2AVWA

Crystal structure of monoclinic form of streptococcus mac-1
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
290
structure length
290
Chain Sequence
VTSVWTKGVTPPANFTQGEDVFHAPYVANQGWYDITKTFNGKDDLLAGAATAGNMLHWWFDQNKDQIKRYLEEHPEKQKINFNGEQMFDVKEAIDTKNHQLDSKLFEYFKEKAFPYLSTKHLGVFPDHVIDMFINGYRLSLTNHGPTPVKEGSKDPRGGIFDAVFTRGDQSKLLTSRHDFKEKNLKEISDLIKKELTEGKALGLSHTYANVRINHVINLWGADFDSNGNLKAIYVTDSDSNASIGMKKYFVGVNSAGKVAISAKEIKEDNIGAQVLGLFTLSTGQDSWNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IgG-degrading protease
publication title Crystal structure of group a streptococcus mac-1: insight into dimer-mediated specificity for recognition of human IgG.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Hydrolase
total genus 82
structure length 290
sequence length 290
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2avwA01
2DC7A 2AVWA 1JQPA 1ME4A 1XKGA 1BP4A 1AYWA 3H8BA 1PADA 3IHPA 1PCIA 2HD5A 1AYVA 1DEUA 3U8EA 3DF0A 1QOLA 3B79A 1CTEA 4FJCA 1BQIA 4YYWA 2E00A 1MDWA 3USVA 3GCBA 1PXVA 1PIPA 1AYUA 3OVZA 1PPPA 3O0UA 2B1NA 4N79A 2P0RA 2VHFA 2E02A 1KXRA 1PPDA 2B1MA 4YYSA 3HD3A 2HHNA 6PADA 2PBHA 2F7DA 3BPFA 1ME3A 2AYNA 2E01A 3N3GA 3MORA 1CJLA 4KLBA 5K16A 2PADA 3AI8A 2DZZA 1SNKA 2JQGR 4K7CA 2FRAA 2DC6A 3ZUAA 3BOWA 3OF9A 2GFOA 3KFQA 1CB5A 2DJGB 1THEA 3MTNA 1AECA 3LFYA 2DC9A 4ZUXU 2AS8A 3K9MA 1YALA 1YT7A 4YYRA 2NQGA 4QBBA 2R9CA 2NQAA 4HWYA 3RVWA 2OZ2A 1CV8A 4XUIA 4W5CA 3QT4A 5CVOB 3BWKA 3N3KA 3E1ZB 2AUZA 9PAPA 2XU1A 3BCNA 2P7UA 1AU4A 2IPPB 2CB5A 4QRXA 1STFE 1GMYA 5CVNB 5EGWA 3TNXA 4BS5A 1BGOA 1Y4HA 3OVXA 1U9XA 2FRQA 1SP4B 3KWBX 3CH3X 2G8JA 5PADA 3V6CA 1PBHA 3IUTA 1GECE 2AYOA 2XU3A 4YYUA 2E03A 4X6JA 3C9EA 2G8EA 3F75A 1NL6A 3D6SA 5FPWA 1EWPA 1PE6A 3HHIA 4PI3A 3CH2X 3PDFA 3H8CA 1NB3A 3MHSA 1KFUL 2HH5A 1U9QX 4OEMA 7PCKA 3H6SA 2G7YA 2CIOA 1YVBA 4YV8A 2R9FA 3P5WA 3IMAA 1ZCMA 1ATKA 1Y08A 3OISA 3WXFA 2ATOA 3KSEA 4I04A 4CZWA 2XU5A 3CBJA 1AU2A 1KFXL 2F1GA 4FIPA 3N4CA 1IWDA 4PP1A 2YJ2A 2BDZA 1YK8A 2FTDA 1CVZA 2NQDB 3K8UA 1O0EA 2OP3A 1FH0A 4I07A 4PADA 1NLJA 3I06A 4CDFB 1POPA 2Y5BA 3BC3A 2FYEA 1M6DA 1QMYA 4N8WA 3KKUA 1MIRA 1HUCB 2DCAA 1MS6A 4N4ZA 3OF8A 2PREA 2PNSA 3QSDA 2DC8A 3PW3A 2P86A 5JH3A 1BY8A 2ACTA 1S4VA 1CSBB 1CPJA 3F5VA 2JQFR 2AU1A 3BPMA 3O1GA 3P5XA 1MEMA 1U9WA 3S3QA 1F2BA 4I05A 2IBIA 4X6HA 3P5VA 3QJ3A 3ERVA 4BPVA 8PCHA 3H7DA 1X9YA 2FQ9A 1GCBA 4X6IA 1F2AA 2FT2A 2GHUA 4YYQA 4DMYA 1A6RA 2DCDA 2R6NA 3M99A 4Q8GA 4MZSA 2O6XA 2FUDA 3CBKA 4BQVA 4QRGA 1MHWA 4YVAA 1EWOA 3S3RA 2G6DA 2Y6EA 1NB5A 1CQDA 2YJBA 