2AVWA

Crystal structure of monoclinic form of streptococcus mac-1
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
290
structure length
290
Chain Sequence
VTSVWTKGVTPPANFTQGEDVFHAPYVANQGWYDITKTFNGKDDLLAGAATAGNMLHWWFDQNKDQIKRYLEEHPEKQKINFNGEQMFDVKEAIDTKNHQLDSKLFEYFKEKAFPYLSTKHLGVFPDHVIDMFINGYRLSLTNHGPTPVKEGSKDPRGGIFDAVFTRGDQSKLLTSRHDFKEKNLKEISDLIKKELTEGKALGLSHTYANVRINHVINLWGADFDSNGNLKAIYVTDSDSNASIGMKKYFVGVNSAGKVAISAKEIKEDNIGAQVLGLFTLSTGQDSWNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords IgG-degrading protease
publication title Crystal structure of group a streptococcus mac-1: insight into dimer-mediated specificity for recognition of human IgG.
pubmed doi rcsb
source organism Streptococcus pyogenes
total genus 82
structure length 290
sequence length 290
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2avwA01
1NLJA 2P0RA 4MZOA 2AIMA 3H7DA 2ATOA 3LXSA 4QBBA 4P6EA 4BQVA 1KXRA 3WXGA 2DCAA 4YYWA 1AECA 1THEA 3GCBA 3WXFA 2PREA 6PADA 3M99A 1NB3A 5A24A 1S4VA 2JQGR 4CDFB 4HWYA 1PXVA 2B1NA 4K7CA 1PIPA 2DJFB 1AYVA 1AU4A 5CHVA 8PCHA 4XR7A 1CJLA 4RY2A 3N3GA 3RVWA 4FIPA 3ZUAA 3BPFA 2AU1A 3HWNA 4CZWA 2AS8A 2DCBA 4XUIA 2O6XA 2DZZA 1STFE 2JQFR 1U9WA 3IEJA 2DZYA 3P5VA 4X6JA 1PPNA 2CB5A 3KWBX 1VJVA 1MDWA 5EF4A 3BOWA 4QH6A 2E01A 2R9OA 3RVXA 2P7UA 2HD5A 3F5VA 2DCCA 4I04A 4N79A 2YJ8A 3PDFA 1AU2A 3PBHA 3OF9A 1QXPA 3S3RA 3S3QA 4YYSA 1O0EA 3ERVA 3MHHA 2DC6A 2HHNA 5CVMA 4BS6A 1U9QX 1MEGA 1NL6A 3QT4A 4PI3A 2OZ2A 1PPDA 3P5UA 1ME3A 1QDQA 1NQCA 4N4ZA 2PADA 4OEMA 1CPJA 4DMXA 3K8UA 4PADA 4YYRA 1ZCMA 3D6SA 4QRGA 4PP2E 2DC8A 3IMAA 2IBIA 2Y5BA 1YK7A 1QOLA 1GMYA 3V6CA 3KSEA 2P86A 4N8WA 1F2BA 1AU0A 3AI8A 3IOQA 1EWOA 2FTDA 1FH0A 4WA6A 3F75A 2ARYA 1CB5A 2OP3A 1KFXL 3O1GA 3OVZA 2BDLA 9PAPA 1GLOA 1QMYA 5PADA 3QJ3A 2F7DA 2XU3A 3BPMA 2E03A 3MORA 1A6RA 4X6HA 1XKGA 5K16A 2WBFX 3E1ZB 2G8EA 4QRXA 2FT2A 1BP4A 3KKUA 1CVZA 3B79A 2NQGA 5EGWA 1NB5A 1AYWA 1MIRA 2YJ9A 1MHWA 2FUDA 2YJCA 1YT7A 1CQDA 3H89A 1YK8A 2IPPB 1F2AA 2OULA 4KLBA 1X9YA 3I3TA 1VSNA 3N3KA 4QRVA 3CBJA 1M6DA 1GCBA 4BPVA 2FYEA 1Y08A 1KHPA 3NHEA 1AIMA 4BSQA 1GECE 4I07A 2DCDA 3H8CA 1EWMA 1Q6KA 5JH3A 3K24A 4I05A 2R9NA 4W5CA 2FRQA 1PPOA 5J94A 2VHSA 3KX1A 3OF8A 4Q8GA 1HUCB 1KHQA 2NQDB 1F2CA 4AXMA 1U5IA 5FPWA 2AVWA 2G7YA 3WXEA 4DMYA 2R9FA 5JA7A 3N4CA 2H7JA 3K9MA 3C9EA 3H6SA 3OVXA 2FO5A 5CHTA 4P6GA 3KFQA 3O0UA 3P5WA 3KW9A 4CDCB 2DJGB 2FQ9A 4FJCA 4Q8HA 3IV2A 1K3BB 1MEMA 3HHIA 4YYQA 2XU1A 4YVAA 1YALA 4ZUXU 3RVVA 1PBHA 3V6EA 2R6NA 2NQIA 2E02A 1CSBB 1EWLA 4W5BA 3QSDA 1SNKA 