A;  1AYU A;  3OF8 A;  2AYO A;  4CZW A;  3MHS A;  3MOR A;  1YT7 A;  3BCN A;  4KLB A;  4YYQ A;  4W4U A;  2DCB A;  5PAD A;  2VFB A;  2AUZ A;  3OIS A;  4NV7 A;  2FYE A;  4K7C A;  5CHT A;  2E03 A;  1KHQ A;  4N4Z A;  3D9W A;  4YYS A;  2CB5 A;  3K8U A;  3LTW A;  1EWP A;  4PI3 A;  3M99 A;  2DJG B;  4I07 A;  1QDQ A;  1STF E;  2FQ9 A;  1EWL A;  1CV8 A;  2AU1 A;  4OEM A;  1XKG A;  2GFO A;  3HD3 A;  1VSN A;  3AI8 A;  4Q8H A;  5EGW A;  4MZO A;  1E2T A;  3OVX A;  2YJB A;  1FH0 A;  1X9Y A;  3HHI A;  4P6E A;  4DMX A;  2G7Y A;  3O1G A;  4NV8 A;  1QMY A;  3H8B A;  1DEU A;  5FPW A;  1W6F A;  3KKU A;  2G8E A;  4W5B A;  1BQI A;  2P86 A;  1MEG A;  2ATO A;  2AS8 A;  2E00 A;  3MHH A;  2GHU A;  3KWZ A;  4N8W A;  2WBF X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...