1AU4A

Crystal structure of the cysteine protease human cathepsin k in complex with a covalent pyrrolidinone inhibitor
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformationally constrained 1,3-diamino ketones: a series of potent inhibitors of the cysteine protease cathepsin K.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords CATHEPSIN K
total genus 56
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 1997-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1au4A00
4FK5A 3OVZA 2ARYA 3P5WA 4I05A 4PP2E 4X6HA 2NQDB 3P5XA 1VJVA 2BDLA 1K3BB 3WXEA 5PADA 4QRVA 3O0UA 1NB3A 1HUCB 4AXMA 1NQCA 4X6IA 2YJCA 3PBHA 3E1ZB 2HXZA 1MEMA 1MIRA 1PXVA 1YK7A 4YYQA 1Y4HA 4BPVA 3S3QA 3V6EA 2FQ9A 3BWKA 2XU5A 3K9MA 1F2CA 3CBJA 4P6EA 1U5IA 3M99A 1CV8A 4YYSA 3H89A 3I06A 4W4UA 1POPA 3KWBX 2R9MA 2DJGB 2FT2A 2JQGR 3BC3A 2IBIA 3U8EA 2NQAA 2DC6A 3KX1A 2PREA 5K16A 3P5UA 4BS6A 7PCKA 3DF0A 1SNKA 1YT7A 3IOQA 1QMYA 5CVOB 2G8JA 3N4CA 3MTNA 2XU3A 1THEA 2R9NA 2YJBA 2DCAA 3CH2X 4PADA 3OF9A 2ATOA 3S3RA 3N3GA 1CVZA 4MSXA 2E00A 1KHQA 3D6SA 2DC8A 4P6GA 2G8EA 4Q8HA 4CZWA 2AS8A 4N79A 1U9XA 2YJ8A 1BQIA 2DC7A 1VSNA 4I07A 2PBHA 2DZZA 4KLBA 2AYOA 1U9QX 2E02A 1JQPA 3MHHA 1TLOA 1KFXL 4K7CA 3K24A 3H7DA 3OVXA 3BOWA 1PADA 2YJ2A 3USVA 4DMXA 4OELA 3OISA 4MZSA 1MEGA 2FTDA 4QBBA 1EWMA 3WXGA 1AU4A 1CPJA 1AU2A 2HD5A 2AUZA 2HH5A 2B1NA 2IPPB 3K8UA 4QRGA 4RY2A 2AYNA 2FYEA 1CS8A 3KKUA 2HHNA 2P7UA 2OZ2A 1GECE 4HWYA 1IWDA 2GHUA 3HHIA 1MHWA 1TU6A 3V6CA 3C9EA 2DZYA 1STFE 4AXLA 4CDDB 3KW9A 2VHFA 2CIOA 1KFUL 1CSBB 1NPZA 2AU1A 1KHPA 2CB5A 2P86A 1AYUA 1S4VA 1CQDA 1PPDA 1EWOA 2Y5BA 3RVVA 3IHPA 4G54A 1F2AA 4YV8A 1ICFA 3PNRA 4CDEB 3MORA 9PAPA 5CHVA 2DCCA 4YYRA 1PPNA 2Y6EA 3QJ3A 4YYVA 1YK8A 2NQGA 4XUIA 3KWZA 3N3KA 1CB5A 1BGOA 5JH3A 1TL9A 1EF7A 1PPPA 4N4ZA 2PNSA 2F1GA 1ZIVA 1XKGA 2R6NA 4OEMA 1AIMA 4X6JA 3H8CA 1Y08A 1QOLA 3LXSA 1EWLA 4YVAA 2AVWA 2DC9A 4ZUXU 4XR7A 3BPMA 2E03A 1CTEA 3NHEA 2F7DA 3WXFA 3AI8A 2G6DA 1PCIA 1BY8A 1EWPA 4I04A 5A24A 2PADA 1ME4A 4PP1A 1F2BA 1YVBA 3H6SA 3QT4A 3PW3A 1O0EA 2C0YA 2DJFB 2FUDA 1SP4B 1GCBA 2WBFX 4BQVA 4FIPA 3HWNA 4FJCA 1ITOA 1PIPA 3CBKA 2AUXA 1AU0A 1AU3A 2DCBA 2E01A 8PCHA 1U9WA 3ZUAA 1YALA 1U9VA 1MS6A 2R9FA 3TNXA 4W5CA 2OP3A 3H8BA 3B79A 3KFQA 5EF4A 2R9OA 5CVNB 4CDFB 1QDQA 4YYWA 1AYVA 4Q8GA 1Q6KA 2GFOA 3GCBA 1NLJA 2FRQA 3RVWA 2XU1A 1DF0A 3P5VA 4CDCB 2B1MA 1PE6A 5CVMA 1FH0A 2O6XA 3MHSA 1BP4A 1NB5A 1QXPA 1PBHA 3OF8A 3HD3A 3F75A 1MDWA 2NQIA 1F29A 3O1GA 3PDFA 5FPWA 4PI3A 3IUTA 1A6RA 4BSQA 2ACTA 3IMAA 1M6DA 2OULA 3RVXA 3LFYA 1ME3A 1X9YA 3I3TA 6PADA 1KXRA 3HHAA 1ATKA 3CH3X 2BDZA 3F5VA 4DMYA 1DEUA 2YJ9A 1GLOA 4YYUA 2P0RA 2XU4A 2R9CA 4QRXA 4WA6A 3BPFA 1AYWA 1NL6A 5F02A 2AIMA 3BCNA 4MZOA 3IV2A 2FO5A 1ZCMA 3KSEA 2VHSA 3ERVA 5J94A 3IEJA 3QSDA 5CHTA 2FRAA 1GMYA 1PPOA 4N8WA 2H7JA 2DCDA 5EGWA 4BS5A 5JA7A 4W5BA 2JQFR 2G7YA 1CJLA 4QH6A 1AECA
