1F2CA

Crystal structure analysis of cryzain bound to vinyl sulfone derived inhibitor (iv)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
215
structure length
215
Chain Sequence
APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQLDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CRUZAIN
publication title A target within the target: probing cruzain's P1' site to define structural determinants for the Chagas' disease protease.
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Hydrolase
total genus 64
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.51: Cruzipain.
pdb deposition date 2000-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1f2cA00
4X6JA 4PP2E 1CVZA 1TU6A 1PIPA 2YJBA 2BDLA 3LFYA 2P86A 1F29A 2DC6A 3IMAA 4W5BA 3WXEA 1AIMA 2R9NA 2HHNA 4BS5A 2Y6EA 4BS6A 1YT7A 2G7YA 3HHIA 4P6GA 2XU1A 2DZZA 4PI3A 2DZYA 2O6XA 2DC9A 3WXFA 4XR7A 3PNRA 2PADA 2FO5A 4HWYA 3TNXA 2PBHA 2FQ9A 3H8BA 3IV2A 1NQCA 3N3KA 3BPFA 1QXPA 1TLOA 1M6DA 2AVWA 1F2BA 4XUIA 1U9WA 1ZCMA 1GMYA 1CJLA 2YJCA 1EWOA 2VHSA 3E1ZB 4MZOA 2E00A 1U9XA 1JQPA 4PP1A 2YJ8A 3H6SA 3CH3X 4MSXA 5CHTA 1VSNA 3IHPA 2H7JA 4P6EA 4X6HA 5K16A 2DJFB 4N4ZA 3MHHA 3IEJA 3S3RA 4MZSA 1CV8A 3LXSA 2FYEA 1HUCB 2DCAA 1MHWA 2FTDA 1SP4B 2R9OA 4AXLA 2XU3A 3OF8A 1XKGA 2G6DA 5F02A 2AUZA 1ZIVA 1FH0A 3P5UA 1ME4A 1STFE 3RVXA 2AS8A 2NQGA 1PPPA 1NB3A 3KSEA 3BPMA 1GCBA 5JH3A 5CVNB 1PPDA 1BQIA 5FPWA 1CTEA 4CDCB 4CZWA 2GHUA 1KFUL 4YYRA 2XU4A 2ARYA 4G54A 4YYSA 1KFXL 5EGWA 3I3TA 2R9MA 1BP4A 4CDEB 1MEGA 3USVA 1BGOA 2F1GA 3PW3A 1A6RA 2R9CA 1MDWA 1AU2A 4KLBA 1PCIA 3I06A 2DCBA 3QSDA 1TL9A 3P5XA 2AYNA 2VHFA 3OISA 1MS6A 3P5VA 1QOLA 5A24A 1U9QX 1YK7A 1MIRA 1SNKA 4YYVA 3IUTA 3CH2X 2YJ2A 1YALA 3H89A 1POPA 1MEMA 2NQAA 3F75A 4I04A 4W4UA 1PPOA 1THEA 1AU4A 3HHAA 1EWPA 1AYVA 4K7CA 2G8JA 2AUXA 1O0EA 1EWLA 2AIMA 6PADA 1KHQA 2E01A 1PBHA 3M99A 2FRQA 4YYWA 4CDFB 1AYUA 3CBJA 1S4VA 1Y4HA 3KFQA 5PADA 2DC8A 1NPZA 3U8EA 1YVBA 4N8WA 1ATKA 1KXRA 4Q8HA 2BDZA 3QJ3A 2OP3A 1PXVA 3ERVA 3CBKA 2P0RA 2E03A 3C9EA 4YVAA 3MORA 4OEMA 3AI8A 2PNSA 3PBHA 