2E00A 4AXLA 3H8BA 1Y4HA 1BY8A 4YV8A 1PPPA 3CH3X 1IWDA 1CV8A 2G6DA 1POPA 2XU4A 1KFUL 1ZIVA 3KWZA 3MTNA 3PNRA 3I06A 3IHPA 5F02A 1EWPA 4MSXA 1CS8A 5CVOB 2AYOA 3PW3A 3LFYA 2VHFA 4CDDB 2Y6EA 4MZSA 2F1GA 2YJBA 5CVNB 1NPZA 1AYUA 4W4UA 2PNSA 3DF0A 2B1MA 1EF7A 2R9CA 4X6IA 4YYUA 2GHUA 1ITOA 1JQPA 1U9VA 4OELA 3USVA 2HXZA 1PCIA 3BWKA 3IUTA 4YYVA 2FRAA 2CIOA 3CH2X 1F29A 1ICFA 1ME4A 1TU6A 3HD3A 2DC9A 3U8EA 2G8JA 1DF0A 1SP4B 3MHSA 7PCKA 4BS5A 1PE6A 3TNXA 1BQIA 1TLOA 3P5XA 1U9XA 1DEUA 2BDZA 1PADA 1TL9A 2DC7A 2YJ2A 1AU3A 2AUZA 3CBKA 3HHAA 4G54A 1ATKA 2GFOA 4FK5A 2HH5A 3BCNA 2PBHA 1CTEA 2ACTA 1BGOA 2XU5A 2R9MA 2AYNA 3OISA 1YVBA 2NQAA 3BC3A 4CDEB 2C0YA 1MS6A 2AUXA 4PP1A
chains in the Genus database with same CATH superfamily
1NLJA 2P0RA 4MZOA 2AIMA 3H7DA 2ATOA 3LXSA 4QBBA 4P6EA 4BQVA 1KXRA 3WXGA 4MM3B 2DCAA 4YYWA 1AECA 1THEA 3GCBA 3WXFA 2PREA 6PADA 3M99A 1NB3A 5A24A 1S4VA 2JQGR 4CDFB 4HWYA 1PXVA 2B1NA 4K7CA 1PIPA 2DJFB 1AYVA 1AU4A 5CHVA 4M0WA 8PCHA 4XR7A 1CJLA 4RY2A 3N3GA 3RVWA 4BOPA 4FIPA 3ZUAA 3BPFA 2AU1A 3HWNA 4CZWA 3C0RA 2AS8A 2DCBA 4XUIA 2O6XA 2DZZA 1STFE 2JQFR 1U9WA 3IEJA 2DZYA 3P5VA 4X6JA 3BY4A 1PPNA 2CB5A 3KWBX 1VJVA 1MDWA 5EF4A 4MI7A 3BOWA 4QH6A 2E01A 2R9OA 3RVXA 2P7UA 2HD5A 3F5VA 2DCCA 4I04A 4N79A 2YJ8A 3PDFA 4BOZA 1AU2A 4RF1A 3PBHA 3OF9A 1QXPA 3S3RA 3S3QA 4YYSA 1O0EA 3ERVA 4RNAA 3MHHA 2DC6A 2HHNA 5CVMA 4BS6A 1U9QX 2JRIA 1MEGA 1NL6A 3QT4A 4PI3A 2OZ2A 1PPDA 3P5UA 1ME3A 1QDQA 1NQCA 4N4ZA 4REZA 2PADA 4OEMA 1CPJA 4DMXA 5E6JA 3K8UA 4PADA 4YYRA 1ZCMA 3D6SA 4QRGA 4PP2E 2DC8A 3IMAA 4D8BA 2IBIA 2Y5BA 1YK7A 1QOLA 1GMYA 3V6CA 3KSEA 2P86A 4N8WA 1F2BA 1YZBA 1AU0A 3AI8A 3IOQA 1EWOA 2FTDA 1FH0A 4WA6A 3F75A 2ARYA 1CB5A 2OP3A 1KFXL 3O1GA 3OVZA 2BDLA 9PAPA 1GLOA 1QMYA 5PADA 4R3DA 3QJ3A 2F7DA 3IFUA 2XU3A 3BPMA 2E03A 3MORA 4PT5A 1A6RA 4X6HA 3PRMA 3MTVA 1XKGA 5K16A 2JTCA 2WBFX 3E1ZB 2G8EA 4QRXA 2FT2A 4OVZA 3MP2A 1BP4A 3KKUA 1CVZA 3B79A 2NQGA 5EGWA 3PHUA 1NB5A 1AYWA 1MIRA 2YJ9A 1MHWA 2FUDA 2YJCA 1YT7A 1CQDA 3H89A 1YK8A 4IUMA 2IPPB 1F2AA 2OULA 4D8EA 4KLBA 4BOQA 2BTWB 1X9YA 3PT2A 3I3TA 1VSNA 3N3KA 4QRVA 5EZQA 3CBJA 2Z84A 3W30A 1M6DA 4P16A 1GCBA 4BPVA 2FYEA 3PHWA 1Y08A 1KHPA 3NHEA 1AIMA 4BSQA 1GECE 4I07A 2DCDA 3H8CA 1EWMA 1Q6KA 3B21A 3BB7A 5JH3A 3K24A 4I05A 2R9NA 4W5CA 2FRQA 1PPOA 4OW0A 5J94A 2VHSA 3KX1A 3OF8A 4Q8GA 1HUCB 1KHQA 3TMPA 2NQDB 1F2CA 4AXMA 1U5IA 5FPWA 2AVWA 2G7YA 3WXEA 4DMYA 2R9FA 5JA7A 3N4CA 2H7JA 4A5UA 4IP3A 3K9MA 3C9EA 3H6SA 3OVXA 2FO5A 5CHTA 4P6GA 3KFQA 3O0UA 3P5WA 3KW9A 2J7QA 2DJGB 4CDCB 2FQ9A 4RKXA 4FJCA 