1AU4A

Crystal structure of the cysteine protease human cathepsin k in complex with a covalent pyrrolidinone inhibitor
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATHEPSIN K
publication title Conformationally constrained 1,3-diamino ketones: a series of potent inhibitors of the cysteine protease cathepsin K.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 56
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 1997-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1au4A00
1KHQA 2AYNA 3BCNA 4FIPA 2DZZA 1ITOA 1NB3A 4Q8GA 3K24A 5CHVA 3E1ZB 3K9MA 3IMAA 4QBBA 5J94A 5CVMA 1QMYA 4AXLA 1U9WA 4FK5A 3P5VA 3N3KA 4QRGA 2DC8A 4W4UA 4YYWA 2DC6A 1CSBB 3HHAA 3IUTA 1QOLA 3QT4A 1HUCB 1PPPA 3K8UA 1VSNA 2FUDA 3IV2A 3BPFA 1U9VA 5EF4A 4BS5A 3RVVA 1A6RA 2XU3A 1MHWA 4AXMA 1AIMA 4KLBA 2JQGR 1PCIA 4YYUA 2E00A 2G8JA 2P0RA 1CVZA 2IPPB 3KWBX 1TLOA 4W5CA 1ME3A 3MHSA 4BS6A 4PADA 4YVAA 2XU4A 4QRVA 3MORA 6PADA 1POPA 2Y5BA 3V6EA 1BY8A 3CH2X 2E03A 2P7UA 4BQVA 2CB5A 3H7DA 4CDEB 1AU3A 4N4ZA 2P86A 1KFUL 1DF0A 1AYVA 3D6SA 1AECA 2YJ9A 4OELA 4Q8HA 8PCHA 5JA7A 3IEJA 2DC9A 3GCBA 2AVWA 2B1NA 4CDCB 3S3QA 4X6HA 1PPDA 3KKUA 1EWMA 4YV8A 2DCBA 1TL9A 1F2BA 4CZWA 2O6XA 1YALA 3QJ3A 3NHEA 2OZ2A 1KHPA 4WA6A 1CPJA 2G6DA 2VHFA 2G8EA 4OEMA 5A24A 1F2CA 2E02A 2FO5A 4HWYA 1GECE 1PE6A 1BQIA 2ARYA 2FRAA 1XKGA 4DMXA 4G54A 3H6SA 2AUXA 3C9EA 2ACTA 3WXGA 3OF8A 4RY2A 3ZUAA 2HXZA 1X9YA 1U5IA 1KXRA 3S3RA 1PIPA 5EGWA 3BOWA 4X6JA 1GLOA 3KWZA 3WXEA 1NQCA 4YYRA 4XR7A 2HD5A 9PAPA 3LXSA 3HD3A 2WBFX 2CIOA 1PXVA 1VJVA 3BC3A 2NQGA 2FRQA 3BWKA 1GMYA 2R9FA 3IOQA 1O0EA 3PW3A 3P5UA 2JQFR 3DF0A 2FTDA 1QXPA 1S4VA 3ERVA 3MTNA 1CQDA 2R6NA 2NQIA 2BDZA 2FT2A 3H89A 1IWDA 2E01A 2G7YA 4ZUXU 4N8WA 4P6GA 1CTEA 1PPNA 4W5BA 3KSEA 3CBKA 1SNKA 2YJ2A 4K7CA 2F1GA 3B79A 2Y6EA 1ATKA 3M99A 3OF9A 3KX1A 4BSQA 1NB5A 3CH3X 2AU1A 3RVXA 1ZIVA 5JH3A 2F7DA 4N79A 1JQPA 5CVNB 1M6DA 4YYQA 1BP4A 1CJLA 2R9CA 4PP1A 3H8BA 1ME4A 2AIMA 1THEA 2DCDA 1Y08A 2YJCA 1CS8A 1MEMA 2PBHA 4CDDB 4YYVA 4CDFB 2FQ9A 1F29A 3RVWA 1K3BB 3LFYA 1EWLA 1TU6A 2FYEA 2HHNA 4P6EA 3TNXA 3HWNA 1U9QX 4QRXA 3P5WA 2DZYA 1Q6KA 1MIRA 2B1MA 1Y4HA 1ICFA 1NPZA 3N4CA 1YK8A 2XU5A 1PADA 1PPOA 1AU4A 5CVOB 1NL6A 1PBHA 5PADA 3OVXA 2PNSA 1NLJA 3BPMA 3PBHA 1KFXL 1AU2A 4DMYA 2VHSA 3KW9A 4X6IA 1QDQA 1EF7A 1SP4B 4PI3A 3OVZA 2AS8A 5F02A 7PCKA 4I04A 3PDFA 2PADA 1GCBA 1EWPA 2OULA 1YT7A 1STFE 2DJFB 2GHUA 2DCAA 2AYOA 2H7JA 4QH6A 3CBJA 4MSXA 1U9XA 3WXFA 2R9MA 1ZCMA 3P5XA 5CHTA 1MEGA 4I07A 1F2AA 4YYSA 