4P6GA 2XU4A 3IV2A 4G54A 1EWMA 2DCBA 2R9OA 1QXPA 3PBHA 5EF4A 3I3TA 1AU3A 1TL9A 3KX1A 2YJ8A 5A24A 3P5UA 1NPZA 1NQCA 2DZYA 1U9VA 4QRVA 4AXLA 1ITOA 3HWNA 4BSQA 5J94A 1VSNA 5JA7A 3WXEA 4OELA 2DCCA 4YYVA 2HXZA 2R9MA 1F29A 1KHPA 1QDQA 3IEJA 2AUXA 3RVXA 1ICFA 1GLOA 2DJFB 1U5IA 1DF0A 4MSXA 4PP2E 4CDDB 2ARYA 1TU6A 3RVVA 4FK5A 2FO5A 1MEGA 3H89A 3WXGA 1PPOA 4QH6A 1VJVA 1K3BB 3MHHA 2H7JA 4W5BA 5CHTA 3HHAA 3KW9A 4BS6A 1KHQA 1YK7A 4RY2A 4AXMA 3V6EA 2OULA 3K24A 1ZIVA 2R9NA 5F02A 2BDLA 1Q6KA 4XR7A 4P6EA 4WA6A 3PNRA 1EWLA 2VHSA 2YJCA 1AU0A 3KWZA 1TLOA 1F2CA 2NQIA 1PPNA 4W4UA 4DMXA 1CS8A 5CVMA 3NHEA 2C0YA 5CHVA 2AIMA 2WBFX 4CDCB 4CDEB 4MZOA 1EF7A 2YJ9A 3LXSA 4Q8HA 3IOQA 1AIMA
chains in the Genus database with same CATH superfamily
2DC7A 3O65A 2AVWA 1JQPA 3E9SA 1ME4A 4REZA 1XKGA 1BP4A 1AYWA 3H8BA 1PADA 3IHPA 1PCIA 3MP2A 2HD5A 4PT5A 1AYVA 1DEUA 3U8EA 3DF0A 1QOLA 3B79A 1CTEA 4FJCA 1BQIA 4YYWA 3RNVA 2E00A 1MDWA 3PT2A 3USVA 3GCBA 1PXVA 1PIPA 1AYUA 3OVZA 4OVZA 5JZEA 1PPPA 3O0UA 2B1NA 4N79A 2P0RA 2VHFA 2E02A 1KXRA 1PPDA 4P16A 2B1MA 4YYSA 3HD3A 2HHNA 6PADA 2PBHA 2F7DA 2J7QA 3BPFA 1ME3A 2AYNA 2E01A 3N3GA 3MORA 1CJLA 4KLBA 5K16A 2PADA 3AI8A 2DZZA 1SNKA 5KO3A 2JQGR 4K7CA 2FRAA 2DC6A 3ZUAA 3BOWA 3OF9A 3KFQA 2GFOA 1CB5A 5EZQA 2AGAA 2DJGB 1THEA 3MTNA 1AECA 3LFYA 2DC9A 4ZUXU 4MM3B 2AS8A 3K9MA 5E6JA 1YALA 1YT7A 4YYRA 2NQGA 3TRKA 4QBBA 2R9CA 2NQAA 4HWYA 3RVWA 2OZ2A 1CV8A 4XUIA 4OW0A 4W5CA 3PSEA 3QT4A 2DOSA 5CVOB 3BWKA 3N3KA 3E1ZB 2AUZA 9PAPA 2XU1A 3BCNA 2P7UA 4RF1A 4IUMA 1AU4A 2IPPB 2CB5A 4QRXA 1STFE 1GMYA 5CVNB 5EGWA 3TNXA 4BS5A 1BGOA 1Y4HA 3OVXA 1U9XA 1UKFA 2FRQA 1SP4B 3KWBX 3CH3X 2G8JA 5PADA 3V6CA 1PBHA 3IUTA 1GECE 2AYOA 2XU3A 4YYUA 2E03A 4X6JA 5EZSA 3C9EA 2G8EA 3F75A 1NL6A 3D6SA 5FPWA 1EWPA 1PE6A 3HHIA 3IFUA 4PI3A 4OVZB 3CH2X 3PDFA 3H8CA 1NB3A 3MHSA 1KFUL 2HH5A 1U9QX 4BOZA 4OEMA 7PCKA 3H6SA 2G7YA 2CIOA 2JTCA 1YVBA 4YV8A 2R9FA 3P5WA 3BB7A 3IMAA 1ZCMA 4BOSA 1YZBA 1ATKA 1Y08A 3OISA 3WXFA 2ATOA 3KSEA 4I04A 4CZWA 3PHWA 2XU5A 4M0WA 2FE8A 3CBJA 1AU2A 1KFXL 2F1GA 4FIPA 3N4CA 1IWDA 4RF0A 4PP1A 2YJ2A 2BDZA 1YK8A 2FTDA 1CVZA 2J7QC 2NQDB 3K8UA 4XZXA 1O0EA 2OP3A 1FH0A 4MI7A 4IP3A 4I07A 4PADA 1NLJA 3I06A 4CDFB 1POPA 2Y5BA 3BC3A 2FYEA 1M6DA 1QMYA 4N8WA 3KKUA 2HWKA 1MIRA 1HUCB 2DCAA 1MS6A 4N4ZA 3OF8A 2PREA 2PNSA 3QSDA 2DC8A 3PW3A 2P86A 4D8IA 5JH3A 4HXDB 4D8BA 1BY8A 2ACTA 1S4VA 1CSBB 1CPJA 3F5VA 2JQFR 2AU1A 3BPMA 3O1GA 3P5XA 1MEMA 1U9WA 3S3QA 1F2BA 4I05A 2IBIA 4X6HA 3P5VA 3QJ3A 3MTVA 4BOPA 3W30A 3ERVA 4BPVA 8PCHA 3H7DA 1X9YA 2FQ9A 1GCBA 4X6IA 