chains in the Genus database with same CATH superfamily
4FK5A 3OVZA 2ARYA 3P5WA 4I05A 3IFUA 4PP2E 4X6HA 2NQDB 3MP2A 3P5XA 1VJVA 2BDLA 1K3BB 3WXEA 5PADA 4QRVA 3O0UA 1NB3A 1HUCB 4AXMA 4XZXA 1NQCA 4X6IA 2YJCA 5E6JA 3PBHA 3E1ZB 4GUAA 2HXZA 2J7QC 1MEMA 1MIRA 1PXVA 1YK7A 4YYQA 1Y4HA 4BPVA 3S3QA 3V6EA 2FQ9A 3BWKA 2XU5A 3K9MA 1F2CA 3CBJA 4P6EA 1U5IA 3M99A 1CV8A 4YYSA 3H89A 3I06A 4W4UA 1POPA 3KWBX 4RKXA 2R9MA 2DJGB 2FT2A 2JQGR 3BC3A 2IBIA 1YZBA 4BOUA 3U8EA 2NQAA 2DC6A 2UZJA 3BB7A 3KX1A 2PREA 5K16A 3P5UA 4BS6A 7PCKA 3DF0A 1SNKA 1YT7A 3IOQA 1QMYA 4WURA 5CVOB 3W30A 2G8JA 3N4CA 3MTNA 3PHXA 2XU3A 1THEA 2R9NA 3TRKA 2YJBA 2DCAA 3CH2X 4PADA 3OF9A 4P16A 2ATOA 3S3RA 3N3GA 1CVZA 4MSXA 2E00A 2Z84A 1KHQA 3D6SA 2DC8A 2G8EA 4P6GA 4Q8HA 4CZWA 2AS8A 4N79A 1U9XA 2YJ8A 1BQIA 4BOZA 2DC7A 4BOPA 1VSNA 4I07A 2PBHA 2DZZA 4MM3B 4KLBA 2AYOA 1U9QX 2E02A 1JQPA 3MHHA 1TLOA 5JZEA 1KFXL 4K7CA 3K24A 3H7DA 3OVXA 3BOWA 4RNAA 1PADA 2YJ2A 3USVA 4DMXA 4OELA 5KO3A 3OISA 4MI7A 4MZSA 1MEGA 2FTDA 4QBBA 3B21A 1EWMA 3WXGA 1AU4A 4OW0A 1CPJA 1AU2A 2HD5A 2AUZA 2HH5A 2B1NA 2IPPB 3K8UA 4QRGA 4RY2A 2AYNA 2FYEA 1CS8A 3RNVA 3KKUA 4M0WA 2HHNA 2P7UA 2OZ2A 1GECE 4OVZB 4HWYA 1IWDA 2GHUA 3HHIA 1MHWA 4ZTBA 1TU6A 3V6CA 3C9EA 2DZYA 1UKFA 1STFE 4AXLA 4CDDB 3KW9A 2VHFA 2CIOA 4BOSA 1KFUL 1CSBB 1NPZA 2JTCA 2AU1A 4R3DA 2BU3A 5EZQA 1KHPA 2CB5A 2P86A 1AYUA 1S4VA 1CQDA 1PPDA 1EWOA 2Y5BA 3RVVA 3IHPA 4G54A 1F2AA 4YV8A 1ICFA 3PNRA 4CDEB 3MORA 9PAPA 3PT2A 5CHVA 5EZSA 2DCCA 4YYRA 1PPNA 2Y6EA 3QJ3A 4YYVA 4D8BA 1YK8A 2NQGA 4XUIA 3KWZA 3N3KA 1CB5A 1BGOA 5JH3A 2HWKA 3W31A 1TL9A 1EF7A 1PPPA 4N4ZA 2PNSA 2F1GA 1ZIVA 1XKGA 4A5UA 2R6NA 4OEMA 1AIMA 4X6JA 3H8CA 3PHUA 1Y08A 1QOLA 3LXSA 1EWLA 4YVAA 2AVWA 2DC9A 4ZUXU 4XR7A 3BPMA 2E03A 1CTEA 3NHEA 2F7DA 3BY4A 3WXFA 3AI8A 2G6DA 1PCIA 1BY8A 1EWPA 4I04A 5A24A 2PADA 1ME4A 4PP1A 1F2BA 1YVBA 3H6SA 3QT4A 4RF0A 3MJ5A 3PW3A 1O0EA 2C0YA 2DJFB 2FUDA 1SP4B 4D8EA 1GCBA 2WBFX 4BQVA 3C0RA 2BTWA 4FIPA 2JRIA 3HWNA 4FJCA 1ITOA 1PIPA 3CBKA 2AUXA 1AU0A 1AU3A 2DCBA 2E01A 8PCHA 3MTVA 1U9WA 3ZUAA 1YALA 2FE8A 1U9VA 3PRMA 1MS6A 2R9FA 3TNXA 4W5CA 2OP3A 1DKIA 3H8BA 3B79A 