2NQDB 1MS6A 4XUIA 1CV8A 1BGOA 2PREA 4PP2E 1YK7A 2HH5A 2NQAA 3IHPA 3U8EA 3MHHA 4MZOA 3QSDA 2DC7A 2AUZA 4MZSA 2YJ8A 2C0YA 3OISA 5FPWA 4I05A 2GFOA 3I3TA 1YVBA 2YJBA 1MDWA 2DJGB 2OP3A 2R9OA 1EWOA 2DCCA 3O0UA 3PNRA 3KFQA 3F75A 1DEUA 3USVA 1AYUA 1FH0A 3F5VA 3O1GA 3I06A 5K16A 3AI8A 3N3GA 4FJCA 2ATOA 3H8CA 2XU1A 3V6CA 1CB5A 2IBIA 1AYWA 1AU0A 2R9NA 3HHIA 4BPVA 2BDLA
chains in the Genus database with same CATH superfamily
1KHQA 2AYNA 3BCNA 4FIPA 2DZZA 1ITOA 1NB3A 4BOPA 4Q8GA 3K24A 5CHVA 3E1ZB 3K9MA 3IMAA 4QBBA 5J94A 4HXDB 5CVMA 1QMYA 2HWKA 4AXLA 4BOQA 1U9WA 4FK5A 3P5VA 3N3KA 4QRGA 2DC8A 4W4UA 2BTWB 4YYWA 4OVZB 2DC6A 2Z84A 3E9SA 5E6JA 1CSBB 3HHAA 3IUTA 1QOLA 3QT4A 1HUCB 1PPPA 3K8UA 1VSNA 4BOSA 2FUDA 3IV2A 3BPFA 1U9VA 5EF4A 4BS5A 3RVVA 4D8EA 1A6RA 4PT5A 2XU3A 1MHWA 4AXMA 1AIMA 4KLBA 2JQGR 1PCIA 4YYUA 2E00A 2G8JA 2P0RA 1CVZA 2IPPB 3KWBX 3BB7A 1TLOA 3IFUA 4W5CA 1ME3A 3MHSA 4RF0A 4BS6A 2JTCA 4PADA 1YZBA 4YVAA 2XU4A 4QRVA 3MORA 6PADA 1POPA 2Y5BA 3O65A 3V6EA 1BY8A 3CH2X 2E03A 2P7UA 4BQVA 2CB5A 3H7DA 2J7QC 4CDEB 1AU3A 4N4ZA 2P86A 1KFUL 1DF0A 1AYVA 3D6SA 1AECA 2YJ9A 4OELA 4REZA 4Q8HA 8PCHA 5JA7A 3IEJA 2DC9A 3GCBA 3PT2A 5EZQA 2AVWA 2B1NA 4BOUA 4CDCB 3S3QA 4X6HA 1PPDA 3KKUA 1EWMA 4YV8A 2DCBA 1TL9A 1F2BA 4CZWA 2O6XA 1YALA 3QJ3A 3NHEA 2OZ2A 1KHPA 4WA6A 2BTWA 4OVZA 1CPJA 2G6DA 2VHFA 2G8EA 4OEMA 5A24A 1F2CA 2E02A 2FO5A 4HWYA 1GECE 1PE6A 1BQIA 3B21A 2ARYA 2FRAA 3MTVA 1XKGA 4DMXA 4G54A 4GUAA 3H6SA 2AUXA 3C9EA 2ACTA 3WXGA 3OF8A 3PRPA 4RY2A 3ZUAA 2HXZA 1X9YA 1U5IA 4P16A 1KXRA 3S3RA 1PIPA 2JRIA 5EGWA 3BOWA 4X6JA 1GLOA 3KWZA 3WXEA 3TRKA 2FE8A 1NQCA 4YYRA 4XR7A 2HD5A 9PAPA 3LXSA 3HD3A 2WBFX 2CIOA 4RF1A 1PXVA 1VJVA 3BC3A 2NQGA 4MI7A 2FRQA 3BWKA 1GMYA 4IUMA 2R9FA 3C0RA 3IOQA 1O0EA 3PW3A 2UZJA 3P5UA 2JQFR 3DF0A 2FTDA 1QXPA 1S4VA 4R3DA 3ERVA 3MTNA 1CQDA 2R6NA 2NQIA 2BDZA 2FT2A 3H89A 1IWDA 2E01A 2G7YA 4ZUXU 3MP2A 4N8WA 2J7QA 4WURA 4MM3B 3PHWA 2DOSA 3MJ5A 4P6GA 1CTEA 1PPNA 4W5BA 3KSEA 3CBKA 1SNKA 2YJ2A 4K7CA 2F1GA 5JZEA 3B79A 2Y6EA 1ATKA 3M99A 3OF9A 4D8BA 3KX1A 4BSQA 1NB5A 3CH3X 2AU1A 4OW0A 3RVXA 1ZIVA 5JH3A 3RNVA 3PHUA 2F7DA 4N79A 1JQPA 5CVNB 1M6DA 4YYQA 1BP4A 1CJLA 4RKXA 2R9CA 4PP1A 3H8BA 1ME4A 2AIMA 1THEA 2DCDA 1Y08A 2YJCA 1CS8A 1MEMA 2PBHA 4CDDB 4XZXA 4YYVA 4CDFB 2FQ9A 4A5UA 1F29A 3RVWA 3PHXA 1K3BB 3LFYA 1EWLA 1TU6A 2FYEA 4D8IA 2HHNA 4P6EA 3TNXA 3HWNA 1U9QX 4QRXA 3P5WA 2DZYA 1Q6KA 1MIRA 2B1MA 1Y4HA 1ICFA 1NPZA 3PRMA 3N4CA 1YK8A 2XU5A 1PADA 1PPOA 1AU4A 5CVOB 1NL6A 1PBHA 5PADA 3OVXA 