4D8IA 2BU3A 5KO3A 4Q8HA 3IV2A 1K3BB 1MEMA 3HHIA 3OQCA 4YYQA 2XU1A 4YVAA 1YALA 4ZUXU 3RVVA 1PBHA 3V6EA 2R6NA 2NQIA 2E02A 1CSBB 4BOUA 1EWLA 4W5BA 3QSDA 1SNKA 2E00A 4AXLA 3H8BA 1Y4HA 1BY8A 4YV8A 1PPPA 3CH3X 1IWDA 1CV8A 1UKFA 2G6DA 1POPA 2XU4A 1KFUL 1ZIVA 3KWZA 3MTNA 3PNRA 3I06A 3IHPA 3PSEA 5F02A 1EWPA 2AGAA 4MSXA 1CS8A 5CVOB 2AYOA 3O65A 4ZTBA 3PW3A 3LFYA 2VHFA 4CDDB 2Y6EA 4MZSA 2F1GA 2YJBA 5CVNB 5EZSA 1NPZA 1AYUA 4W4UA 2PNSA 3DF0A 2B1MA 1EF7A 2R9CA 4X6IA 4YYUA 2GHUA 1ITOA 1JQPA 1U9VA 3MJ5A 4OELA 3USVA 2HXZA 3E9SA 1PCIA 3BWKA 3IUTA 4YYVA 2FRAA 3TRKA 2CIOA 2HWKA 3CH2X 5JZEA 1F29A 1ICFA 1ME4A 1TU6A 4RF0A 3HD3A 2DC9A 3U8EA 2G8JA 2J7QC 1DF0A 1SP4B 3MHSA 7PCKA 4BS5A 1PE6A 3TNXA 1BQIA 1TLOA 3P5XA 1DKIA 4GUAA 1U9XA 1DEUA 2BDZA 1PADA 1TL9A 3BBAA 4XZXA 4HXDB 2DC7A 2YJ2A 1AU3A 2AUZA 3CBKA 3HHAA 4G54A 1ATKA 3PRPA 2GFOA 4OVZB 4FK5A 2DOSA 3W31A 2HH5A 3RNVA 2FE8A 3BCNA 4BOSA 3PHXA 2PBHA 1CTEA 2ACTA 1BGOA 2UZJA 3ZNHA 2XU5A 2R9MA 2AYNA 1PVJA 3OISA 1YVBA 4WURA 2NQAA 3BC3A 2BTWA 4CDEB 2C0YA 1MS6A 2AUXA 4PP1A
chains in the Genus database with same CATH topology
1NLJA 2P0RA 4MZOA 2AIMA 3H7DA 2ATOA 3LXSA 4QBBA 4P6EA 4BQVA 1KXRA 3WXGA 2DCAA 4YYWA 1AECA 1THEA 3GCBA 3WXFA 2PREA 6PADA 3M99A 1NB3A 5A24A 1S4VA 2JQGR 4CDFB 4HWYA 1PXVA 2B1NA 4K7CA 1PIPA 2DJFB 1AYVA 1AU4A 5CHVA 8PCHA 4XR7A 1CJLA 4RY2A 3N3GA 3RVWA 4FIPA 3ZUAA 3BPFA 2AU1A 3HWNA 4CZWA 2AS8A 2DCBA 4XUIA 2O6XA 2DZZA 1STFE 2JQFR 1U9WA 3IEJA 2DZYA 3P5VA 4GUZA 4X6JA 1PPNA 2CB5A 3KWBX 1VJVA 1MDWA 5EF4A 3BOWA 4QH6A 2E01A 2R9OA 3RVXA 2P7UA 2HD5A 3F5VA 2DCCA 4I04A 4N79A 2YJ8A 3PDFA 1AU2A 3PBHA 3OF9A 1QXPA 3S3RA 3S3QA 4YYSA 1O0EA 3ERVA 3MHHA 2DC6A 2VFCA 2HHNA 5CVMA 4BS6A 1U9QX 1MEGA 1NL6A 3QT4A 4PI3A 2OZ2A 1PPDA 3P5UA 1ME3A 1QDQA 1NQCA 4N4ZA 2PADA 4OEMA 1CPJA 4DMXA 3K8UA 4PADA 4YYRA 1ZCMA 3D6SA 4QRGA 4PP2E 2DC8A 3IMAA 2IBIA 2Y5BA 1YK7A 1QOLA 3D9WA 1GMYA 3V6CA 3KSEA 2P86A 4N8WA 1F2BA 1AU0A 3AI8A 3IOQA 1EWOA 2FTDA 1FH0A 4WA6A 3F75A 2ARYA 1CB5A 2OP3A 1KFXL 3O1GA 3OVZA 2BDLA 9PAPA 1GLOA 1GX3A 1QMYA 5PADA 3QJ3A 2F7DA 2XU3A 3BPMA 2E03A 3MORA 1A6RA 4X6HA 1XKGA 5K16A 2WBFX 3E1ZB 2G8EA 4QRXA 2FT2A 1BP4A 3KKUA 1CVZA 3B79A 2NQGA 5EGWA 1NB5A 1AYWA 1MIRA 2YJ9A 1MHWA 1W6FA 2FUDA 2YJCA 1YT7A 1CQDA 3H89A 1YK8A 2IPPB 1F2AA 2OULA 4KLBA 1X9YA 3I3TA 1VSNA 3N3KA 4QRVA 3CBJA 1M6DA 1GCBA 4BPVA 2FYEA 1Y08A 1KHPA 3NHEA 1AIMA 4BSQA 1GECE 4I07A 2VFBA 2DCDA 3H8CA 1EWMA 1Q6KA 5JH3A 3K24A 4I05A 2R9NA 4W5CA 2FRQA 1PPOA 5J94A 2VHSA 3KX1A 3OF8A 4Q8GA 1HUCB 1KHQA 2NQDB 1F2CA 4AXMA 1U5IA 5FPWA 2AVWA 2G7YA 