2YJ9A 5CHVA 3RVVA 2ACTA 5EF4A 3D6SA 2ATOA 2E02A 1CB5A 1GECE 4X6IA 9PAPA 1K3BB 3IOQA 1ICFA 1PPNA 3QT4A 4DMYA 3PDFA 2DJGB 2IBIA 3KX1A 5J94A 4AXMA 3V6CA 1CQDA 2B1NA 1PADA 3MHSA 5JA7A 1U5IA 1KHPA 3H8CA 1CS8A 3K24A 2OZ2A 1Y08A 4RY2A 4ZUXU 2WBFX 2JQFR 3NHEA 3KWBX 3KWZA 1ITOA 4FIPA 1QDQA 1QMYA 2FT2A 1YK8A 2AYOA 3WXGA 2CIOA 3RVWA 3BCNA 3F5VA 4BSQA 1CSBB 2PREA 4W5CA 2F7DA 4YYUA 3B79A 2NQDB 2DC7A 2CB5A 4FJCA 8PCHA 3HD3A 1DEUA 2HD5A 1BY8A 2B1MA 3K9MA 4CDDB 1EF7A 3HWNA 4I05A 1F2CA 2GFOA 1AU0A 4QH6A 2Y5BA 2AU1A 3K8UA 3OF9A 3BOWA 3O0UA 2HH5A 1VJVA 3BWKA 3H7DA 2JQGR 4WA6A 4Q8GA 1IWDA 3GCBA 4QBBA 5CVOB 1GLOA 1AECA 2IPPB 2DCCA 4N79A 3KKUA 3S3QA 2HXZA 4I07A 2FUDA 2R9FA 3N3GA 4YV8A 7PCKA 3OVXA 4PADA 4QRGA 1U9VA 2DCDA 3DF0A 3P5WA 1Q6KA 4QRXA 2R6NA 2C0YA 3KW9A 1DF0A 4YYQA 2FRAA 3O1GA 2NQIA 3BC3A 1ME3A 4FK5A 3ZUAA 2P7UA 3V6EA 5CVMA 1NB5A 3OVZA 3MTNA 4BPVA 4DMXA 1EWMA 4OELA 1NLJA 3N4CA 1PE6A 1X9YA 1AU3A 1F2AA 1NL6A 2G8EA 4QRVA 2OULA 1CPJA 2XU5A 4BQVA 1AYWA
chains in the Genus database with same CATH superfamily
4X6JA 4PP2E 1CVZA 1TU6A 1PIPA 2YJBA 4BOUA 2BDLA 3LFYA 4OVZB 2P86A 4RF0A 1F29A 2DC6A 3IMAA 3W31A 4W5BA 3WXEA 1AIMA 2R9NA 2HHNA 4BS5A 2Y6EA 4BS6A 1YT7A 2G7YA 3HHIA 4P6GA 2XU1A 4PT5A 2DZZA 2DOSA 4PI3A 5KO3A 2AGAA 2DZYA 2O6XA 2DC9A 3WXFA 4XR7A 3PNRA 2PADA 2FO5A 4HWYA 3TNXA 2PBHA 4D8BA 2FQ9A 3H8BA 3IV2A 1NQCA 3N3KA 3BPFA 4XZXA 1QXPA 1TLOA 1M6DA 4OW0A 2AVWA 1F2BA 4XUIA 1U9WA 3PT2A 1ZCMA 1GMYA 1CJLA 2YJCA 1EWOA 2VHSA 3E1ZB 2UZJA 3PHXA 4MZOA 2E00A 1U9XA 1JQPA 5EZSA 4PP1A 2YJ8A 1UKFA 3H6SA 3CH3X 4MSXA 1PVJA 5CHTA 1VSNA 3IHPA 2H7JA 4P6EA 2J7QA 4X6HA 5K16A 2DJFB 4OVZA 4N4ZA 3MHHA 3IEJA 3S3RA 4MZSA 2Z84A 1CV8A 3LXSA 2FYEA 1HUCB 2DCAA 4HXDB 3C0RA 1MHWA 2FTDA 1SP4B 2R9OA 4AXLA 2XU3A 3OF8A 1XKGA 2G6DA 5F02A 2AUZA 1ZIVA 4IP3A 1FH0A 3P5UA 1ME4A 1STFE 3RVXA 2AS8A 2NQGA 4D8EA 1PPPA 1NB3A 3KSEA 3BPMA 4BOZA 1GCBA 5JH3A 5CVNB 1PPDA 1BQIA 3E9SA 4MM3B 5FPWA 1CTEA 4CDCB 4CZWA 2GHUA 1DKIA 1KFUL 4YYRA 3MJ5A 2JTCA 3PHWA 2XU4A 2ARYA 4G54A 4YYSA 1KFXL 5EGWA 5JZEA 3I3TA 2R9MA 1BP4A 4CDEB 1MEGA 3USVA 