2PNSA 1NLJA 3BPMA 2BU3A 3PBHA 1KFXL 1AU2A 4DMYA 2VHSA 3KW9A 4X6IA 1QDQA 1EF7A 1SP4B 3BBAA 3OVZA 4PI3A 2AS8A 5F02A 7PCKA 4I04A 3PDFA 2PADA 1GCBA 1EWPA 2OULA 1YT7A 4RNAA 3W30A 1STFE 2DJFB 2GHUA 2DCAA 2AYOA 2H7JA 4QH6A 3CBJA 3BY4A 4MSXA 1U9XA 3WXFA 2R9MA 1ZCMA 3P5XA 5CHTA 1MEGA 4I07A 1F2AA 4YYSA 2NQDB 1MS6A 3TMPA 4XUIA 1CV8A 1BGOA 2PREA 4PP2E 1YK7A 1UKFA 2HH5A 2NQAA 3IHPA 3U8EA 3MHHA 4MZOA 3QSDA 2DC7A 2AUZA 4MZSA 3W31A 2YJ8A 2C0YA 3OISA 5FPWA 4I05A 2GFOA 3I3TA 3PSEA 1YVBA 2YJBA 4BOZA 1MDWA 2DJGB 2OP3A 2R9OA 1EWOA 4M0WA 2DCCA 3O0UA 3PNRA 3KFQA 3F75A 1DEUA 3USVA 1AYUA 3OQCA 1FH0A 3F5VA 3O1GA 3I06A 5K16A 4ZTBA 3AI8A 3N3GA 4FJCA 5EZSA 1PVJA 3ZNHA 2ATOA 3H8CA 2AGAA 2XU1A 4IP3A 3V6CA 1CB5A 2IBIA 1AYWA 1AU0A 2R9NA 3HHIA 5KO3A 4BPVA 2BDLA 1DKIA
chains in the Genus database with same CATH topology
1KHQA 2AYNA 3BCNA 4FIPA 2DZZA 1ITOA 1NB3A 4Q8GA 3K24A 5CHVA 3E1ZB 3K9MA 3IMAA 4QBBA 5J94A 5CVMA 1QMYA 4AXLA 1U9WA 4FK5A 3P5VA 3N3KA 4QRGA 2DC8A 4W4UA 4YYWA 2DC6A 1CSBB 3HHAA 3IUTA 1QOLA 3QT4A 1HUCB 1PPPA 3K8UA 1VSNA 2FUDA 3IV2A 3BPFA 1U9VA 5EF4A 4BS5A 3RVVA 1A6RA 2XU3A 1MHWA 4AXMA 1AIMA 4KLBA 2JQGR 1PCIA 4YYUA 2E00A 2G8JA 2P0RA 1CVZA 2IPPB 3KWBX 1TLOA 4W5CA 1ME3A 3MHSA 4BS6A 4PADA 4YVAA 2XU4A 4QRVA 3MORA 4C5PA 6PADA 1POPA 2Y5BA 3V6EA 1BY8A 3CH2X 2E03A 2P7UA 4BQVA 2CB5A 3H7DA 4CDEB 1AU3A 4N4ZA 2P86A 1KFUL 1DF0A 1AYVA 3D6SA 1AECA 2YJ9A 4OELA 4Q8HA 8PCHA 5JA7A 3IEJA 2DC9A 3GCBA 2AVWA 2B1NA 4CDCB 3S3QA 4X6HA 1PPDA 3KKUA 1EWMA 4YV8A 2DCBA 1TL9A 1F2BA 4CZWA 2O6XA 1YALA 3QJ3A 3NHEA 2OZ2A 1KHPA 4WA6A 1CPJA 2G6DA 2VHFA 2G8EA 4OEMA 5A24A 1F2CA 2E02A 2FO5A 4HWYA 1GECE 1PE6A 1BQIA 2ARYA 2FRAA 1XKGA 4DMXA 4G54A 3H6SA 2AUXA 3C9EA 2ACTA 3WXGA 3OF8A 4RY2A 3ZUAA 2HXZA 1X9YA 1U5IA 1KXRA 3S3RA 1PIPA 5EGWA 3BOWA 4X6JA 1GLOA 3KWZA 3WXEA 1NQCA 4YYRA 4XR7A 2HD5A 4NV8A 9PAPA 3LXSA 3HD3A 2WBFX 2CIOA 1PXVA 1VJVA 3BC3A 2NQGA 2FRQA 3BWKA 1GMYA 2R9FA 3IOQA 1O0EA 3PW3A 3P5UA 2JQFR 3DF0A 2FTDA 1QXPA 1S4VA 3ERVA 3MTNA 1CQDA 2R6NA 2NQIA 2BDZA 2FT2A 3H89A 1IWDA 2E01A 2G7YA 4ZUXU 4N8WA 3D9WA 4P6GA 1CTEA 1PPNA 4W5BA 3KSEA 3CBKA 1SNKA 2YJ2A 4K7CA 2F1GA 3B79A 2Y6EA 1ATKA 3M99A 3OF9A 1E2TA 3KX1A 4BSQA 1NB5A 3CH3X 2AU1A 3RVXA 1ZIVA 5JH3A 2F7DA 4N79A 1JQPA 5CVNB 1M6DA 4GUZA 4YYQA 1BP4A 1CJLA 2R9CA 4PP1A 3H8BA 1ME4A 2AIMA 1THEA 2DCDA 1Y08A 2YJCA 1CS8A 1MEMA 2PBHA 4CDDB 4YYVA 4CDFB 2FQ9A 4NV7A 1F29A 3RVWA 1K3BB 3LFYA 1EWLA 1GX3A 1TU6A 2FYEA 2HHNA 4P6EA 3TNXA 3HWNA 1U9QX 4QRXA 3P5WA 2DZYA 1Q6KA 1MIRA 2B1MA 1Y4HA 