3KFQA 1PVJA 5EF4A 2R9OA 5CVNB 4CDFB 1QDQA 4YYWA 1AYVA 4Q8GA 1Q6KA 2GFOA 3GCBA 1NLJA 2FRQA 3RVWA 2XU1A 4REZA 1DF0A 3P5VA 4CDCB 2B1MA 1PE6A 5CVMA 1FH0A 2O6XA 3MHSA 4IP3A 1BP4A 1NB5A 4RF1A 1QXPA 1PBHA 3OF8A 3HD3A 3F75A 1MDWA 2NQIA 1F29A 3O1GA 3PDFA 5FPWA 4PI3A 3IUTA 1A6RA 4BSQA 2ACTA 4OVZA 4BOQA 3IMAA 1M6DA 2OULA 3RVXA 3LFYA 1ME3A 1X9YA 3I3TA 6PADA 1KXRA 2J7QA 3HHAA 1ATKA 3CH3X 2BDZA 3F5VA 4DMYA 1DEUA 2YJ9A 3BBAA 1GLOA 2DOSA 4YYUA 2P0RA 2XU4A 2R9CA 4QRXA 4WA6A 3BPFA 3PHWA 4PT5A 1AYWA 1NL6A 5F02A 2AIMA 2AGAA 3BCNA 4IUMA 3O65A 4MZOA 3IV2A 2FO5A 1ZCMA 3KSEA 3E9SA 2BTWB 2VHSA 3ZNHA 3ERVA 4D8IA 5J94A 3IEJA 3QSDA 5CHTA 2FRAA 1GMYA 1PPOA 4N8WA 2H7JA 2DCDA 5EGWA 3PSEA 4HXDB 4BS5A 3OQCA 5JA7A 4W5BA 2JQFR 2G7YA 1CJLA 3TMPA 3PRPA 4QH6A 1AECA
chains in the Genus database with same CATH topology
4FK5A 3OVZA 2ARYA 3P5WA 4I05A 4X6HA 4PP2E 2NQDB 3P5XA 1VJVA 2BDLA 1K3BB 3WXEA 5PADA 4QRVA 3O0UA 1NB3A 4BGFA 1HUCB 4AXMA 1NQCA 4X6IA 2YJCA 3PBHA 3E1ZB 2HXZA 1MEMA 1MIRA 1PXVA 1YK7A 4YYQA 1Y4HA 4BPVA 3S3QA 3V6EA 2FQ9A 3BWKA 2XU5A 3K9MA 1F2CA 3CBJA 4P6EA 1U5IA 3M99A 1CV8A 4YYSA 3H89A 3I06A 4W4UA 1POPA 3KWBX 2R9MA 2DJGB 2FT2A 2JQGR 3BC3A 2IBIA 3U8EA 2NQAA 2DC6A 3KX1A 2PREA 5K16A 3P5UA 4BS6A 7PCKA 3DF0A 1SNKA 1YT7A 3IOQA 1QMYA 5CVOB 2G8JA 3N4CA 3MTNA 2XU3A 1THEA 2R9NA 2YJBA 2DCAA 3CH2X 4PADA 3OF9A 2ATOA 1W4TA 3S3RA 3N3GA 1CVZA 4MSXA 2E00A 1KHQA 3D6SA 2DC8A 4P6GA 2G8EA 1W6FA 4Q8HA 4CZWA 2AS8A 4N79A 1U9XA 2YJ8A 1BQIA 2DC7A 2BSZA 1VSNA 4I07A 2PBHA 2DZZA 4KLBA 2AYOA 1U9QX 2E02A 1JQPA 1W5RA 3MHHA 1TLOA 1KFXL 4K7CA 3K24A 3H7DA 3OVXA 3BOWA 1PADA 2YJ2A 3USVA 4DMXA 4OELA 3OISA 4MZSA 1MEGA 2FTDA 4GUZA 4QBBA 1EWMA 3WXGA 1AU4A 1CPJA 1AU2A 2HD5A 2AUZA 2HH5A 2B1NA 2IPPB 3K8UA 4QRGA 4RY2A 2AYNA 2FYEA 1CS8A 3KKUA 2HHNA 2P7UA 2OZ2A 1GECE 4HWYA 1IWDA 2GHUA 3HHIA 1MHWA 4NV7A 1TU6A 3V6CA 3C9EA 2DZYA 1STFE 4AXLA 4CDDB 3KW9A 2VHFA 2CIOA 1KFUL 1CSBB 1NPZA 2AU1A 1KHPA 2CB5A 2P86A 1AYUA 1S4VA 1CQDA 1PPDA 1EWOA 2Y5BA 3RVVA 3IHPA 4G54A 1F2AA 4YV8A 1ICFA 3PNRA 4CDEB 3MORA 9PAPA 5CHVA 2DCCA 3LTWA 4YYRA 1PPNA 2Y6EA 3QJ3A 4YYVA 4XUIA 1YK8A 2NQGA 3KWZA 3N3KA 1CB5A 1BGOA 5JH3A 1TL9A 1EF7A 1PPPA 2VFBA 4N4ZA 2PNSA 2F1GA 1ZIVA 1XKGA 2VFCA 2R6NA 4OEMA 1AIMA 4X6JA 3H8CA 1Y08A 1E2TA 1QOLA 3LXSA 1EWLA 4YVAA 2AVWA 2DC9A 4ZUXU 4XR7A 3BPMA 2E03A 1CTEA 3NHEA 2F7DA 3WXFA 3AI8A 2G6DA 1PCIA 1BY8A 1EWPA 4I04A 5A24A 2PADA 1ME4A 4PP1A 1F2BA 1YVBA 3H6SA 3QT4A 3PW3A 1O0EA 2C0YA 2DJFB 2FUDA 1SP4B 1GCBA 2WBFX 4BQVA 4FIPA 3HWNA 