1BGOA 2F1GA 3B21A 3PW3A 1A6RA 2R9CA 1MDWA 1AU2A 4KLBA 1PCIA 3I06A 2DCBA 3QSDA 1TL9A 3P5XA 2AYNA 2VHFA 3OISA 1MS6A 3P5VA 1QOLA 5A24A 1U9QX 1YK7A 1MIRA 1SNKA 4YYVA 3IUTA 3CH2X 2YJ2A 1YALA 2BTWB 3H89A 1POPA 1MEMA 2NQAA 3F75A 4I04A 4W4UA 1PPOA 1THEA 1AU4A 3HHAA 1EWPA 3O65A 3BY4A 1AYVA 4K7CA 2G8JA 4GUAA 2AUXA 1O0EA 1EWLA 3PSEA 2AIMA 6PADA 1KHQA 2E01A 1PBHA 3M99A 2FRQA 4YYWA 3TMPA 4CDFB 1AYUA 3CBJA 1S4VA 1Y4HA 3KFQA 5PADA 2DC8A 1NPZA 3U8EA 1YVBA 4N8WA 1ATKA 4D8IA 1KXRA 4Q8HA 2BDZA 3QJ3A 2OP3A 1PXVA 3ERVA 3CBKA 2P0RA 2HWKA 3PHUA 2E03A 3BB7A 3C9EA 4YVAA 2J7QC 3W30A 3MORA 4OEMA 3AI8A 2PNSA 3PBHA 2YJ9A 5CHVA 3RVVA 4REZA 2ACTA 5EF4A 3D6SA 2ATOA 2E02A 1CB5A 1GECE 4X6IA 9PAPA 1K3BB 3IOQA 1ICFA 1PPNA 3QT4A 3ZNHA 4DMYA 2FE8A 3PDFA 2DJGB 2IBIA 3KX1A 5J94A 4AXMA 3V6CA 1CQDA 2B1NA 1PADA 3MHSA 5JA7A 1U5IA 1KHPA 3PRPA 2BTWA 5E6JA 3H8CA 1CS8A 3K24A 2OZ2A 2JRIA 4R3DA 1Y08A 3IFUA 4RY2A 4ZUXU 2WBFX 2JQFR 3NHEA 3KWBX 3KWZA 1ITOA 4FIPA 1QDQA 1QMYA 2FT2A 1YK8A 2AYOA 3WXGA 3MP2A 2CIOA 3RVWA 3BCNA 3F5VA 4ZTBA 4BSQA 1CSBB 2PREA 4W5CA 2F7DA 4YYUA 3B79A 2NQDB 2DC7A 2CB5A 4FJCA 8PCHA 3HD3A 1DEUA 2HD5A 3PRMA 1BY8A 2B1MA 3K9MA 4CDDB 1EF7A 5EZQA 3HWNA 4WURA 4I05A 1F2CA 2GFOA 1AU0A 4QH6A 2Y5BA 4RF1A 2AU1A 3K8UA 3OF9A 3BOWA 4BOPA 3O0UA 4A5UA 2HH5A 1VJVA 3BWKA 3H7DA 2JQGR 4WA6A 4RKXA 4Q8GA 1IWDA 3GCBA 4QBBA 5CVOB 1GLOA 1AECA 2IPPB 2DCCA 4N79A 3KKUA 3S3QA 2HXZA 4I07A 2FUDA 2R9FA 3RNVA 3N3GA 3TRKA 2BU3A 4IUMA 4MI7A 4YV8A 7PCKA 3MTVA 3OQCA 3OVXA 4PADA 4QRGA 4P16A 1YZBA 1U9VA 2DCDA 3DF0A 4M0WA 3P5WA 1Q6KA 4QRXA 2R6NA 2C0YA 3KW9A 1DF0A 4YYQA 2FRAA 3O1GA 2NQIA 3BC3A 1ME3A 4BOSA 4FK5A 3ZUAA 2P7UA 3V6EA 5CVMA 1NB5A 3OVZA 3MTNA 4BPVA 4RNAA 4DMXA 1EWMA 4BOQA 3BBAA 4OELA 1NLJA 3N4CA 1PE6A 1X9YA 1AU3A 1F2AA 1NL6A 2G8EA 4QRVA 2OULA 1CPJA 2XU5A 4BQVA 1AYWA
chains in the Genus database with same CATH topology