4RKXA 1F2AA 2FT2A 2GHUA 4YYQA 2BTWA 4DMYA 1A6RA 2DCDA 2Z84A 2R6NA 3M99A 4Q8GA 4MZSA 2O6XA 2FUDA 3CBKA 4BQVA 4QRGA 1MHWA 1PVJA 4YVAA 1EWOA 3S3RA 2G6DA 2Y6EA 1NB5A 1CQDA 2YJBA 4P6GA 3BY4A 2XU4A 3IV2A 4G54A 1EWMA 2DCBA 2R9OA 1QXPA 3PBHA 4BOUA 5EF4A 3I3TA 1AU3A 1TL9A 3KX1A 2YJ8A 5A24A 3P5UA 1NPZA 1NQCA 3TMPA 2DZYA 1U9VA 4QRVA 4AXLA 1ITOA 3HWNA 4BSQA 5J94A 1VSNA 5JA7A 3PHUA 3WXEA 4OELA 2DCCA 4YYVA 2HXZA 4ZTBA 2R9MA 1F29A 3B21A 1KHPA 1QDQA 3IEJA 2AUXA 4A5UA 3PHXA 3RVXA 1ICFA 1GLOA 2DJFB 3BBAA 1U5IA 4GUAA 3PRPA 2JRIA 1DF0A 4MSXA 4PP2E 4CDDB 3OQCA 2ARYA 1TU6A 2BU3A 3RVVA 4FK5A 2FO5A 1MEGA 3H89A 3MJ5A 3WXGA 1PPOA 3C0RA 4QH6A 1VJVA 1K3BB 3MHHA 2H7JA 4W5BA 5CHTA 1DKIA 3HHAA 3KW9A 4BS6A 4R3DA 1KHQA 1YK7A 2BTWB 4RY2A 4AXMA 3V6EA 2OULA 3K24A 1ZIVA 2R9NA 5F02A 2BDLA 1Q6KA 3W31A 4XR7A 4P6EA 4WA6A 3PNRA 1EWLA 4BOQA 2VHSA 2YJCA 1AU0A 3KWZA 1TLOA 1F2CA 3PRMA 4RNAA 2NQIA 1PPNA 4W4UA 4DMXA 3ZNHA 1CS8A 5CVMA 3NHEA 2C0YA 5CHVA 4WURA 2AIMA 2WBFX 4D8EA 4CDCB 4CDEB 2UZJA 4MZOA 1EF7A 2YJ9A 3LXSA 4Q8HA 3IOQA 1AIMA
chains in the Genus database with same CATH topology
2DC7A 2AVWA 1JQPA 1ME4A 1XKGA 1BP4A 1AYWA 3H8BA 1PADA 3IHPA 1PCIA 2HD5A 1AYVA 1DEUA 3U8EA 3DF0A 1QOLA 3B79A 1CTEA 4FJCA 1BQIA 4YYWA 2E00A 1MDWA 3USVA 3GCBA 3D9WA 1PXVA 1PIPA 1AYUA 3OVZA 1PPPA 3O0UA 2B1NA 4N79A 2P0RA 2VHFA 2E02A 1KXRA 1PPDA 2B1MA 4YYSA 3HD3A 2HHNA 6PADA 2PBHA 2F7DA 3BPFA 1ME3A 2AYNA 2E01A 3N3GA 3MORA 1CJLA 4KLBA 5K16A 2PADA 3AI8A 2DZZA 1SNKA 2JQGR 4K7CA 2FRAA 2DC6A 3ZUAA 3BOWA 3OF9A 2GFOA 3KFQA 1CB5A 2DJGB 1THEA 3MTNA 1AECA 3LFYA 2DC9A 4ZUXU 2AS8A 3K9MA 1YALA 1YT7A 4YYRA 2NQGA 4QBBA 2R9CA 2NQAA 4HWYA 3RVWA 2OZ2A 1CV8A 4XUIA 4W5CA 3QT4A 5CVOB 2VFCA 3BWKA 3N3KA 3E1ZB 2AUZA 9PAPA 2XU1A 3BCNA 2P7UA 4NV7A 1AU4A 2IPPB 2CB5A 4QRXA 1STFE 1GMYA 2VFBA 5CVNB 5EGWA 3TNXA 4BS5A 1BGOA 1Y4HA 3OVXA 1U9XA 2FRQA 1E2TA 1SP4B 3KWBX 3CH3X 2G8JA 5PADA 4BGFA 3V6CA 1PBHA 3IUTA 1GECE 2AYOA 2XU3A 4YYUA 2E03A 4X6JA 3C9EA 2G8EA 3F75A 1NL6A 3D6SA 5FPWA 1EWPA 1PE6A 3HHIA 4PI3A 3CH2X 3PDFA 3H8CA 1NB3A 3MHSA 1KFUL 2HH5A 1U9QX 4C5PA 4OEMA 7PCKA 3H6SA 2G7YA 1GX3A 2CIOA 1YVBA 4YV8A 2R9FA 3P5WA 3IMAA 1ZCMA 1ATKA 1Y08A 3OISA 3WXFA 2BSZA 2ATOA 3KSEA 4I04A 4CZWA 2XU5A 3CBJA 1AU2A 1KFXL 2F1GA 4FIPA 3N4CA 1IWDA 4PP1A 2YJ2A 2BDZA 1YK8A 2FTDA 1CVZA 2NQDB 3K8UA 1O0EA 2OP3A 1FH0A 4I07A 4PADA 1NLJA 3I06A 4CDFB 1POPA 2Y5BA 3BC3A 2FYEA 1M6DA 1QMYA 4N8WA 3KKUA 1MIRA 1HUCB 2DCAA 1MS6A 4N4ZA 3OF8A 2PREA 4B55A 2PNSA 3QSDA 2DC8A 3PW3A 2P86A 5JH3A 1BY8A 2ACTA 1S4VA 1CSBB 1CPJA 1W4TA 3F5VA 2JQFR 