4FJCA 1ITOA 1PIPA 3CBKA 2AUXA 1AU0A 1AU3A 2DCBA 2E01A 8PCHA 1U9WA 3ZUAA 1YALA 1U9VA 1MS6A 2R9FA 3TNXA 4W5CA 2OP3A 3H8BA 3B79A 3KFQA 5EF4A 2R9OA 5CVNB 4CDFB 1QDQA 4YYWA 1AYVA 4Q8GA 1Q6KA 2GFOA 3GCBA 1NLJA 2FRQA 3RVWA 2XU1A 1DF0A 3P5VA 4CDCB 2B1MA 1PE6A 5CVMA 1FH0A 2O6XA 3MHSA 1BP4A 1NB5A 1QXPA 1PBHA 3OF8A 3HD3A 3F75A 1MDWA 2NQIA 1F29A 3O1GA 3PDFA 5FPWA 3D9WA 4PI3A 3IUTA 1A6RA 4BSQA 2ACTA 3IMAA 1M6DA 2OULA 3RVXA 3LFYA 1ME3A 1X9YA 3I3TA 6PADA 1KXRA 3HHAA 1ATKA 3CH3X 4NV8A 2BDZA 3F5VA 4DMYA 1DEUA 2YJ9A 1GLOA 4YYUA 2P0RA 2XU4A 2R9CA 4QRXA 4WA6A 4C5PA 3BPFA 4B55A 1AYWA 1NL6A 5F02A 2AIMA 3BCNA 4MZOA 3IV2A 2FO5A 1ZCMA 3KSEA 2VHSA 3ERVA 5J94A 3IEJA 3QSDA 5CHTA 2FRAA 1GMYA 1PPOA 4N8WA 2H7JA 2DCDA 5EGWA 1GX3A 4BS5A 5JA7A 4W5BA 2JQFR 2G7YA 1CJLA 4QH6A 1AECA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FK5 A;  3OVZ A;  2ARY A;  3P5W A;  4I05 A;  4PP2 E;  4X6H A;  2NQD B;  3P5X A;  1VJV A;  2BDL A;  1K3B B;  3WXE A;  5PAD A;  4QRV A;  3O0U A;  1NB3 A;  1HUC B;  4AXM A;  1NQC A;  4X6I A;  2YJC A;  3PBH A;  3E1Z B;  2HXZ A;  1MEM A;  1MIR A;  1PXV A;  1YK7 A;  4YYQ A;  1Y4H A;  4BPV A;  3S3Q A;  3V6E A;  2FQ9 A;  3BWK A;  2XU5 A;  3K9M A;  1F2C A;  3CBJ A;  4P6E A;  1U5I A;  3M99 A;  1CV8 A;  4YYS A;  3H89 A;  3I06 A;  4W4U A;  1POP A;  3KWB X;  2R9M A;  2DJG B;  2FT2 A;  2JQG R;  3BC3 A;  2IBI A;  3U8E A;  2NQA A;  2DC6 A;  3KX1 A;  2PRE A;  5K16 A;  3P5U A;  4BS6 A;  7PCK A;  3DF0 A;  1SNK A;  1YT7 A;  3IOQ A;  1QMY A;  5CVO B;  2G8J A;  3N4C A;  3MTN A;  2XU3 A;  1THE A;  2R9N A;  2YJB A;  2DCA A;  3CH2 X;  4PAD A;  3OF9 A;  2ATO A;  3S3R A;  3N3G A;  1CVZ A;  4MSX A;  2E00 A;  1KHQ A;  3D6S A;  2DC8 A;  4P6G A;  2G8E A;  4Q8H A;  4CZW A;  2AS8 A;  4N79 A;  1U9X A;  2YJ8 A;  1BQI A;  2DC7 A;  1VSN A;  4I07 A;  2PBH A;  2DZZ A;  4KLB A;  2AYO A;  1U9Q X;  2E02 A;  1JQP A;  3MHH A;  1TLO A;  1KFX L;  4K7C A;  3K24 A;  3H7D A;  3OVX A;  3BOW A;  1PAD A;  2YJ2 A;  3USV A;  4DMX A;  4OEL A;  3OIS A;  4MZS A;  1MEG A;  2FTD A;  4QBB A;  1EWM A;  3WXG A;  1AU4 A;  1CPJ A;  1AU2 A;  2HD5 A;  2AUZ A;  2HH5 A;  2B1N A;  2IPP B;  3K8U A;  4QRG A;  4RY2 A;  2AYN A;  2FYE A;  1CS8 A;  3KKU A;  2HHN A;  2P7U A;  2OZ2 A;  1GEC E;  4HWY A;  1IWD A;  2GHU A;  3HHI A;  1MHW A;  1TU6 A;  3V6C A;  3C9E A;  2DZY A;  1STF E;  4AXL A;  4CDD B;  3KW9 A;  2VHF A;  2CIO A;  1KFU L;  1CSB B;  1NPZ A;  2AU1 A;  1KHP A;  2CB5 A;  2P86 A;  1AYU A;  1S4V A;  1CQD A;  1PPD A;  1EWO A;  