1ICFA 1NPZA 3N4CA 1YK8A 2XU5A 1PADA 1PPOA 1AU4A 5CVOB 1NL6A 1PBHA 5PADA 3OVXA 2PNSA 1NLJA 3BPMA 3PBHA 1KFXL 1AU2A 4DMYA 2VHSA 3KW9A 4X6IA 1QDQA 1EF7A 1SP4B 3OVZA 4PI3A 2AS8A 5F02A 7PCKA 4I04A 3PDFA 2PADA 1GCBA 1EWPA 2VFCA 2OULA 1YT7A 1STFE 2DJFB 2GHUA 2DCAA 2AYOA 2H7JA 4QH6A 4BGFA 3CBJA 4MSXA 1U9XA 3WXFA 2BSZA 2R9MA 1ZCMA 3P5XA 5CHTA 1MEGA 4I07A 1F2AA 4YYSA 1W4TA 2NQDB 1MS6A 4XUIA 1CV8A 1BGOA 2PREA 4PP2E 1YK7A 2HH5A 2NQAA 1W6FA 3IHPA 3U8EA 3MHHA 4MZOA 3QSDA 2DC7A 2AUZA 4MZSA 2YJ8A 2C0YA 3OISA 5FPWA 4I05A 2GFOA 3I3TA 1YVBA 2YJBA 1MDWA 2DJGB 2OP3A 2R9OA 1EWOA 2DCCA 3O0UA 3PNRA 3KFQA 3F75A 1DEUA 3USVA 1AYUA 1FH0A 3F5VA 3O1GA 3I06A 5K16A 3AI8A 1W5RA 3N3GA 4FJCA 2ATOA 3H8CA 2VFBA 2XU1A 3V6CA 1CB5A 3LTWA 2IBIA 1AYWA 1AU0A 2R9NA 4B55A 3HHIA 4BPVA 2BDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KHQ A;  2AYN A;  3BCN A;  4FIP A;  2DZZ A;  1ITO A;  1NB3 A;  4Q8G A;  3K24 A;  5CHV A;  3E1Z B;  3K9M A;  3IMA A;  4QBB A;  5J94 A;  5CVM A;  1QMY A;  4AXL A;  1U9W A;  4FK5 A;  3P5V A;  3N3K A;  4QRG A;  2DC8 A;  4W4U A;  4YYW A;  2DC6 A;  1CSB B;  3HHA A;  3IUT A;  1QOL A;  3QT4 A;  1HUC B;  1PPP A;  3K8U A;  1VSN A;  2FUD A;  3IV2 A;  3BPF A;  1U9V A;  5EF4 A;  4BS5 A;  3RVV A;  1A6R A;  2XU3 A;  1MHW A;  4AXM A;  1AIM A;  4KLB A;  2JQG R;  1PCI A;  4YYU A;  2E00 A;  2G8J A;  2P0R A;  1CVZ A;  2IPP B;  3KWB X;  1TLO A;  4W5C A;  1ME3 A;  3MHS A;  4BS6 A;  4PAD A;  4YVA A;  2XU4 A;  4QRV A;  3MOR A;  6PAD A;  1POP A;  2Y5B A;  3V6E A;  1BY8 A;  3CH2 X;  2E03 A;  2P7U A;  4BQV A;  2CB5 A;  3H7D A;  4CDE B;  1AU3 A;  4N4Z A;  2P86 A;  1KFU L;  1DF0 A;  1AYV A;  3D6S A;  1AEC A;  2YJ9 A;  4OEL A;  4Q8H A;  8PCH A;  5JA7 A;  3IEJ A;  2DC9 A;  3GCB A;  2AVW A;  2B1N A;  4CDC B;  3S3Q A;  4X6H A;  1PPD A;  3KKU A;  1EWM A;  4YV8 A;  2DCB A;  1TL9 A;  1F2B A;  4CZW A;  2O6X A;  1YAL A;  3QJ3 A;  3NHE A;  2OZ2 A;  1KHP A;  4WA6 A;  1CPJ A;  2G6D A;  2VHF A;  2G8E A;  4OEM A;  5A24 A;  1F2C A;  2E02 A;  2FO5 A;  4HWY A;  1GEC E;  1PE6 A;  1BQI A;  2ARY A;  2FRA A;  1XKG A;  4DMX A;  4G54 A;  3H6S A;  2AUX A;  3C9E A;  2ACT A;  3WXG A;  3OF8 A;  4RY2 A;  3ZUA A;  2HXZ A;  1X9Y A;  1U5I A;  1KXR A;  3S3R A;  1PIP A;  5EGW A;  3BOW A;  4X6J A;  1GLO A;  3KWZ A;  3WXE A;  1NQC A;  4YYR A;  4XR7 A;  2HD5 A;  9PAP A;  3LXS A;  3HD3 A;  2WBF X;  2CIO A;  1PXV A;  1VJV A;  3BC3 A;  2NQG A;  2FRQ A;  3BWK A;  1GMY A;  2R9F A;  3IOQ A;  1O0E A;  3PW3 A;  3P5U A;  2JQF R;  