2AU1A 3BPMA 3O1GA 3P5XA 1MEMA 1U9WA 3S3QA 1F2BA 4I05A 2IBIA 4X6HA 3P5VA 3QJ3A 3ERVA 4BPVA 8PCHA 3H7DA 1X9YA 2FQ9A 1GCBA 4X6IA 1F2AA 2FT2A 2GHUA 4YYQA 4DMYA 1A6RA 2DCDA 3LTWA 2R6NA 3M99A 4Q8GA 4MZSA 2O6XA 2FUDA 3CBKA 4BQVA 4QRGA 4NV8A 1MHWA 4YVAA 1EWOA 3S3RA 2G6DA 2Y6EA 1NB5A 1CQDA 2YJBA 4P6GA 2XU4A 3IV2A 4GUZA 4G54A 1EWMA 2DCBA 2R9OA 1QXPA 3PBHA 5EF4A 3I3TA 1AU3A 1TL9A 3KX1A 2YJ8A 5A24A 3P5UA 1NPZA 1NQCA 2DZYA 1U9VA 4QRVA 4AXLA 1ITOA 3HWNA 4BSQA 5J94A 1VSNA 5JA7A 3WXEA 4OELA 2DCCA 4YYVA 2HXZA 2R9MA 1F29A 1KHPA 1QDQA 3IEJA 2AUXA 3RVXA 1ICFA 1GLOA 1W5RA 2DJFB 1U5IA 1DF0A 4MSXA 4PP2E 4CDDB 2ARYA 1TU6A 3RVVA 4FK5A 2FO5A 1MEGA 3H89A 3WXGA 1PPOA 4QH6A 1VJVA 1K3BB 3MHHA 2H7JA 4W5BA 5CHTA 3HHAA 3KW9A 4BS6A 1KHQA 1YK7A 4RY2A 4AXMA 3V6EA 2OULA 3K24A 1ZIVA 2R9NA 5F02A 2BDLA 1Q6KA 4XR7A 4P6EA 4WA6A 3PNRA 1EWLA 2VHSA 2YJCA 1AU0A 3KWZA 1TLOA 1F2CA 2NQIA 1PPNA 4W4UA 4DMXA 1W6FA 1CS8A 5CVMA 3NHEA 2C0YA 5CHVA 2AIMA 2WBFX 4CDCB 4CDEB 4MZOA 1EF7A 2YJ9A 3LXSA 4Q8HA 3IOQA 1AIMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DC7 A;  2AVW A;  1JQP A;  1ME4 A;  1XKG A;  1BP4 A;  1AYW A;  3H8B A;  1PAD A;  3IHP A;  1PCI A;  2HD5 A;  1AYV A;  1DEU A;  3U8E A;  3DF0 A;  1QOL A;  3B79 A;  1CTE A;  4FJC A;  1BQI A;  4YYW A;  2E00 A;  1MDW A;  3USV A;  3GCB A;  1PXV A;  1PIP A;  1AYU A;  3OVZ A;  1PPP A;  3O0U A;  2B1N A;  4N79 A;  2P0R A;  2VHF A;  2E02 A;  1KXR A;  1PPD A;  2B1M A;  4YYS A;  3HD3 A;  2HHN A;  6PAD A;  2PBH A;  2F7D A;  3BPF A;  1ME3 A;  2AYN A;  2E01 A;  3N3G A;  3MOR A;  1CJL A;  4KLB A;  5K16 A;  2PAD A;  3AI8 A;  2DZZ A;  1SNK A;  2JQG R;  4K7C A;  2FRA A;  2DC6 A;  3ZUA A;  3BOW A;  3OF9 A;  2GFO A;  3KFQ A;  1CB5 A;  2DJG B;  1THE A;  3MTN A;  1AEC A;  3LFY A;  2DC9 A;  4ZUX U;  2AS8 A;  3K9M A;  1YAL A;  1YT7 A;  4YYR A;  2NQG A;  4QBB A;  2R9C A;  2NQA A;  4HWY A;  3RVW A;  2OZ2 A;  1CV8 A;  4XUI A;  4W5C A;  3QT4 A;  5CVO B;  3BWK A;  3N3K A;  3E1Z B;  2AUZ A;  9PAP A;  2XU1 A;  3BCN A;  2P7U A;  1AU4 A;  2IPP B;  2CB5 A;  4QRX A;  1STF E;  1GMY A;  5CVN B;  5EGW A;  3TNX A;  4BS5 A;  1BGO A;  1Y4H A;  3OVX A;  1U9X A;  2FRQ A;  1SP4 B;  3KWB X;  3CH3 X;  2G8J A;  5PAD A;  3V6C A;  1PBH A;  3IUT A;  1GEC E;  2AYO A;  2XU3 A;  4YYU A;  2E03 A;  4X6J A;  3C9E A;  2G8E A;  3F75 A;  1NL6 A;  3D6S A;  5FPW A;  1EWP A;  1PE6 A;  3HHI A;  4PI3 A;  3CH2 X;  3PDF A;  3H8C A;  1NB3 A;  3MHS A;  1KFU L;  2HH5 A;  1U9Q X;  4OEM A;  7PCK A;  3H6S A;  2G7Y A;  2CIO A;  1YVB A;  4YV8 A;  2R9F A;  3P5W