2Y5B A;  3RVV A;  3IHP A;  4G54 A;  1F2A A;  4YV8 A;  1ICF A;  3PNR A;  4CDE B;  3MOR A;  9PAP A;  5CHV A;  2DCC A;  4YYR A;  1PPN A;  2Y6E A;  3QJ3 A;  4YYV A;  1YK8 A;  2NQG A;  4XUI A;  3KWZ A;  3N3K A;  1CB5 A;  1BGO A;  5JH3 A;  1TL9 A;  1EF7 A;  1PPP A;  4N4Z A;  2PNS A;  2F1G A;  1ZIV A;  1XKG A;  2R6N A;  4OEM A;  1AIM A;  4X6J A;  3H8C A;  1Y08 A;  1QOL A;  3LXS A;  1EWL A;  4YVA A;  2AVW A;  2DC9 A;  4ZUX U;  4XR7 A;  3BPM A;  2E03 A;  1CTE A;  3NHE A;  2F7D A;  3WXF A;  3AI8 A;  2G6D A;  1PCI A;  1BY8 A;  1EWP A;  4I04 A;  5A24 A;  2PAD A;  1ME4 A;  4PP1 A;  1F2B A;  1YVB A;  3H6S A;  3QT4 A;  3PW3 A;  1O0E A;  2C0Y A;  2DJF B;  2FUD A;  1SP4 B;  1GCB A;  2WBF X;  4BQV A;  4FIP A;  3HWN A;  4FJC A;  1ITO A;  1PIP A;  3CBK A;  2AUX A;  1AU0 A;  1AU3 A;  2DCB A;  2E01 A;  8PCH A;  1U9W A;  3ZUA A;  1YAL A;  1U9V A;  1MS6 A;  2R9F A;  3TNX A;  4W5C A;  2OP3 A;  3H8B A;  3B79 A;  3KFQ A;  5EF4 A;  2R9O A;  5CVN B;  4CDF B;  1QDQ A;  4YYW A;  1AYV A;  4Q8G A;  1Q6K A;  2GFO A;  3GCB A;  1NLJ A;  2FRQ A;  3RVW A;  2XU1 A;  1DF0 A;  3P5V A;  4CDC B;  2B1M A;  1PE6 A;  5CVM A;  1FH0 A;  2O6X A;  3MHS A;  1BP4 A;  1NB5 A;  1QXP A;  1PBH A;  3OF8 A;  3HD3 A;  3F75 A;  1MDW A;  2NQI A;  1F29 A;  3O1G A;  3PDF A;  5FPW A;  4PI3 A;  3IUT A;  1A6R A;  4BSQ A;  2ACT A;  3IMA A;  1M6D A;  2OUL A;  3RVX A;  3LFY A;  1ME3 A;  1X9Y A;  3I3T A;  6PAD A;  1KXR A;  3HHA A;  1ATK A;  3CH3 X;  2BDZ A;  3F5V A;  4DMY A;  1DEU A;  2YJ9 A;  1GLO A;  4YYU A;  2P0R A;  2XU4 A;  2R9C A;  4QRX A;  4WA6 A;  3BPF A;  1AYW A;  1NL6 A;  5F02 A;  2AIM A;  3BCN A;  4MZO A;  3IV2 A;  2FO5 A;  1ZCM A;  3KSE A;  2VHS A;  3ERV A;  5J94 A;  3IEJ A;  3QSD A;  5CHT A;  2FRA A;  1GMY A;  1PPO A;  4N8W A;  2H7J A;  2DCD A;  5EGW A;  4BS5 A;  5JA7 A;  4W5B A;  2JQF R;  2G7Y A;  1CJL A;  4QH6 A;  1AEC A; 
#chains in the Genus database with same CATH topology
 4FK5 A;  3OVZ A;  2ARY A;  3P5W A;  4I05 A;  3IFU A;  4PP2 E;  4X6H A;  2NQD B;  3MP2 A;  3P5X A;  1VJV A;  2BDL A;  1K3B B;  3WXE A;  5PAD A;  4QRV A;  3O0U A;  1NB3 A;  1HUC B;  4AXM A;  4XZX A;  1NQC A;  4X6I A;  2YJC A;  5E6J A;  3PBH A;  3E1Z B;  4GUA A;  2HXZ A;  2J7Q C;  1MEM A;  1MIR A;  1PXV A;  1YK7 A;  4YYQ A;  1Y4H A;  4BPV A;  3S3Q A;  3V6E A;  2FQ9 A;  3BWK A;  2XU5 A;  3K9M A;  1F2C A;  3CBJ A;  4P6E A;  1U5I A;  3M99 A;  1CV8 A;  4YYS A;  3H89 A;  3I06 A;  4W4U A;  1POP A;  3KWB X;  4RKX A;  2R9M A;  2DJG B;  2FT2 A;  