3DF0 A;  2FTD A;  1QXP A;  1S4V A;  3ERV A;  3MTN A;  1CQD A;  2R6N A;  2NQI A;  2BDZ A;  2FT2 A;  3H89 A;  1IWD A;  2E01 A;  2G7Y A;  4ZUX U;  4N8W A;  4P6G A;  1CTE A;  1PPN A;  4W5B A;  3KSE A;  3CBK A;  1SNK A;  2YJ2 A;  4K7C A;  2F1G A;  3B79 A;  2Y6E A;  1ATK A;  3M99 A;  3OF9 A;  3KX1 A;  4BSQ A;  1NB5 A;  3CH3 X;  2AU1 A;  3RVX A;  1ZIV A;  5JH3 A;  2F7D A;  4N79 A;  1JQP A;  5CVN B;  1M6D A;  4YYQ A;  1BP4 A;  1CJL A;  2R9C A;  4PP1 A;  3H8B A;  1ME4 A;  2AIM A;  1THE A;  2DCD A;  1Y08 A;  2YJC A;  1CS8 A;  1MEM A;  2PBH A;  4CDD B;  4YYV A;  4CDF B;  2FQ9 A;  1F29 A;  3RVW A;  1K3B B;  3LFY A;  1EWL A;  1TU6 A;  2FYE A;  2HHN A;  4P6E A;  3TNX A;  3HWN A;  1U9Q X;  4QRX A;  3P5W A;  2DZY A;  1Q6K A;  1MIR A;  2B1M A;  1Y4H A;  1ICF A;  1NPZ A;  3N4C A;  1YK8 A;  2XU5 A;  1PAD A;  1PPO A;  1AU4 A;  5CVO B;  1NL6 A;  1PBH A;  5PAD A;  3OVX A;  2PNS A;  1NLJ A;  3BPM A;  3PBH A;  1KFX L;  1AU2 A;  4DMY A;  2VHS A;  3KW9 A;  4X6I A;  1QDQ A;  1EF7 A;  1SP4 B;  4PI3 A;  3OVZ A;  2AS8 A;  5F02 A;  7PCK A;  4I04 A;  3PDF A;  2PAD A;  1GCB A;  1EWP A;  2OUL A;  1YT7 A;  1STF E;  2DJF B;  2GHU A;  2DCA A;  2AYO A;  2H7J A;  4QH6 A;  3CBJ A;  4MSX A;  1U9X A;  3WXF A;  2R9M A;  1ZCM A;  3P5X A;  5CHT A;  1MEG A;  4I07 A;  1F2A A;  4YYS A;  2NQD B;  1MS6 A;  4XUI A;  1CV8 A;  1BGO A;  2PRE A;  4PP2 E;  1YK7 A;  2HH5 A;  2NQA A;  3IHP A;  3U8E A;  3MHH A;  4MZO A;  3QSD A;  2DC7 A;  2AUZ A;  4MZS A;  2YJ8 A;  2C0Y A;  3OIS A;  5FPW A;  4I05 A;  2GFO A;  3I3T A;  1YVB A;  2YJB A;  1MDW A;  2DJG B;  2OP3 A;  2R9O A;  1EWO A;  2DCC A;  3O0U A;  3PNR A;  3KFQ A;  3F75 A;  1DEU A;  3USV A;  1AYU A;  1FH0 A;  3F5V A;  3O1G A;  3I06 A;  5K16 A;  3AI8 A;  3N3G A;  4FJC A;  2ATO A;  3H8C A;  2XU1 A;  3V6C A;  1CB5 A;  2IBI A;  1AYW A;  1AU0 A;  2R9N A;  3HHI A;  4BPV A;  2BDL A; 
#chains in the Genus database with same CATH topology
 1KHQ A;  2AYN A;  3BCN A;  4FIP A;  2DZZ A;  1ITO A;  1NB3 A;  4BOP A;  4Q8G A;  3K24 A;  5CHV A;  3E1Z B;  3K9M A;  3IMA A;  4QBB A;  5J94 A;  4HXD B;  5CVM A;  1QMY A;  2HWK A;  4AXL A;  4BOQ A;  1U9W A;  4FK5 A;  3P5V A;  3N3K A;  4QRG A;  2DC8 A;  4W4U A;  2BTW B;  4YYW A;  4OVZ B;  2DC6 A;  2Z84 A;  3E9S A;  5E6J A;  1CSB B;  3HHA A;  3IUT A;  1QOL A;  3QT4 A;  1HUC B;  1PPP A;  3K8U A;  1VSN A;  4BOS A;  2FUD A;  3IV2 A;  3BPF A;  1U9V A;  5EF4 A;  4BS5 A;  3RVV A;  4D8E A;  1A6R A;  4PT5 A;  2XU3 A;  1MHW A;  4AXM A;  1AIM