A;  3IMA A;  1ZCM A;  1ATK A;  1Y08 A;  3OIS A;  3WXF A;  2ATO A;  3KSE A;  4I04 A;  4CZW A;  2XU5 A;  3CBJ A;  1AU2 A;  1KFX L;  2F1G A;  4FIP A;  3N4C A;  1IWD A;  4PP1 A;  2YJ2 A;  2BDZ A;  1YK8 A;  2FTD A;  1CVZ A;  2NQD B;  3K8U A;  1O0E A;  2OP3 A;  1FH0 A;  4I07 A;  4PAD A;  1NLJ A;  3I06 A;  4CDF B;  1POP A;  2Y5B A;  3BC3 A;  2FYE A;  1M6D A;  1QMY A;  4N8W A;  3KKU A;  1MIR A;  1HUC B;  2DCA A;  1MS6 A;  4N4Z A;  3OF8 A;  2PRE A;  2PNS A;  3QSD A;  2DC8 A;  3PW3 A;  2P86 A;  5JH3 A;  1BY8 A;  2ACT A;  1S4V A;  1CSB B;  1CPJ A;  3F5V A;  2JQF R;  2AU1 A;  3BPM A;  3O1G A;  3P5X A;  1MEM A;  1U9W A;  3S3Q A;  1F2B A;  4I05 A;  2IBI A;  4X6H A;  3P5V A;  3QJ3 A;  3ERV A;  4BPV A;  8PCH A;  3H7D A;  1X9Y A;  2FQ9 A;  1GCB A;  4X6I A;  1F2A A;  2FT2 A;  2GHU A;  4YYQ A;  4DMY A;  1A6R A;  2DCD A;  2R6N A;  3M99 A;  4Q8G A;  4MZS A;  2O6X A;  2FUD A;  3CBK A;  4BQV A;  4QRG A;  1MHW A;  4YVA A;  1EWO A;  3S3R A;  2G6D A;  2Y6E A;  1NB5 A;  1CQD A;  2YJB A;  4P6G A;  2XU4 A;  3IV2 A;  4G54 A;  1EWM A;  2DCB A;  2R9O A;  1QXP A;  3PBH A;  5EF4 A;  3I3T A;  1AU3 A;  1TL9 A;  3KX1 A;  2YJ8 A;  5A24 A;  3P5U A;  1NPZ A;  1NQC A;  2DZY A;  1U9V A;  4QRV A;  4AXL A;  1ITO A;  3HWN A;  4BSQ A;  5J94 A;  1VSN A;  5JA7 A;  3WXE A;  4OEL A;  2DCC A;  4YYV A;  2HXZ A;  2R9M A;  1F29 A;  1KHP A;  1QDQ A;  3IEJ A;  2AUX A;  3RVX A;  1ICF A;  1GLO A;  2DJF B;  1U5I A;  1DF0 A;  4MSX A;  4PP2 E;  4CDD B;  2ARY A;  1TU6 A;  3RVV A;  4FK5 A;  2FO5 A;  1MEG A;  3H89 A;  3WXG A;  1PPO A;  4QH6 A;  1VJV A;  1K3B B;  3MHH A;  2H7J A;  4W5B A;  5CHT A;  3HHA A;  3KW9 A;  4BS6 A;  1KHQ A;  1YK7 A;  4RY2 A;  4AXM A;  3V6E A;  2OUL A;  3K24 A;  1ZIV A;  2R9N A;  5F02 A;  2BDL A;  1Q6K A;  4XR7 A;  4P6E A;  4WA6 A;  3PNR A;  1EWL A;  2VHS A;  2YJC A;  1AU0 A;  3KWZ A;  1TLO A;  1F2C A;  2NQI A;  1PPN A;  4W4U A;  4DMX A;  1CS8 A;  5CVM A;  3NHE A;  2C0Y A;  5CHV A;  2AIM A;  2WBF X;  4CDC B;  4CDE B;  4MZO A;  1EF7 A;  2YJ9 A;  3LXS A;  4Q8H A;  3IOQ A;  1AIM A; 
#chains in the Genus database with same CATH topology
 2DC7 A;  3O65 A;  2AVW A;  1JQP A;  3E9S A;  1ME4 A;  4REZ A;  1XKG A;  1BP4 A;  1AYW A;  3H8B A;  1PAD A;  3IHP A;  1PCI A;  3MP2 A;  2HD5 A;  4PT5 A;  1AYV A;  1DEU A;  3U8E A;  3DF0 A;  1QOL A;  3B79 A;  1CTE A;  4FJC A;  1BQI A;  4YYW A;  3RNV A;  2E00 A;  1MDW A;  3PT2 A;  3USV A;  3GCB A;  1PXV A;  1PIP A;  1AYU A;  3OVZ A;  4OVZ A;  5JZE A;  1PPP A;  3O0U A;  2B1N A;  4N79 A;  2P0R A;  2VHF A;  