3WXEA 4DMYA 2R9FA 5JA7A 3N4CA 2H7JA 3K9MA 3C9EA 3H6SA 3OVXA 2FO5A 5CHTA 4P6GA 3KFQA 3O0UA 3P5WA 3KW9A 4CDCB 2DJGB 2FQ9A 4FJCA 4Q8HA 3IV2A 1K3BB 1MEMA 3HHIA 4YYQA 2XU1A 4YVAA 1YALA 4ZUXU 3RVVA 1PBHA 3V6EA 2R6NA 1W5RA 2NQIA 2E02A 1CSBB 1EWLA 4W5BA 3QSDA 1SNKA 2E00A 4AXLA 3H8BA 1Y4HA 1BY8A 4YV8A 1PPPA 3CH3X 1IWDA 1CV8A 2G6DA 1POPA 2XU4A 1KFUL 1ZIVA 3KWZA 3MTNA 3PNRA 3I06A 3IHPA 4NV7A 5F02A 1EWPA 4BGFA 4MSXA 1CS8A 5CVOB 2AYOA 1W4TA 3PW3A 1E2TA 3LFYA 2VHFA 4CDDB 2Y6EA 4MZSA 2F1GA 2YJBA 5CVNB 1NPZA 1AYUA 4W4UA 2PNSA 3DF0A 4C5PA 2B1MA 1EF7A 2R9CA 4X6IA 4YYUA 2GHUA 1ITOA 1JQPA 1U9VA 4OELA 3USVA 4B55A 2HXZA 1PCIA 3BWKA 3IUTA 4YYVA 2FRAA 2CIOA 3CH2X 1F29A 1ICFA 1ME4A 1TU6A 3HD3A 2DC9A 3U8EA 4NV8A 2G8JA 1DF0A 1SP4B 3MHSA 7PCKA 4BS5A 1PE6A 3TNXA 1BQIA 1TLOA 3P5XA 1U9XA 1DEUA 2BDZA 1PADA 1TL9A 2DC7A 2YJ2A 1AU3A 2AUZA 3CBKA 3HHAA 4G54A 1ATKA 2GFOA 3LTWA 4FK5A 2BSZA 2HH5A 3BCNA 2PBHA 1CTEA 2ACTA 1BGOA 2XU5A 2R9MA 2AYNA 3OISA 1YVBA 2NQAA 3BC3A 4CDEB 2C0YA 1MS6A 2AUXA 4PP1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NLJ A;  2P0R A;  4MZO A;  2AIM A;  3H7D A;  2ATO A;  3LXS A;  4QBB A;  4P6E A;  4BQV A;  1KXR A;  3WXG A;  2DCA A;  4YYW A;  1AEC A;  1THE A;  3GCB A;  3WXF A;  2PRE A;  6PAD A;  3M99 A;  1NB3 A;  5A24 A;  1S4V A;  2JQG R;  4CDF B;  4HWY A;  1PXV A;  2B1N A;  4K7C A;  1PIP A;  2DJF B;  1AYV A;  1AU4 A;  5CHV A;  8PCH A;  4XR7 A;  1CJL A;  4RY2 A;  3N3G A;  3RVW A;  4FIP A;  3ZUA A;  3BPF A;  2AU1 A;  3HWN A;  4CZW A;  2AS8 A;  2DCB A;  4XUI A;  2O6X A;  2DZZ A;  1STF E;  2JQF R;  1U9W A;  3IEJ A;  2DZY A;  3P5V A;  4X6J A;  1PPN A;  2CB5 A;  3KWB X;  1VJV A;  1MDW A;  5EF4 A;  3BOW A;  4QH6 A;  2E01 A;  2R9O A;  3RVX A;  2P7U A;  2HD5 A;  3F5V A;  2DCC A;  4I04 A;  4N79 A;  2YJ8 A;  3PDF A;  1AU2 A;  3PBH A;  3OF9 A;  1QXP A;  3S3R A;  3S3Q A;  4YYS A;  1O0E A;  3ERV A;  3MHH A;  2DC6 A;  2HHN A;  5CVM A;  4BS6 A;  1U9Q X;  1MEG A;  1NL6 A;  3QT4 A;  4PI3 A;  2OZ2 A;  1PPD A;  3P5U A;  1ME3 A;  1QDQ A;  1NQC A;  4N4Z A;  2PAD A;  4OEM A;  1CPJ A;  4DMX A;  3K8U A;  4PAD A;  4YYR A;  1ZCM A;  3D6S A;  4QRG A;  4PP2 E;  2DC8 A;  3IMA A;  2IBI A;  2Y5B A;  1YK7 A;  1QOL A;  1GMY A;  3V6C A;  3KSE A;  2P86 A;  4N8W A;  1F2B A;  1AU0 A;  3AI8 A;  3IOQ A;  1EWO A;  2FTD A;  1FH0 A;  4WA6 A;  3F75 A;  2ARY A;  1CB5 A;  2OP3 A;  1KFX L;  3O1G A;  3OVZ A;  2BDL A;  9PAP A;  1GLO A;  1QMY A;  5PAD A;  3QJ3 A;  2F7D A;  2XU3 A;  3BPM A;  2E03 A;  3MOR A;  1A6R A;  4X6H A;  1XKG A;  5K16 A;  2WBF X;  