A;  4KLB A;  2JQG R;  1PCI A;  4YYU A;  2E00 A;  2G8J A;  2P0R A;  1CVZ A;  2IPP B;  3KWB X;  3BB7 A;  1TLO A;  3IFU A;  4W5C A;  1ME3 A;  3MHS A;  4RF0 A;  4BS6 A;  2JTC A;  4PAD A;  1YZB A;  4YVA A;  2XU4 A;  4QRV A;  3MOR A;  6PAD A;  1POP A;  2Y5B A;  3O65 A;  3V6E A;  1BY8 A;  3CH2 X;  2E03 A;  2P7U A;  4BQV A;  2CB5 A;  3H7D A;  2J7Q C;  4CDE B;  1AU3 A;  4N4Z A;  2P86 A;  1KFU L;  1DF0 A;  1AYV A;  3D6S A;  1AEC A;  2YJ9 A;  4OEL A;  4REZ A;  4Q8H A;  8PCH A;  5JA7 A;  3IEJ A;  2DC9 A;  3GCB A;  3PT2 A;  5EZQ A;  2AVW A;  2B1N A;  4BOU A;  4CDC B;  3S3Q A;  4X6H A;  1PPD A;  3KKU A;  1EWM A;  4YV8 A;  2DCB A;  1TL9 A;  1F2B A;  4CZW A;  2O6X A;  1YAL A;  3QJ3 A;  3NHE A;  2OZ2 A;  1KHP A;  4WA6 A;  2BTW A;  4OVZ A;  1CPJ A;  2G6D A;  2VHF A;  2G8E A;  4OEM A;  5A24 A;  1F2C A;  2E02 A;  2FO5 A;  4HWY A;  1GEC E;  1PE6 A;  1BQI A;  3B21 A;  2ARY A;  2FRA A;  3MTV A;  1XKG A;  4DMX A;  4G54 A;  4GUA A;  3H6S A;  2AUX A;  3C9E A;  2ACT A;  3WXG A;  3OF8 A;  3PRP A;  4RY2 A;  3ZUA A;  2HXZ A;  1X9Y A;  1U5I A;  4P16 A;  1KXR A;  3S3R A;  1PIP A;  2JRI A;  5EGW A;  3BOW A;  4X6J A;  1GLO A;  3KWZ A;  3WXE A;  3TRK A;  2FE8 A;  1NQC A;  4YYR A;  4XR7 A;  2HD5 A;  9PAP A;  3LXS A;  3HD3 A;  2WBF X;  2CIO A;  4RF1 A;  1PXV A;  1VJV A;  3BC3 A;  2NQG A;  4MI7 A;  2FRQ A;  3BWK A;  1GMY A;  4IUM A;  2R9F A;  3C0R A;  3IOQ A;  1O0E A;  3PW3 A;  2UZJ A;  3P5U A;  2JQF R;  3DF0 A;  2FTD A;  1QXP A;  1S4V A;  4R3D A;  3ERV A;  3MTN A;  1CQD A;  2R6N A;  2NQI A;  2BDZ A;  2FT2 A;  3H89 A;  1IWD A;  2E01 A;  2G7Y A;  4ZUX U;  3MP2 A;  4N8W A;  2J7Q A;  4WUR A;  4MM3 B;  3PHW A;  2DOS A;  3MJ5 A;  4P6G A;  1CTE A;  1PPN A;  4W5B A;  3KSE A;  3CBK A;  1SNK A;  2YJ2 A;  4K7C A;  2F1G A;  5JZE A;  3B79 A;  2Y6E A;  1ATK A;  3M99 A;  3OF9 A;  4D8B A;  3KX1 A;  4BSQ A;  1NB5 A;  3CH3 X;  2AU1 A;  4OW0 A;  3RVX A;  1ZIV A;  5JH3 A;  3RNV A;  3PHU A;  2F7D A;  4N79 A;  1JQP A;  5CVN B;  1M6D A;  4YYQ A;  1BP4 A;  1CJL A;  4RKX A;  2R9C A;  4PP1 A;  3H8B A;  1ME4 A;  2AIM A;  1THE A;  2DCD A;  1Y08 A;  2YJC A;  1CS8 A;  1MEM A;  2PBH A;  4CDD B;  4XZX A;  4YYV A;  4CDF B;  2FQ9 A;  4A5U A;  1F29 A;  3RVW A;  3PHX A;  1K3B B;  3LFY A;  1EWL A;  1TU6 A;  2FYE A;  4D8I A;  2HHN A;  4P6E A;  3TNX A;  3HWN A;  1U9Q X;  4QRX A;  3P5W A;  2DZY A;  1Q6K A;  1MIR A;  2B1M A;  1Y4H A;  1ICF A;  1NPZ A;  3PRM A;  3N4C A;  1YK8 A;  2XU5 A;  1PAD A;  1PPO A;  1AU4 A;  5CVO B;  1NL6 