4X6JA 4PP2E 1CVZA 1TU6A 1PIPA 2YJBA 2BDLA 3LFYA 2P86A 4BGFA 1F29A 2DC6A 3IMAA 4W5BA 3WXEA 1AIMA 2R9NA 2HHNA 4BS5A 2Y6EA 4BS6A 1YT7A 2G7YA 3HHIA 4P6GA 2XU1A 2DZZA 4GUZA 4PI3A 2DZYA 2O6XA 2DC9A 3WXFA 4XR7A 3PNRA 2PADA 2FO5A 4HWYA 3TNXA 2PBHA 1E2TA 2FQ9A 3H8BA 3IV2A 1NQCA 3N3KA 3BPFA 1QXPA 1TLOA 1M6DA 2AVWA 1F2BA 4XUIA 1U9WA 1ZCMA 1GMYA 1CJLA 2YJCA 1EWOA 2VHSA 3E1ZB 4MZOA 2E00A 1U9XA 1JQPA 4PP1A 2YJ8A 3H6SA 1W5RA 3CH3X 4MSXA 5CHTA 1VSNA 3IHPA 2H7JA 4P6EA 4X6HA 5K16A 2DJFB 4N4ZA 3MHHA 3IEJA 3S3RA 4MZSA 1CV8A 3LXSA 2FYEA 1HUCB 2DCAA 1MHWA 3LTWA 2FTDA 1SP4B 2R9OA 4AXLA 2XU3A 3OF8A 1XKGA 2G6DA 5F02A 2AUZA 1ZIVA 2BSZA 1FH0A 3P5UA 1ME4A 1STFE 3RVXA 2AS8A 2NQGA 1PPPA 1W6FA 1NB3A 3KSEA 4NV8A 3BPMA 1GCBA 5JH3A 5CVNB 1PPDA 1BQIA 5FPWA 1CTEA 4CDCB 4CZWA 2GHUA 1KFUL 4YYRA 4B55A 2XU4A 2ARYA 4G54A 4YYSA 1KFXL 5EGWA 3I3TA 2R9MA 1BP4A 4CDEB 1MEGA 3USVA 1BGOA 2F1GA 3PW3A 1A6RA 2R9CA 1MDWA 1AU2A 4KLBA 1PCIA 3I06A 2DCBA 3QSDA 1TL9A 3P5XA 2AYNA 2VHFA 3OISA 1MS6A 3P5VA 1QOLA 5A24A 1U9QX 1YK7A 1MIRA 1SNKA 4YYVA 3IUTA 3CH2X 2YJ2A 1YALA 3H89A 1POPA 1MEMA 2NQAA 3F75A 4I04A 4W4UA 1PPOA 1THEA 1AU4A 3HHAA 1EWPA 1AYVA 4K7CA 2G8JA 2AUXA 4NV7A 1O0EA 1EWLA 2AIMA 6PADA 1KHQA 2E01A 1PBHA 3M99A 2FRQA 4YYWA 4CDFB 1AYUA 3CBJA 1S4VA 1Y4HA 3KFQA 5PADA 2DC8A 1NPZA 3U8EA 1YVBA 4N8WA 1ATKA 1KXRA 4Q8HA 2BDZA 3QJ3A 2OP3A 1PXVA 3ERVA 3CBKA 2P0RA 2E03A 3C9EA 4YVAA 3D9WA 3MORA 4OEMA 3AI8A 2PNSA 3PBHA 2YJ9A 5CHVA 3RVVA 2ACTA 5EF4A 3D6SA 2ATOA 2E02A 1CB5A 1GECE 4X6IA 9PAPA 1K3BB 3IOQA 1ICFA 1PPNA 3QT4A 4DMYA 3PDFA 2DJGB 2IBIA 3KX1A 5J94A 4AXMA 3V6CA 1CQDA 2B1NA 1PADA 3MHSA 5JA7A 1U5IA 1KHPA 3H8CA 1CS8A 3K24A 2OZ2A 1Y08A 4RY2A 4ZUXU 2WBFX 2JQFR 3NHEA 3KWBX 3KWZA 1ITOA 4FIPA 1QDQA 1QMYA 2FT2A 1YK8A 2AYOA 3WXGA 2VFCA 2CIOA 3RVWA 3BCNA 3F5VA 4BSQA 1CSBB 2PREA 4W5CA 2F7DA 4YYUA 3B79A 2NQDB 2DC7A 2CB5A 4FJCA 8PCHA 3HD3A 1DEUA 2HD5A 1BY8A 2B1MA 3K9MA 4CDDB 1EF7A 3HWNA 1GX3A 4I05A 1F2CA 1W4TA 2GFOA 1AU0A 4QH6A 2Y5BA 2AU1A 3K8UA 3OF9A 3BOWA 3O0UA 2HH5A 1VJVA 3BWKA 3H7DA 2JQGR 4WA6A 4Q8GA 1IWDA 3GCBA 4QBBA 5CVOB 1GLOA 1AECA 2IPPB 2DCCA 4N79A 3KKUA 3S3QA 2HXZA 4I07A 2FUDA 2R9FA 3N3GA 4YV8A 7PCKA 3OVXA 4PADA 4QRGA 1U9VA 2DCDA 3DF0A 3P5WA 1Q6KA 4QRXA 2R6NA 2C0YA 3KW9A 1DF0A 4YYQA 2FRAA 3O1GA 2NQIA 3BC3A 1ME3A 4FK5A 