2JQG R;  3BC3 A;  2IBI A;  1YZB A;  4BOU A;  3U8E A;  2NQA A;  2DC6 A;  2UZJ A;  3BB7 A;  3KX1 A;  2PRE A;  5K16 A;  3P5U A;  4BS6 A;  7PCK A;  3DF0 A;  1SNK A;  1YT7 A;  3IOQ A;  1QMY A;  4WUR A;  5CVO B;  3W30 A;  2G8J A;  3N4C A;  3MTN A;  3PHX A;  2XU3 A;  1THE A;  2R9N A;  3TRK A;  2YJB A;  2DCA A;  3CH2 X;  4PAD A;  3OF9 A;  4P16 A;  2ATO A;  3S3R A;  3N3G A;  1CVZ A;  4MSX A;  2E00 A;  2Z84 A;  1KHQ A;  3D6S A;  2DC8 A;  2G8E A;  4P6G A;  4Q8H A;  4CZW A;  2AS8 A;  4N79 A;  1U9X A;  2YJ8 A;  1BQI A;  4BOZ A;  2DC7 A;  4BOP A;  1VSN A;  4I07 A;  2PBH A;  2DZZ A;  4MM3 B;  4KLB A;  2AYO A;  1U9Q X;  2E02 A;  1JQP A;  3MHH A;  1TLO A;  5JZE A;  1KFX L;  4K7C A;  3K24 A;  3H7D A;  3OVX A;  3BOW A;  4RNA A;  1PAD A;  2YJ2 A;  3USV A;  4DMX A;  4OEL A;  5KO3 A;  3OIS A;  4MI7 A;  4MZS A;  1MEG A;  2FTD A;  4QBB A;  3B21 A;  1EWM A;  3WXG A;  1AU4 A;  4OW0 A;  1CPJ A;  1AU2 A;  2HD5 A;  2AUZ A;  2HH5 A;  2B1N A;  2IPP B;  3K8U A;  4QRG A;  4RY2 A;  2AYN A;  2FYE A;  1CS8 A;  3RNV A;  3KKU A;  4M0W A;  2HHN A;  2P7U A;  2OZ2 A;  1GEC E;  4OVZ B;  4HWY A;  1IWD A;  2GHU A;  3HHI A;  1MHW A;  4ZTB A;  1TU6 A;  3V6C A;  3C9E A;  2DZY A;  1UKF A;  1STF E;  4AXL A;  4CDD B;  3KW9 A;  2VHF A;  2CIO A;  4BOS A;  1KFU L;  1CSB B;  1NPZ A;  2JTC A;  2AU1 A;  4R3D A;  2BU3 A;  5EZQ A;  1KHP A;  2CB5 A;  2P86 A;  1AYU A;  1S4V A;  1CQD A;  1PPD A;  1EWO A;  2Y5B A;  3RVV A;  3IHP A;  4G54 A;  1F2A A;  4YV8 A;  1ICF A;  3PNR A;  4CDE B;  3MOR A;  9PAP A;  3PT2 A;  5CHV A;  5EZS A;  2DCC A;  4YYR A;  1PPN A;  2Y6E A;  3QJ3 A;  4YYV A;  4D8B A;  1YK8 A;  2NQG A;  4XUI A;  3KWZ A;  3N3K A;  1CB5 A;  1BGO A;  5JH3 A;  2HWK A;  3W31 A;  1TL9 A;  1EF7 A;  1PPP A;  4N4Z A;  2PNS A;  2F1G A;  1ZIV A;  1XKG A;  4A5U A;  2R6N A;  4OEM A;  1AIM A;  4X6J A;  3H8C A;  3PHU A;  1Y08 A;  1QOL A;  3LXS A;  1EWL A;  4YVA A;  2AVW A;  2DC9 A;  4ZUX U;  4XR7 A;  3BPM A;  2E03 A;  1CTE A;  3NHE A;  2F7D A;  3BY4 A;  3WXF A;  3AI8 A;  2G6D A;  1PCI A;  1BY8 A;  1EWP A;  4I04 A;  5A24 A;  2PAD A;  1ME4 A;  4PP1 A;  1F2B A;  1YVB A;  3H6S A;  3QT4 A;  4RF0 A;  3MJ5 A;  3PW3 A;  1O0E A;  2C0Y A;  2DJF B;  2FUD A;  1SP4 B;  4D8E A;  1GCB A;  2WBF X;  4BQV A;  3C0R A;  2BTW A;  4FIP A;  2JRI A;  3HWN A;  4FJC A;  1ITO A;  1PIP A;  3CBK A;  2AUX A;  1AU0 A;  1AU3 A;  2DCB A;  2E01 A;  8PCH A;  3MTV A;  1U9W A;  3ZUA A;  1YAL A;  2FE8 A;  1U9V A;  3PRM A;  1MS6 A;  2R9F A;  3TNX A;  4W5C