3E1Z B;  2G8E A;  4QRX A;  2FT2 A;  1BP4 A;  3KKU A;  1CVZ A;  3B79 A;  2NQG A;  5EGW A;  1NB5 A;  1AYW A;  1MIR A;  2YJ9 A;  1MHW A;  2FUD A;  2YJC A;  1YT7 A;  1CQD A;  3H89 A;  1YK8 A;  2IPP B;  1F2A A;  2OUL A;  4KLB A;  1X9Y A;  3I3T A;  1VSN A;  3N3K A;  4QRV A;  3CBJ A;  1M6D A;  1GCB A;  4BPV A;  2FYE A;  1Y08 A;  1KHP A;  3NHE A;  1AIM A;  4BSQ A;  1GEC E;  4I07 A;  2DCD A;  3H8C A;  1EWM A;  1Q6K A;  5JH3 A;  3K24 A;  4I05 A;  2R9N A;  4W5C A;  2FRQ A;  1PPO A;  5J94 A;  2VHS A;  3KX1 A;  3OF8 A;  4Q8G A;  1HUC B;  1KHQ A;  2NQD B;  1F2C A;  4AXM A;  1U5I A;  5FPW A;  2AVW A;  2G7Y A;  3WXE A;  4DMY A;  2R9F A;  5JA7 A;  3N4C A;  2H7J A;  3K9M A;  3C9E A;  3H6S A;  3OVX A;  2FO5 A;  5CHT A;  4P6G A;  3KFQ A;  3O0U A;  3P5W A;  3KW9 A;  4CDC B;  2DJG B;  2FQ9 A;  4FJC A;  4Q8H A;  3IV2 A;  1K3B B;  1MEM A;  3HHI A;  4YYQ A;  2XU1 A;  4YVA A;  1YAL A;  4ZUX U;  3RVV A;  1PBH A;  3V6E A;  2R6N A;  2NQI A;  2E02 A;  1CSB B;  1EWL A;  4W5B A;  3QSD A;  1SNK A;  2E00 A;  4AXL A;  3H8B A;  1Y4H A;  1BY8 A;  4YV8 A;  1PPP A;  3CH3 X;  1IWD A;  1CV8 A;  2G6D A;  1POP A;  2XU4 A;  1KFU L;  1ZIV A;  3KWZ A;  3MTN A;  3PNR A;  3I06 A;  3IHP A;  5F02 A;  1EWP A;  4MSX A;  1CS8 A;  5CVO B;  2AYO A;  3PW3 A;  3LFY A;  2VHF A;  4CDD B;  2Y6E A;  4MZS A;  2F1G A;  2YJB A;  5CVN B;  1NPZ A;  1AYU A;  4W4U A;  2PNS A;  3DF0 A;  2B1M A;  1EF7 A;  2R9C A;  4X6I A;  4YYU A;  2GHU A;  1ITO A;  1JQP A;  1U9V A;  4OEL A;  3USV A;  2HXZ A;  1PCI A;  3BWK A;  3IUT A;  4YYV A;  2FRA A;  2CIO A;  3CH2 X;  1F29 A;  1ICF A;  1ME4 A;  1TU6 A;  3HD3 A;  2DC9 A;  3U8E A;  2G8J A;  1DF0 A;  1SP4 B;  3MHS A;  7PCK A;  4BS5 A;  1PE6 A;  3TNX A;  1BQI A;  1TLO A;  3P5X A;  1U9X A;  1DEU A;  2BDZ A;  1PAD A;  1TL9 A;  2DC7 A;  2YJ2 A;  1AU3 A;  2AUZ A;  3CBK A;  3HHA A;  4G54 A;  1ATK A;  2GFO A;  4FK5 A;  2HH5 A;  3BCN A;  2PBH A;  1CTE A;  2ACT A;  1BGO A;  2XU5 A;  2R9M A;  2AYN A;  3OIS A;  1YVB A;  2NQA A;  3BC3 A;  4CDE B;  2C0Y A;  1MS6 A;  2AUX A;  4PP1 A; 
#chains in the Genus database with same CATH topology
 1NLJ A;  2P0R A;  4MZO A;  2AIM A;  3H7D A;  2ATO A;  3LXS A;  4QBB A;  4P6E A;  4BQV A;  1KXR A;  3WXG A;  4MM3 B;  2DCA A;  4YYW A;  1AEC A;  1THE A;  3GCB A;  3WXF A;  2PRE A;  6PAD A;  3M99 A;  1NB3 A;  5A24 A;  1S4V A;  2JQG R;  4CDF B;  4HWY A;  1PXV A;  2B1N A;  4K7C A;  1PIP A;  2DJF B;  1AYV A;  1AU4 A;  5CHV A;  4M0W A;  8PCH A;  4XR7 A;  1CJL A;  4RY2 A;  3N3G A;  3RVW A;  4BOP A;  4FIP A;  