3ZUAA 2P7UA 3V6EA 5CVMA 1NB5A 3OVZA 3MTNA 4BPVA 4DMXA 1EWMA 4OELA 1NLJA 3N4CA 1PE6A 1X9YA 1AU3A 1F2AA 1NL6A 2G8EA 4QRVA 2OULA 1CPJA 2XU5A 4BQVA 1AYWA 4C5PA 2VFBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X6J A;  4PP2 E;  1CVZ A;  1TU6 A;  1PIP A;  2YJB A;  2BDL A;  3LFY A;  2P86 A;  1F29 A;  2DC6 A;  3IMA A;  4W5B A;  3WXE A;  1AIM A;  2R9N A;  2HHN A;  4BS5 A;  2Y6E A;  4BS6 A;  1YT7 A;  2G7Y A;  3HHI A;  4P6G A;  2XU1 A;  2DZZ A;  4PI3 A;  2DZY A;  2O6X A;  2DC9 A;  3WXF A;  4XR7 A;  3PNR A;  2PAD A;  2FO5 A;  4HWY A;  3TNX A;  2PBH A;  2FQ9 A;  3H8B A;  3IV2 A;  1NQC A;  3N3K A;  3BPF A;  1QXP A;  1TLO A;  1M6D A;  2AVW A;  1F2B A;  4XUI A;  1U9W A;  1ZCM A;  1GMY A;  1CJL A;  2YJC A;  1EWO A;  2VHS A;  3E1Z B;  4MZO A;  2E00 A;  1U9X A;  1JQP A;  4PP1 A;  2YJ8 A;  3H6S A;  3CH3 X;  4MSX A;  5CHT A;  1VSN A;  3IHP A;  2H7J A;  4P6E A;  4X6H A;  5K16 A;  2DJF B;  4N4Z A;  3MHH A;  3IEJ A;  3S3R A;  4MZS A;  1CV8 A;  3LXS A;  2FYE A;  1HUC B;  2DCA A;  1MHW A;  2FTD A;  1SP4 B;  2R9O A;  4AXL A;  2XU3 A;  3OF8 A;  1XKG A;  2G6D A;  5F02 A;  2AUZ A;  1ZIV A;  1FH0 A;  3P5U A;  1ME4 A;  1STF E;  3RVX A;  2AS8 A;  2NQG A;  1PPP A;  1NB3 A;  3KSE A;  3BPM A;  1GCB A;  5JH3 A;  5CVN B;  1PPD A;  1BQI A;  5FPW A;  1CTE A;  4CDC B;  4CZW A;  2GHU A;  1KFU L;  4YYR A;  2XU4 A;  2ARY A;  4G54 A;  4YYS A;  1KFX L;  5EGW A;  3I3T A;  2R9M A;  1BP4 A;  4CDE B;  1MEG A;  3USV A;  1BGO A;  2F1G A;  3PW3 A;  1A6R A;  2R9C A;  1MDW A;  1AU2 A;  4KLB A;  1PCI A;  3I06 A;  2DCB A;  3QSD A;  1TL9 A;  3P5X A;  2AYN A;  2VHF A;  3OIS A;  1MS6 A;  3P5V A;  1QOL A;  5A24 A;  1U9Q X;  1YK7 A;  1MIR A;  1SNK A;  4YYV A;  3IUT A;  3CH2 X;  2YJ2 A;  1YAL A;  3H89 A;  1POP A;  1MEM A;  2NQA A;  3F75 A;  4I04 A;  4W4U A;  1PPO A;  1THE A;  1AU4 A;  3HHA A;  1EWP A;  1AYV A;  4K7C A;  2G8J A;  2AUX A;  1O0E A;  1EWL A;  2AIM A;  6PAD A;  1KHQ A;  2E01 A;  1PBH A;  3M99 A;  2FRQ A;  4YYW A;  4CDF B;  1AYU A;  3CBJ A;  1S4V A;  1Y4H A;  3KFQ A;  5PAD A;  2DC8 A;  1NPZ A;  