A;  1PBH A;  5PAD A;  3OVX A;  2PNS A;  1NLJ A;  3BPM A;  2BU3 A;  3PBH A;  1KFX L;  1AU2 A;  4DMY A;  2VHS A;  3KW9 A;  4X6I A;  1QDQ A;  1EF7 A;  1SP4 B;  3BBA A;  3OVZ A;  4PI3 A;  2AS8 A;  5F02 A;  7PCK A;  4I04 A;  3PDF A;  2PAD A;  1GCB A;  1EWP A;  2OUL A;  1YT7 A;  4RNA A;  3W30 A;  1STF E;  2DJF B;  2GHU A;  2DCA A;  2AYO A;  2H7J A;  4QH6 A;  3CBJ A;  3BY4 A;  4MSX A;  1U9X A;  3WXF A;  2R9M A;  1ZCM A;  3P5X A;  5CHT A;  1MEG A;  4I07 A;  1F2A A;  4YYS A;  2NQD B;  1MS6 A;  3TMP A;  4XUI A;  1CV8 A;  1BGO A;  2PRE A;  4PP2 E;  1YK7 A;  1UKF A;  2HH5 A;  2NQA A;  3IHP A;  3U8E A;  3MHH A;  4MZO A;  3QSD A;  2DC7 A;  2AUZ A;  4MZS A;  3W31 A;  2YJ8 A;  2C0Y A;  3OIS A;  5FPW A;  4I05 A;  2GFO A;  3I3T A;  3PSE A;  1YVB A;  2YJB A;  4BOZ A;  1MDW A;  2DJG B;  2OP3 A;  2R9O A;  1EWO A;  4M0W A;  2DCC A;  3O0U A;  3PNR A;  3KFQ A;  3F75 A;  1DEU A;  3USV A;  1AYU A;  3OQC A;  1FH0 A;  3F5V A;  3O1G A;  3I06 A;  5K16 A;  4ZTB A;  3AI8 A;  3N3G A;  4FJC A;  5EZS A;  1PVJ A;  3ZNH A;  2ATO A;  3H8C A;  2AGA A;  2XU1 A;  4IP3 A;  3V6C A;  1CB5 A;  2IBI A;  1AYW A;  1AU0 A;  2R9N A;  3HHI A;  5KO3 A;  4BPV A;  2BDL A;  1DKI A; 
#chains in the Genus database with same CATH homology
 1KHQ A;  2AYN A;  3BCN A;  4FIP A;  2DZZ A;  1ITO A;  1NB3 A;  4Q8G A;  3K24 A;  5CHV A;  3E1Z B;  3K9M A;  3IMA A;  4QBB A;  5J94 A;  5CVM A;  1QMY A;  4AXL A;  1U9W A;  4FK5 A;  3P5V A;  3N3K A;  4QRG A;  2DC8 A;  4W4U A;  4YYW A;  2DC6 A;  1CSB B;  3HHA A;  3IUT A;  1QOL A;  3QT4 A;  1HUC B;  1PPP A;  3K8U A;  1VSN A;  2FUD A;  3IV2 A;  3BPF A;  1U9V A;  5EF4 A;  4BS5 A;  3RVV A;  1A6R A;  2XU3 A;  1MHW A;  4AXM A;  1AIM A;  4KLB A;  2JQG R;  1PCI A;  4YYU A;  2E00 A;  2G8J A;  2P0R A;  1CVZ A;  2IPP B;  3KWB X;  1TLO A;  4W5C A;  1ME3 A;  3MHS A;  4BS6 A;  4PAD A;  4YVA A;  2XU4 A;  4QRV A;  3MOR A;  4C5P A;  6PAD A;  1POP A;  2Y5B A;  3V6E A;  1BY8 A;  3CH2 X;  2E03 A;  2P7U A;  4BQV A;  2CB5 A;  3H7D A;  4CDE B;  1AU3 A;  4N4Z A;  2P86 A;  1KFU L;  1DF0 A;  1AYV A;  3D6S A;  1AEC A;  2YJ9 A;  4OEL A;  4Q8H A;  8PCH A;  5JA7 A;  3IEJ A;  2DC9 A;  3GCB A;  2AVW A;  2B1N A;  4CDC B;  3S3Q A;  4X6H A;  1PPD A;  3KKU A;  1EWM A;  4YV8 A;  2DCB A;  1TL9 A;  1F2B A;  4CZW A;  2O6X A;  1YAL A;  3QJ3 A;  3NHE A;  2OZ2 A;  1KHP A;  4WA6 A;  1CPJ A;  2G6D A;  2VHF A;  2G8E A;  4OEM A;  5A24 A;  1F2C A;  2E02 A;  2FO5 A;  4HWY A;  1GEC E;  1PE6 A;  1BQI A;  2ARY A;  2FRA A;  