3ZUA A;  3BPF A;  2AU1 A;  3HWN A;  4CZW A;  3C0R A;  2AS8 A;  2DCB A;  4XUI A;  2O6X A;  2DZZ A;  1STF E;  2JQF R;  1U9W A;  3IEJ A;  2DZY A;  3P5V A;  4X6J A;  3BY4 A;  1PPN A;  2CB5 A;  3KWB X;  1VJV A;  1MDW A;  5EF4 A;  4MI7 A;  3BOW A;  4QH6 A;  2E01 A;  2R9O A;  3RVX A;  2P7U A;  2HD5 A;  3F5V A;  2DCC A;  4I04 A;  4N79 A;  2YJ8 A;  3PDF A;  4BOZ A;  1AU2 A;  4RF1 A;  3PBH A;  3OF9 A;  1QXP A;  3S3R A;  3S3Q A;  4YYS A;  1O0E A;  3ERV A;  4RNA A;  3MHH A;  2DC6 A;  2HHN A;  5CVM A;  4BS6 A;  1U9Q X;  2JRI A;  1MEG A;  1NL6 A;  3QT4 A;  4PI3 A;  2OZ2 A;  1PPD A;  3P5U A;  1ME3 A;  1QDQ A;  1NQC A;  4N4Z A;  4REZ A;  2PAD A;  4OEM A;  1CPJ A;  4DMX A;  5E6J A;  3K8U A;  4PAD A;  4YYR A;  1ZCM A;  3D6S A;  4QRG A;  4PP2 E;  2DC8 A;  3IMA A;  4D8B A;  2IBI A;  2Y5B A;  1YK7 A;  1QOL A;  1GMY A;  3V6C A;  3KSE A;  2P86 A;  4N8W A;  1F2B A;  1YZB A;  1AU0 A;  3AI8 A;  3IOQ A;  1EWO A;  2FTD A;  1FH0 A;  4WA6 A;  3F75 A;  2ARY A;  1CB5 A;  2OP3 A;  1KFX L;  3O1G A;  3OVZ A;  2BDL A;  9PAP A;  1GLO A;  1QMY A;  5PAD A;  4R3D A;  3QJ3 A;  2F7D A;  3IFU A;  2XU3 A;  3BPM A;  2E03 A;  3MOR A;  4PT5 A;  1A6R A;  4X6H A;  3PRM A;  3MTV A;  1XKG A;  5K16 A;  2JTC A;  2WBF X;  3E1Z B;  2G8E A;  4QRX A;  2FT2 A;  4OVZ A;  3MP2 A;  1BP4 A;  3KKU A;  1CVZ A;  3B79 A;  2NQG A;  5EGW A;  3PHU A;  1NB5 A;  1AYW A;  1MIR A;  2YJ9 A;  1MHW A;  2FUD A;  2YJC A;  1YT7 A;  1CQD A;  3H89 A;  1YK8 A;  4IUM A;  2IPP B;  1F2A A;  2OUL A;  4D8E A;  4KLB A;  4BOQ A;  2BTW B;  1X9Y A;  3PT2 A;  3I3T A;  1VSN A;  3N3K A;  4QRV A;  5EZQ A;  3CBJ A;  2Z84 A;  3W30 A;  1M6D A;  4P16 A;  1GCB A;  4BPV A;  2FYE A;  3PHW A;  1Y08 A;  1KHP A;  3NHE A;  1AIM A;  4BSQ A;  1GEC E;  4I07 A;  2DCD A;  3H8C A;  1EWM A;  1Q6K A;  3B21 A;  3BB7 A;  5JH3 A;  3K24 A;  4I05 A;  2R9N A;  4W5C A;  2FRQ A;  1PPO A;  4OW0 A;  5J94 A;  2VHS A;  3KX1 A;  3OF8 A;  4Q8G A;  1HUC B;  1KHQ A;  3TMP A;  2NQD B;  1F2C A;  4AXM A;  1U5I A;  5FPW A;  2AVW A;  2G7Y A;  3WXE A;  4DMY A;  2R9F A;  5JA7 A;  3N4C A;  2H7J A;  4A5U A;  4IP3 A;  3K9M A;  3C9E A;  3H6S A;  3OVX A;  2FO5 A;  5CHT A;  4P6G A;  3KFQ A;  3O0U A;  3P5W A;  3KW9 A;  2J7Q A;  2DJG B;  4CDC B;  2FQ9 A;  4RKX A;  4FJC A;  4D8I A;  2BU3 A;  5KO3 A;  4Q8H A;  3IV2 A;  1K3B B;  1MEM A;  3HHI A;  3OQC A;  4YYQ A;  2XU1 A;  4YVA A;  1YAL A;  4ZUX U;  3RVV A;  1PBH A;  3V6E A;  2R6N A;  2NQI A;  2E02 A;  1CSB B;  4BOU A;  1EWL A;  4W5B A;  3QSD A;  1SNK A;  2E00 A;  4AXL A;  3H8B A;  1Y4H