3U8E A;  1YVB A;  4N8W A;  1ATK A;  1KXR A;  4Q8H A;  2BDZ A;  3QJ3 A;  2OP3 A;  1PXV A;  3ERV A;  3CBK A;  2P0R A;  2E03 A;  3C9E A;  4YVA A;  3MOR A;  4OEM A;  3AI8 A;  2PNS A;  3PBH A;  2YJ9 A;  5CHV A;  3RVV A;  2ACT A;  5EF4 A;  3D6S A;  2ATO A;  2E02 A;  1CB5 A;  1GEC E;  4X6I A;  9PAP A;  1K3B B;  3IOQ A;  1ICF A;  1PPN A;  3QT4 A;  4DMY A;  3PDF A;  2DJG B;  2IBI A;  3KX1 A;  5J94 A;  4AXM A;  3V6C A;  1CQD A;  2B1N A;  1PAD A;  3MHS A;  5JA7 A;  1U5I A;  1KHP A;  3H8C A;  1CS8 A;  3K24 A;  2OZ2 A;  1Y08 A;  4RY2 A;  4ZUX U;  2WBF X;  2JQF R;  3NHE A;  3KWB X;  3KWZ A;  1ITO A;  4FIP A;  1QDQ A;  1QMY A;  2FT2 A;  1YK8 A;  2AYO A;  3WXG A;  2CIO A;  3RVW A;  3BCN A;  3F5V A;  4BSQ A;  1CSB B;  2PRE A;  4W5C A;  2F7D A;  4YYU A;  3B79 A;  2NQD B;  2DC7 A;  2CB5 A;  4FJC A;  8PCH A;  3HD3 A;  1DEU A;  2HD5 A;  1BY8 A;  2B1M A;  3K9M A;  4CDD B;  1EF7 A;  3HWN A;  4I05 A;  1F2C A;  2GFO A;  1AU0 A;  4QH6 A;  2Y5B A;  2AU1 A;  3K8U A;  3OF9 A;  3BOW A;  3O0U A;  2HH5 A;  1VJV A;  3BWK A;  3H7D A;  2JQG R;  4WA6 A;  4Q8G A;  1IWD A;  3GCB A;  4QBB A;  5CVO B;  1GLO A;  1AEC A;  2IPP B;  2DCC A;  4N79 A;  3KKU A;  3S3Q A;  2HXZ A;  4I07 A;  2FUD A;  2R9F A;  3N3G A;  4YV8 A;  7PCK A;  3OVX A;  4PAD A;  4QRG A;  1U9V A;  2DCD A;  3DF0 A;  3P5W A;  1Q6K A;  4QRX A;  2R6N A;  2C0Y A;  3KW9 A;  1DF0 A;  4YYQ A;  2FRA A;  3O1G A;  2NQI A;  3BC3 A;  1ME3 A;  4FK5 A;  3ZUA A;  2P7U A;  3V6E A;  5CVM A;  1NB5 A;  3OVZ A;  3MTN A;  4BPV A;  4DMX A;  1EWM A;  4OEL A;  1NLJ A;  3N4C A;  1PE6 A;  1X9Y A;  1AU3 A;  1F2A A;  1NL6 A;  2G8E A;  4QRV A;  2OUL A;  1CPJ A;  2XU5 A;  4BQV A;  1AYW A; 
#chains in the Genus database with same CATH topology
 4X6J A;  4PP2 E;  1CVZ A;  1TU6 A;  1PIP A;  2YJB A;  4BOU A;  2BDL A;  3LFY A;  4OVZ B;  2P86 A;  4RF0 A;  1F29 A;  2DC6 A;  3IMA A;  3W31 A;  4W5B A;  3WXE A;  1AIM A;  2R9N A;  2HHN A;  4BS5 A;  2Y6E A;  4BS6 A;  1YT7 A;  2G7Y A;  3HHI A;  4P6G A;  2XU1 A;  4PT5 A;  2DZZ A;  2DOS A;  4PI3 A;  5KO3 A;  2AGA A;  2DZY A;  