A;  2OP3 A;  1DKI A;  3H8B A;  3B79 A;  3KFQ A;  1PVJ A;  5EF4 A;  2R9O A;  5CVN B;  4CDF B;  1QDQ A;  4YYW A;  1AYV A;  4Q8G A;  1Q6K A;  2GFO A;  3GCB A;  1NLJ A;  2FRQ A;  3RVW A;  2XU1 A;  4REZ A;  1DF0 A;  3P5V A;  4CDC B;  2B1M A;  1PE6 A;  5CVM A;  1FH0 A;  2O6X A;  3MHS A;  4IP3 A;  1BP4 A;  1NB5 A;  4RF1 A;  1QXP A;  1PBH A;  3OF8 A;  3HD3 A;  3F75 A;  1MDW A;  2NQI A;  1F29 A;  3O1G A;  3PDF A;  5FPW A;  4PI3 A;  3IUT A;  1A6R A;  4BSQ A;  2ACT A;  4OVZ A;  4BOQ A;  3IMA A;  1M6D A;  2OUL A;  3RVX A;  3LFY A;  1ME3 A;  1X9Y A;  3I3T A;  6PAD A;  1KXR A;  2J7Q A;  3HHA A;  1ATK A;  3CH3 X;  2BDZ A;  3F5V A;  4DMY A;  1DEU A;  2YJ9 A;  3BBA A;  1GLO A;  2DOS A;  4YYU A;  2P0R A;  2XU4 A;  2R9C A;  4QRX A;  4WA6 A;  3BPF A;  3PHW A;  4PT5 A;  1AYW A;  1NL6 A;  5F02 A;  2AIM A;  2AGA A;  3BCN A;  4IUM A;  3O65 A;  4MZO A;  3IV2 A;  2FO5 A;  1ZCM A;  3KSE A;  3E9S A;  2BTW B;  2VHS A;  3ZNH A;  3ERV A;  4D8I A;  5J94 A;  3IEJ A;  3QSD A;  5CHT A;  2FRA A;  1GMY A;  1PPO A;  4N8W A;  2H7J A;  2DCD A;  5EGW A;  3PSE A;  4HXD B;  4BS5 A;  3OQC A;  5JA7 A;  4W5B A;  2JQF R;  2G7Y A;  1CJL A;  3TMP A;  3PRP A;  4QH6 A;  1AEC A; 
#chains in the Genus database with same CATH homology
 4FK5 A;  3OVZ A;  2ARY A;  3P5W A;  4I05 A;  4X6H A;  4PP2 E;  2NQD B;  3P5X A;  1VJV A;  2BDL A;  1K3B B;  3WXE A;  5PAD A;  4QRV A;  3O0U A;  1NB3 A;  4BGF A;  1HUC B;  4AXM A;  1NQC A;  4X6I A;  2YJC A;  3PBH A;  3E1Z B;  2HXZ A;  1MEM A;  1MIR A;  1PXV A;  1YK7 A;  4YYQ A;  1Y4H A;  4BPV A;  3S3Q A;  3V6E A;  2FQ9 A;  3BWK A;  2XU5 A;  3K9M A;  1F2C A;  3CBJ A;  4P6E A;  1U5I A;  3M99 A;  1CV8 A;  4YYS A;  3H89 A;  3I06 A;  4W4U A;  1POP A;  3KWB X;  2R9M A;  2DJG B;  2FT2 A;  2JQG R;  3BC3 A;  2IBI A;  3U8E A;  2NQA A;  2DC6 A;  3KX1 A;  2PRE A;  5K16 A;  3P5U A;  4BS6 A;  7PCK A;  3DF0 A;  1SNK A;  1YT7 A;  3IOQ A;  1QMY A;  5CVO B;  2G8J A;  3N4C A;  3MTN A;  2XU3 A;  1THE A;  2R9N A;  2YJB A;  2DCA A;  3CH2 X;  4PAD A;  3OF9 A;  2ATO A;  1W4T A;  3S3R A;  3N3G A;  1CVZ A;  4MSX A;  2E00 A;  1KHQ A;  3D6S A;  2DC8 A;  4P6G A;  2G8E A;  1W6F A;  4Q8H A;  4CZW A;  2AS8 A;  4N79 A;  1U9X A;  2YJ8 A;  1BQI A;  2DC7 A;  2BSZ A;  1VSN A;  4I07 A;  2PBH A;  2DZZ A;  4KLB A;  2AYO A;  1U9Q X;  2E02 A;  1JQP A;  1W5R A;  3MHH A;  1TLO A;  1KFX L;  4K7C A;  3K24 A;  3H7D A;  3OVX A;  3BOW A;  1PAD A;  2YJ2 A;  3USV A;  4DMX A;  4OEL A;  3OIS A;  4MZS A;  1MEG A;  2FTD A;  