A;  1BY8 A;  4YV8 A;  1PPP A;  3CH3 X;  1IWD A;  1CV8 A;  1UKF A;  2G6D A;  1POP A;  2XU4 A;  1KFU L;  1ZIV A;  3KWZ A;  3MTN A;  3PNR A;  3I06 A;  3IHP A;  3PSE A;  5F02 A;  1EWP A;  2AGA A;  4MSX A;  1CS8 A;  5CVO B;  2AYO A;  3O65 A;  4ZTB A;  3PW3 A;  3LFY A;  2VHF A;  4CDD B;  2Y6E A;  4MZS A;  2F1G A;  2YJB A;  5CVN B;  5EZS A;  1NPZ A;  1AYU A;  4W4U A;  2PNS A;  3DF0 A;  2B1M A;  1EF7 A;  2R9C A;  4X6I A;  4YYU A;  2GHU A;  1ITO A;  1JQP A;  1U9V A;  3MJ5 A;  4OEL A;  3USV A;  2HXZ A;  3E9S A;  1PCI A;  3BWK A;  3IUT A;  4YYV A;  2FRA A;  3TRK A;  2CIO A;  2HWK A;  3CH2 X;  5JZE A;  1F29 A;  1ICF A;  1ME4 A;  1TU6 A;  4RF0 A;  3HD3 A;  2DC9 A;  3U8E A;  2G8J A;  2J7Q C;  1DF0 A;  1SP4 B;  3MHS A;  7PCK A;  4BS5 A;  1PE6 A;  3TNX A;  1BQI A;  1TLO A;  3P5X A;  1DKI A;  4GUA A;  1U9X A;  1DEU A;  2BDZ A;  1PAD A;  1TL9 A;  3BBA A;  4XZX A;  4HXD B;  2DC7 A;  2YJ2 A;  1AU3 A;  2AUZ A;  3CBK A;  3HHA A;  4G54 A;  1ATK A;  3PRP A;  2GFO A;  4OVZ B;  4FK5 A;  2DOS A;  3W31 A;  2HH5 A;  3RNV A;  2FE8 A;  3BCN A;  4BOS A;  3PHX A;  2PBH A;  1CTE A;  2ACT A;  1BGO A;  2UZJ A;  3ZNH A;  2XU5 A;  2R9M A;  2AYN A;  1PVJ A;  3OIS A;  1YVB A;  4WUR A;  2NQA A;  3BC3 A;  2BTW A;  4CDE B;  2C0Y A;  1MS6 A;  2AUX A;  4PP1 A; 
#chains in the Genus database with same CATH homology
 1NLJ A;  2P0R A;  4MZO A;  2AIM A;  3H7D A;  2ATO A;  3LXS A;  4QBB A;  4P6E A;  4BQV A;  1KXR A;  3WXG A;  2DCA A;  4YYW A;  1AEC A;  1THE A;  3GCB A;  3WXF A;  2PRE A;  6PAD A;  3M99 A;  1NB3 A;  5A24 A;  1S4V A;  2JQG R;  4CDF B;  4HWY A;  1PXV A;  2B1N A;  4K7C A;  1PIP A;  2DJF B;  1AYV A;  1AU4 A;  5CHV A;  8PCH A;  4XR7 A;  1CJL A;  4RY2 A;  3N3G A;  3RVW A;  4FIP A;  3ZUA A;  3BPF A;  2AU1 A;  3HWN A;  4CZW A;  2AS8 A;  2DCB A;  4XUI A;  2O6X A;  2DZZ A;  1STF E;  2JQF R;  1U9W A;  3IEJ A;  2DZY A;  3P5V A;  4GUZ A;  4X6J A;  1PPN A;  2CB5 A;  3KWB X;  1VJV A;  1MDW A;  5EF4 A;  3BOW A;  4QH6 A;  2E01 A;  2R9O A;  3RVX A;  2P7U A;  2HD5 A;  3F5V A;  2DCC A;  4I04 A;  4N79 A;  2YJ8 A;  3PDF A;  1AU2 A;  3PBH A;  3OF9 A;  1QXP A;  3S3R A;  3S3Q A;  4YYS A;  1O0E A;  3ERV A;  3MHH A;  2DC6 A;  2VFC A;  2HHN A;  5CVM A;  4BS6 A;  1U9Q X;  1MEG A;  1NL6 A;  3QT4 A;  4PI3 A;  2OZ2 A;  1PPD A;  3P5U A;  1ME3 A;  1QDQ A;  1NQC A;  4N4Z A;  2PAD A;  4OEM A;  1CPJ A;  4DMX A;  3K8U A;  4PAD A;  4YYR A;  1ZCM A;  3D6S A;  4QRG A;  4PP2 E;  2DC8 A;  3IMA A;  2IBI A;  2Y5B A;  1YK7 A;  1QOL A;  3D9W A;  1GMY A;  3V6C A;  3KSE A;  