2E02 A;  1KXR A;  1PPD A;  4P16 A;  2B1M A;  4YYS A;  3HD3 A;  2HHN A;  6PAD A;  2PBH A;  2F7D A;  2J7Q A;  3BPF A;  1ME3 A;  2AYN A;  2E01 A;  3N3G A;  3MOR A;  1CJL A;  4KLB A;  5K16 A;  2PAD A;  3AI8 A;  2DZZ A;  1SNK A;  5KO3 A;  2JQG R;  4K7C A;  2FRA A;  2DC6 A;  3ZUA A;  3BOW A;  3OF9 A;  3KFQ A;  2GFO A;  1CB5 A;  5EZQ A;  2AGA A;  2DJG B;  1THE A;  3MTN A;  1AEC A;  3LFY A;  2DC9 A;  4ZUX U;  4MM3 B;  2AS8 A;  3K9M A;  5E6J A;  1YAL A;  1YT7 A;  4YYR A;  2NQG A;  3TRK A;  4QBB A;  2R9C A;  2NQA A;  4HWY A;  3RVW A;  2OZ2 A;  1CV8 A;  4XUI A;  4OW0 A;  4W5C A;  3PSE A;  3QT4 A;  2DOS A;  5CVO B;  3BWK A;  3N3K A;  3E1Z B;  2AUZ A;  9PAP A;  2XU1 A;  3BCN A;  2P7U A;  4RF1 A;  4IUM A;  1AU4 A;  2IPP B;  2CB5 A;  4QRX A;  1STF E;  1GMY A;  5CVN B;  5EGW A;  3TNX A;  4BS5 A;  1BGO A;  1Y4H A;  3OVX A;  1U9X A;  1UKF A;  2FRQ A;  1SP4 B;  3KWB X;  3CH3 X;  2G8J A;  5PAD A;  3V6C A;  1PBH A;  3IUT A;  1GEC E;  2AYO A;  2XU3 A;  4YYU A;  2E03 A;  4X6J A;  5EZS A;  3C9E A;  2G8E A;  3F75 A;  1NL6 A;  3D6S A;  5FPW A;  1EWP A;  1PE6 A;  3HHI A;  3IFU A;  4PI3 A;  4OVZ B;  3CH2 X;  3PDF A;  3H8C A;  1NB3 A;  3MHS A;  1KFU L;  2HH5 A;  1U9Q X;  4BOZ A;  4OEM A;  7PCK A;  3H6S A;  2G7Y A;  2CIO A;  2JTC A;  1YVB A;  4YV8 A;  2R9F A;  3P5W A;  3BB7 A;  3IMA A;  1ZCM A;  4BOS A;  1YZB A;  1ATK A;  1Y08 A;  3OIS A;  3WXF A;  2ATO A;  3KSE A;  4I04 A;  4CZW A;  3PHW A;  2XU5 A;  4M0W A;  2FE8 A;  3CBJ A;  1AU2 A;  1KFX L;  2F1G A;  4FIP A;  3N4C A;  1IWD A;  4RF0 A;  4PP1 A;  2YJ2 A;  2BDZ A;  1YK8 A;  2FTD A;  1CVZ A;  2J7Q C;  2NQD B;  3K8U A;  4XZX A;  1O0E A;  2OP3 A;  1FH0 A;  4MI7 A;  4IP3 A;  4I07 A;  4PAD A;  1NLJ A;  3I06 A;  4CDF B;  1POP A;  2Y5B A;  3BC3 A;  2FYE A;  1M6D A;  1QMY A;  4N8W A;  3KKU A;  2HWK A;  1MIR A;  1HUC B;  2DCA A;  1MS6 A;  4N4Z A;  3OF8 A;  2PRE A;  2PNS A;  3QSD A;  2DC8 A;  3PW3 A;  2P86 A;  4D8I A;  5JH3 A;  4HXD B;  4D8B A;  1BY8 A;  2ACT A;  1S4V A;  1CSB B;  1CPJ A;  3F5V A;  2JQF R;  2AU1 A;  3BPM A;  3O1G A;  3P5X A;  1MEM A;  1U9W A;  3S3Q A;  1F2B A;  4I05 A;  2IBI A;  4X6H A;  3P5V A;  3QJ3 A;  3MTV A;  4BOP A;  3W30 A;  3ERV A;  4BPV A;  8PCH A;  3H7D A;  1X9Y A;  2FQ9 A;  1GCB A;  4X6I A;  4RKX A;  1F2A A;  2FT2 A;  2GHU A;  4YYQ A;  2BTW A;  4DMY A;  1A6R A;  2DCD A;  2Z84 A;  2R6N A;  3M99 A;  4Q8G A;  4MZS A;  2O6X A;  2FUD A;  3CBK A;  4BQV A;  4QRG A;  1MHW A;  1PVJ A;  4YVA A;  1EWO A;  3S3R A;  2G6D A;  2Y6E A;  1NB5 A;  1CQD A;  2YJB A;  4P6G