4GUZ A;  4QBB A;  1EWM A;  3WXG A;  1AU4 A;  1CPJ A;  1AU2 A;  2HD5 A;  2AUZ A;  2HH5 A;  2B1N A;  2IPP B;  3K8U A;  4QRG A;  4RY2 A;  2AYN A;  2FYE A;  1CS8 A;  3KKU A;  2HHN A;  2P7U A;  2OZ2 A;  1GEC E;  4HWY A;  1IWD A;  2GHU A;  3HHI A;  1MHW A;  4NV7 A;  1TU6 A;  3V6C A;  3C9E A;  2DZY A;  1STF E;  4AXL A;  4CDD B;  3KW9 A;  2VHF A;  2CIO A;  1KFU L;  1CSB B;  1NPZ A;  2AU1 A;  1KHP A;  2CB5 A;  2P86 A;  1AYU A;  1S4V A;  1CQD A;  1PPD A;  1EWO A;  2Y5B A;  3RVV A;  3IHP A;  4G54 A;  1F2A A;  4YV8 A;  1ICF A;  3PNR A;  4CDE B;  3MOR A;  9PAP A;  5CHV A;  2DCC A;  3LTW A;  4YYR A;  1PPN A;  2Y6E A;  3QJ3 A;  4YYV A;  4XUI A;  1YK8 A;  2NQG A;  3KWZ A;  3N3K A;  1CB5 A;  1BGO A;  5JH3 A;  1TL9 A;  1EF7 A;  1PPP A;  2VFB A;  4N4Z A;  2PNS A;  2F1G A;  1ZIV A;  1XKG A;  2VFC A;  2R6N A;  4OEM A;  1AIM A;  4X6J A;  3H8C A;  1Y08 A;  1E2T A;  1QOL A;  3LXS A;  1EWL A;  4YVA A;  2AVW A;  2DC9 A;  4ZUX U;  4XR7 A;  3BPM A;  2E03 A;  1CTE A;  3NHE A;  2F7D A;  3WXF A;  3AI8 A;  2G6D A;  1PCI A;  1BY8 A;  1EWP A;  4I04 A;  5A24 A;  2PAD A;  1ME4 A;  4PP1 A;  1F2B A;  1YVB A;  3H6S A;  3QT4 A;  3PW3 A;  1O0E A;  2C0Y A;  2DJF B;  2FUD A;  1SP4 B;  1GCB A;  2WBF X;  4BQV A;  4FIP A;  3HWN A;  4FJC A;  1ITO A;  1PIP A;  3CBK A;  2AUX A;  1AU0 A;  1AU3 A;  2DCB A;  2E01 A;  8PCH A;  1U9W A;  3ZUA A;  1YAL A;  1U9V A;  1MS6 A;  2R9F A;  3TNX A;  4W5C A;  2OP3 A;  3H8B A;  3B79 A;  3KFQ A;  5EF4 A;  2R9O A;  5CVN B;  4CDF B;  1QDQ A;  4YYW A;  1AYV A;  4Q8G A;  1Q6K A;  2GFO A;  3GCB A;  1NLJ A;  2FRQ A;  3RVW A;  2XU1 A;  1DF0 A;  3P5V A;  4CDC B;  2B1M A;  1PE6 A;  5CVM A;  1FH0 A;  2O6X A;  3MHS A;  1BP4 A;  1NB5 A;  1QXP A;  1PBH A;  3OF8 A;  3HD3 A;  3F75 A;  1MDW A;  2NQI A;  1F29 A;  3O1G A;  3PDF A;  5FPW A;  3D9W A;  4PI3 A;  3IUT A;  1A6R A;  4BSQ A;  2ACT A;  3IMA A;  1M6D A;  2OUL A;  3RVX A;  3LFY A;  1ME3 A;  1X9Y A;  3I3T A;  6PAD A;  1KXR A;  3HHA A;  1ATK A;  3CH3 X;  4NV8 A;  2BDZ A;  3F5V A;  4DMY A;  1DEU A;  2YJ9 A;  1GLO A;  4YYU A;  2P0R A;  2XU4 A;  2R9C A;  4QRX A;  4WA6 A;  4C5P A;  3BPF A;  4B55 A;  1AYW A;  1NL6 A;  5F02 A;  2AIM A;  3BCN A;  4MZO A;  3IV2 A;  2FO5 A;  1ZCM A;  3KSE A;  2VHS A;  3ERV A;  5J94 A;  3IEJ A;  3QSD A;  5CHT A;  2FRA A;  1GMY A;  1PPO A;  4N8W A;  2H7J A;  2DCD A;  5EGW A;  1GX3 A;  4BS5 A;  5JA7 A;  4W5B A;  2JQF R;  2G7Y A;  1CJL A;  4QH6 A;  1AEC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...