2P86 A;  4N8W A;  1F2B A;  1AU0 A;  3AI8 A;  3IOQ A;  1EWO A;  2FTD A;  1FH0 A;  4WA6 A;  3F75 A;  2ARY A;  1CB5 A;  2OP3 A;  1KFX L;  3O1G A;  3OVZ A;  2BDL A;  9PAP A;  1GLO A;  1GX3 A;  1QMY A;  5PAD A;  3QJ3 A;  2F7D A;  2XU3 A;  3BPM A;  2E03 A;  3MOR A;  1A6R A;  4X6H A;  1XKG A;  5K16 A;  2WBF X;  3E1Z B;  2G8E A;  4QRX A;  2FT2 A;  1BP4 A;  3KKU A;  1CVZ A;  3B79 A;  2NQG A;  5EGW A;  1NB5 A;  1AYW A;  1MIR A;  2YJ9 A;  1MHW A;  1W6F A;  2FUD A;  2YJC A;  1YT7 A;  1CQD A;  3H89 A;  1YK8 A;  2IPP B;  1F2A A;  2OUL A;  4KLB A;  1X9Y A;  3I3T A;  1VSN A;  3N3K A;  4QRV A;  3CBJ A;  1M6D A;  1GCB A;  4BPV A;  2FYE A;  1Y08 A;  1KHP A;  3NHE A;  1AIM A;  4BSQ A;  1GEC E;  4I07 A;  2VFB A;  2DCD A;  3H8C A;  1EWM A;  1Q6K A;  5JH3 A;  3K24 A;  4I05 A;  2R9N A;  4W5C A;  2FRQ A;  1PPO A;  5J94 A;  2VHS A;  3KX1 A;  3OF8 A;  4Q8G A;  1HUC B;  1KHQ A;  2NQD B;  1F2C A;  4AXM A;  1U5I A;  5FPW A;  2AVW A;  2G7Y A;  3WXE A;  4DMY A;  2R9F A;  5JA7 A;  3N4C A;  2H7J A;  3K9M A;  3C9E A;  3H6S A;  3OVX A;  2FO5 A;  5CHT A;  4P6G A;  3KFQ A;  3O0U A;  3P5W A;  3KW9 A;  4CDC B;  2DJG B;  2FQ9 A;  4FJC A;  4Q8H A;  3IV2 A;  1K3B B;  1MEM A;  3HHI A;  4YYQ A;  2XU1 A;  4YVA A;  1YAL A;  4ZUX U;  3RVV A;  1PBH A;  3V6E A;  2R6N A;  1W5R A;  2NQI A;  2E02 A;  1CSB B;  1EWL A;  4W5B A;  3QSD A;  1SNK A;  2E00 A;  4AXL A;  3H8B A;  1Y4H A;  1BY8 A;  4YV8 A;  1PPP A;  3CH3 X;  1IWD A;  1CV8 A;  2G6D A;  1POP A;  2XU4 A;  1KFU L;  1ZIV A;  3KWZ A;  3MTN A;  3PNR A;  3I06 A;  3IHP A;  4NV7 A;  5F02 A;  1EWP A;  4BGF A;  4MSX A;  1CS8 A;  5CVO B;  2AYO A;  1W4T A;  3PW3 A;  1E2T A;  3LFY A;  2VHF A;  4CDD B;  2Y6E A;  4MZS A;  2F1G A;  2YJB A;  5CVN B;  1NPZ A;  1AYU A;  4W4U A;  2PNS A;  3DF0 A;  4C5P A;  2B1M A;  1EF7 A;  2R9C A;  4X6I A;  4YYU A;  2GHU A;  1ITO A;  1JQP A;  1U9V A;  4OEL A;  3USV A;  4B55 A;  2HXZ A;  1PCI A;  3BWK A;  3IUT A;  4YYV A;  2FRA A;  2CIO A;  3CH2 X;  1F29 A;  1ICF A;  1ME4 A;  1TU6 A;  3HD3 A;  2DC9 A;  3U8E A;  4NV8 A;  2G8J A;  1DF0 A;  1SP4 B;  3MHS A;  7PCK A;  4BS5 A;  1PE6 A;  3TNX A;  1BQI A;  1TLO A;  3P5X A;  1U9X A;  1DEU A;  2BDZ A;  1PAD A;  1TL9 A;  2DC7 A;  2YJ2 A;  1AU3 A;  2AUZ A;  3CBK A;  3HHA A;  4G54 A;  1ATK A;  2GFO A;  3LTW A;  4FK5 A;  2BSZ A;  2HH5 A;  3BCN A;  2PBH A;  1CTE A;  2ACT A;  1BGO A;  2XU5 A;  2R9M A;  2AYN A;  3OIS A;  1YVB A;  2NQA A;  3BC3 A;  4CDE B;  2C0Y A;  1MS6 A;  2AUX A;  4PP1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...