A;  3BY4 A;  2XU4 A;  3IV2 A;  4G54 A;  1EWM A;  2DCB A;  2R9O A;  1QXP A;  3PBH A;  4BOU A;  5EF4 A;  3I3T A;  1AU3 A;  1TL9 A;  3KX1 A;  2YJ8 A;  5A24 A;  3P5U A;  1NPZ A;  1NQC A;  3TMP A;  2DZY A;  1U9V A;  4QRV A;  4AXL A;  1ITO A;  3HWN A;  4BSQ A;  5J94 A;  1VSN A;  5JA7 A;  3PHU A;  3WXE A;  4OEL A;  2DCC A;  4YYV A;  2HXZ A;  4ZTB A;  2R9M A;  1F29 A;  3B21 A;  1KHP A;  1QDQ A;  3IEJ A;  2AUX A;  4A5U A;  3PHX A;  3RVX A;  1ICF A;  1GLO A;  2DJF B;  3BBA A;  1U5I A;  4GUA A;  3PRP A;  2JRI A;  1DF0 A;  4MSX A;  4PP2 E;  4CDD B;  3OQC A;  2ARY A;  1TU6 A;  2BU3 A;  3RVV A;  4FK5 A;  2FO5 A;  1MEG A;  3H89 A;  3MJ5 A;  3WXG A;  1PPO A;  3C0R A;  4QH6 A;  1VJV A;  1K3B B;  3MHH A;  2H7J A;  4W5B A;  5CHT A;  1DKI A;  3HHA A;  3KW9 A;  4BS6 A;  4R3D A;  1KHQ A;  1YK7 A;  2BTW B;  4RY2 A;  4AXM A;  3V6E A;  2OUL A;  3K24 A;  1ZIV A;  2R9N A;  5F02 A;  2BDL A;  1Q6K A;  3W31 A;  4XR7 A;  4P6E A;  4WA6 A;  3PNR A;  1EWL A;  4BOQ A;  2VHS A;  2YJC A;  1AU0 A;  3KWZ A;  1TLO A;  1F2C A;  3PRM A;  4RNA A;  2NQI A;  1PPN A;  4W4U A;  4DMX A;  3ZNH A;  1CS8 A;  5CVM A;  3NHE A;  2C0Y A;  5CHV A;  4WUR A;  2AIM A;  2WBF X;  4D8E A;  4CDC B;  4CDE B;  2UZJ A;  4MZO A;  1EF7 A;  2YJ9 A;  3LXS A;  4Q8H A;  3IOQ A;  1AIM A; 
#chains in the Genus database with same CATH homology
 2DC7 A;  2AVW A;  1JQP A;  1ME4 A;  1XKG A;  1BP4 A;  1AYW A;  3H8B A;  1PAD A;  3IHP A;  1PCI A;  2HD5 A;  1AYV A;  1DEU A;  3U8E A;  3DF0 A;  1QOL A;  3B79 A;  1CTE A;  4FJC A;  1BQI A;  4YYW A;  2E00 A;  1MDW A;  3USV A;  3GCB A;  3D9W A;  1PXV A;  1PIP A;  1AYU A;  3OVZ A;  1PPP A;  3O0U A;  2B1N A;  4N79 A;  2P0R A;  2VHF A;  2E02 A;  1KXR A;  1PPD A;  2B1M A;  4YYS A;  3HD3 A;  2HHN A;  6PAD A;  2PBH A;  2F7D A;  3BPF A;  1ME3 A;  2AYN A;  2E01 A;  3N3G A;  3MOR A;  1CJL A;  4KLB A;  5K16 A;  2PAD A;  3AI8 A;  2DZZ A;  1SNK A;  2JQG R;  4K7C A;  2FRA A;  2DC6 A;  3ZUA A;  3BOW A;  3OF9 A;  2GFO A;  3KFQ A;  1CB5 A;  2DJG B;  1THE A;  3MTN A;  1AEC A;  3LFY A;  2DC9 A;  4ZUX U;  2AS8 A;  3K9M A;  1YAL A;  1YT7 A;  4YYR A;  2NQG A;  4QBB A;  2R9C A;  2NQA A;  4HWY A;  3RVW A;  2OZ2 A;  1CV8 A;  4XUI A;  4W5C A;  3QT4 A;  5CVO B;  2VFC A;  3BWK A;  3N3K A;  3E1Z B;  2AUZ A;  9PAP A;  2XU1 A;  3BCN A;  2P7U A;  4NV7 A;  1AU4 A;  2IPP B;  2CB5 A;  4QRX A;  1STF E;  1GMY A;  2VFB A;  5CVN B;  5EGW A;  3TNX A;  4BS5 A;  1BGO A;  1Y4H A;  3OVX A;  1U9X A;  2FRQ A;  1E2T A;  1SP4 B;  3KWB X;  3CH3 X;  2G8J A;  5PAD A;  4BGF A;  