1XKG A;  4DMX A;  4G54 A;  3H6S A;  2AUX A;  3C9E A;  2ACT A;  3WXG A;  3OF8 A;  4RY2 A;  3ZUA A;  2HXZ A;  1X9Y A;  1U5I A;  1KXR A;  3S3R A;  1PIP A;  5EGW A;  3BOW A;  4X6J A;  1GLO A;  3KWZ A;  3WXE A;  1NQC A;  4YYR A;  4XR7 A;  2HD5 A;  4NV8 A;  9PAP A;  3LXS A;  3HD3 A;  2WBF X;  2CIO A;  1PXV A;  1VJV A;  3BC3 A;  2NQG A;  2FRQ A;  3BWK A;  1GMY A;  2R9F A;  3IOQ A;  1O0E A;  3PW3 A;  3P5U A;  2JQF R;  3DF0 A;  2FTD A;  1QXP A;  1S4V A;  3ERV A;  3MTN A;  1CQD A;  2R6N A;  2NQI A;  2BDZ A;  2FT2 A;  3H89 A;  1IWD A;  2E01 A;  2G7Y A;  4ZUX U;  4N8W A;  3D9W A;  4P6G A;  1CTE A;  1PPN A;  4W5B A;  3KSE A;  3CBK A;  1SNK A;  2YJ2 A;  4K7C A;  2F1G A;  3B79 A;  2Y6E A;  1ATK A;  3M99 A;  3OF9 A;  1E2T A;  3KX1 A;  4BSQ A;  1NB5 A;  3CH3 X;  2AU1 A;  3RVX A;  1ZIV A;  5JH3 A;  2F7D A;  4N79 A;  1JQP A;  5CVN B;  1M6D A;  4GUZ A;  4YYQ A;  1BP4 A;  1CJL A;  2R9C A;  4PP1 A;  3H8B A;  1ME4 A;  2AIM A;  1THE A;  2DCD A;  1Y08 A;  2YJC A;  1CS8 A;  1MEM A;  2PBH A;  4CDD B;  4YYV A;  4CDF B;  2FQ9 A;  4NV7 A;  1F29 A;  3RVW A;  1K3B B;  3LFY A;  1EWL A;  1GX3 A;  1TU6 A;  2FYE A;  2HHN A;  4P6E A;  3TNX A;  3HWN A;  1U9Q X;  4QRX A;  3P5W A;  2DZY A;  1Q6K A;  1MIR A;  2B1M A;  1Y4H A;  1ICF A;  1NPZ A;  3N4C A;  1YK8 A;  2XU5 A;  1PAD A;  1PPO A;  1AU4 A;  5CVO B;  1NL6 A;  1PBH A;  5PAD A;  3OVX A;  2PNS A;  1NLJ A;  3BPM A;  3PBH A;  1KFX L;  1AU2 A;  4DMY A;  2VHS A;  3KW9 A;  4X6I A;  1QDQ A;  1EF7 A;  1SP4 B;  3OVZ A;  4PI3 A;  2AS8 A;  5F02 A;  7PCK A;  4I04 A;  3PDF A;  2PAD A;  1GCB A;  1EWP A;  2VFC A;  2OUL A;  1YT7 A;  1STF E;  2DJF B;  2GHU A;  2DCA A;  2AYO A;  2H7J A;  4QH6 A;  4BGF A;  3CBJ A;  4MSX A;  1U9X A;  3WXF A;  2BSZ A;  2R9M A;  1ZCM A;  3P5X A;  5CHT A;  1MEG A;  4I07 A;  1F2A A;  4YYS A;  1W4T A;  2NQD B;  1MS6 A;  4XUI A;  1CV8 A;  1BGO A;  2PRE A;  4PP2 E;  1YK7 A;  2HH5 A;  2NQA A;  1W6F A;  3IHP A;  3U8E A;  3MHH A;  4MZO A;  3QSD A;  2DC7 A;  2AUZ A;  4MZS A;  2YJ8 A;  2C0Y A;  3OIS A;  5FPW A;  4I05 A;  2GFO A;  3I3T A;  1YVB A;  2YJB A;  1MDW A;  2DJG B;  2OP3 A;  2R9O A;  1EWO A;  2DCC A;  3O0U A;  3PNR A;  3KFQ A;  3F75 A;  1DEU A;  3USV A;  1AYU A;  1FH0 A;  3F5V A;  3O1G A;  3I06 A;  5K16 A;  3AI8 A;  1W5R A;  3N3G A;  4FJC A;  2ATO A;  3H8C A;  2VFB A;  2XU1 A;  3V6C A;  1CB5 A;  3LTW A;  2IBI A;  1AYW A;  1AU0 A;  2R9N A;  4B55 A;  3HHI A;  4BPV A;  2BDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...