3V6C A;  1PBH A;  3IUT A;  1GEC E;  2AYO A;  2XU3 A;  4YYU A;  2E03 A;  4X6J A;  3C9E A;  2G8E A;  3F75 A;  1NL6 A;  3D6S A;  5FPW A;  1EWP A;  1PE6 A;  3HHI A;  4PI3 A;  3CH2 X;  3PDF A;  3H8C A;  1NB3 A;  3MHS A;  1KFU L;  2HH5 A;  1U9Q X;  4C5P A;  4OEM A;  7PCK A;  3H6S A;  2G7Y A;  1GX3 A;  2CIO A;  1YVB A;  4YV8 A;  2R9F A;  3P5W A;  3IMA A;  1ZCM A;  1ATK A;  1Y08 A;  3OIS A;  3WXF A;  2BSZ A;  2ATO A;  3KSE A;  4I04 A;  4CZW A;  2XU5 A;  3CBJ A;  1AU2 A;  1KFX L;  2F1G A;  4FIP A;  3N4C A;  1IWD A;  4PP1 A;  2YJ2 A;  2BDZ A;  1YK8 A;  2FTD A;  1CVZ A;  2NQD B;  3K8U A;  1O0E A;  2OP3 A;  1FH0 A;  4I07 A;  4PAD A;  1NLJ A;  3I06 A;  4CDF B;  1POP A;  2Y5B A;  3BC3 A;  2FYE A;  1M6D A;  1QMY A;  4N8W A;  3KKU A;  1MIR A;  1HUC B;  2DCA A;  1MS6 A;  4N4Z A;  3OF8 A;  2PRE A;  4B55 A;  2PNS A;  3QSD A;  2DC8 A;  3PW3 A;  2P86 A;  5JH3 A;  1BY8 A;  2ACT A;  1S4V A;  1CSB B;  1CPJ A;  1W4T A;  3F5V A;  2JQF R;  2AU1 A;  3BPM A;  3O1G A;  3P5X A;  1MEM A;  1U9W A;  3S3Q A;  1F2B A;  4I05 A;  2IBI A;  4X6H A;  3P5V A;  3QJ3 A;  3ERV A;  4BPV A;  8PCH A;  3H7D A;  1X9Y A;  2FQ9 A;  1GCB A;  4X6I A;  1F2A A;  2FT2 A;  2GHU A;  4YYQ A;  4DMY A;  1A6R A;  2DCD A;  3LTW A;  2R6N A;  3M99 A;  4Q8G A;  4MZS A;  2O6X A;  2FUD A;  3CBK A;  4BQV A;  4QRG A;  4NV8 A;  1MHW A;  4YVA A;  1EWO A;  3S3R A;  2G6D A;  2Y6E A;  1NB5 A;  1CQD A;  2YJB A;  4P6G A;  2XU4 A;  3IV2 A;  4GUZ A;  4G54 A;  1EWM A;  2DCB A;  2R9O A;  1QXP A;  3PBH A;  5EF4 A;  3I3T A;  1AU3 A;  1TL9 A;  3KX1 A;  2YJ8 A;  5A24 A;  3P5U A;  1NPZ A;  1NQC A;  2DZY A;  1U9V A;  4QRV A;  4AXL A;  1ITO A;  3HWN A;  4BSQ A;  5J94 A;  1VSN A;  5JA7 A;  3WXE A;  4OEL A;  2DCC A;  4YYV A;  2HXZ A;  2R9M A;  1F29 A;  1KHP A;  1QDQ A;  3IEJ A;  2AUX A;  3RVX A;  1ICF A;  1GLO A;  1W5R A;  2DJF B;  1U5I A;  1DF0 A;  4MSX A;  4PP2 E;  4CDD B;  2ARY A;  1TU6 A;  3RVV A;  4FK5 A;  2FO5 A;  1MEG A;  3H89 A;  3WXG A;  1PPO A;  4QH6 A;  1VJV A;  1K3B B;  3MHH A;  2H7J A;  4W5B A;  5CHT A;  3HHA A;  3KW9 A;  4BS6 A;  1KHQ A;  1YK7 A;  4RY2 A;  4AXM A;  3V6E A;  2OUL A;  3K24 A;  1ZIV A;  2R9N A;  5F02 A;  2BDL A;  1Q6K A;  4XR7 A;  4P6E A;  4WA6 A;  3PNR A;  1EWL A;  2VHS A;  2YJC A;  1AU0 A;  3KWZ A;  1TLO A;  1F2C A;  2NQI A;  1PPN A;  4W4U A;  4DMX A;  1W6F A;  1CS8 A;  5CVM A;  3NHE A;  2C0Y A;  5CHV A;  2AIM A;  2WBF X;  4CDC B;  4CDE B;  4MZO A;  1EF7 A;  2YJ9 A;  3LXS A;  4Q8H A;  3IOQ A;  1AIM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...