2O6X A;  2DC9 A;  3WXF A;  4XR7 A;  3PNR A;  2PAD A;  2FO5 A;  4HWY A;  3TNX A;  2PBH A;  4D8B A;  2FQ9 A;  3H8B A;  3IV2 A;  1NQC A;  3N3K A;  3BPF A;  4XZX A;  1QXP A;  1TLO A;  1M6D A;  4OW0 A;  2AVW A;  1F2B A;  4XUI A;  1U9W A;  3PT2 A;  1ZCM A;  1GMY A;  1CJL A;  2YJC A;  1EWO A;  2VHS A;  3E1Z B;  2UZJ A;  3PHX A;  4MZO A;  2E00 A;  1U9X A;  1JQP A;  5EZS A;  4PP1 A;  2YJ8 A;  1UKF A;  3H6S A;  3CH3 X;  4MSX A;  1PVJ A;  5CHT A;  1VSN A;  3IHP A;  2H7J A;  4P6E A;  2J7Q A;  4X6H A;  5K16 A;  2DJF B;  4OVZ A;  4N4Z A;  3MHH A;  3IEJ A;  3S3R A;  4MZS A;  2Z84 A;  1CV8 A;  3LXS A;  2FYE A;  1HUC B;  2DCA A;  4HXD B;  3C0R A;  1MHW A;  2FTD A;  1SP4 B;  2R9O A;  4AXL A;  2XU3 A;  3OF8 A;  1XKG A;  2G6D A;  5F02 A;  2AUZ A;  1ZIV A;  4IP3 A;  1FH0 A;  3P5U A;  1ME4 A;  1STF E;  3RVX A;  2AS8 A;  2NQG A;  4D8E A;  1PPP A;  1NB3 A;  3KSE A;  3BPM A;  4BOZ A;  1GCB A;  5JH3 A;  5CVN B;  1PPD A;  1BQI A;  3E9S A;  4MM3 B;  5FPW A;  1CTE A;  4CDC B;  4CZW A;  2GHU A;  1DKI A;  1KFU L;  4YYR A;  3MJ5 A;  2JTC A;  3PHW A;  2XU4 A;  2ARY A;  4G54 A;  4YYS A;  1KFX L;  5EGW A;  5JZE A;  3I3T A;  2R9M A;  1BP4 A;  4CDE B;  1MEG A;  3USV A;  1BGO A;  2F1G A;  3B21 A;  3PW3 A;  1A6R A;  2R9C A;  1MDW A;  1AU2 A;  4KLB A;  1PCI A;  3I06 A;  2DCB A;  3QSD A;  1TL9 A;  3P5X A;  2AYN A;  2VHF A;  3OIS A;  1MS6 A;  3P5V A;  1QOL A;  5A24 A;  1U9Q X;  1YK7 A;  1MIR A;  1SNK A;  4YYV A;  3IUT A;  3CH2 X;  2YJ2 A;  1YAL A;  2BTW B;  3H89 A;  1POP A;  1MEM A;  2NQA A;  3F75 A;  4I04 A;  4W4U A;  1PPO A;  1THE A;  1AU4 A;  3HHA A;  1EWP A;  3O65 A;  3BY4 A;  1AYV A;  4K7C A;  2G8J A;  4GUA A;  2AUX A;  1O0E A;  1EWL A;  3PSE A;  2AIM A;  6PAD A;  1KHQ A;  2E01 A;  1PBH A;  3M99 A;  2FRQ A;  4YYW A;  3TMP A;  4CDF B;  1AYU A;  3CBJ A;  1S4V A;  1Y4H A;  3KFQ A;  5PAD A;  2DC8 A;  1NPZ A;  3U8E A;  1YVB A;  4N8W A;  1ATK A;  4D8I A;  1KXR A;  4Q8H A;  2BDZ A;  3QJ3 A;  2OP3 A;  1PXV A;  3ERV A;  3CBK A;  2P0R A;  2HWK A;  3PHU A;  2E03 A;  3BB7 A;  3C9E A;  4YVA A;  2J7Q C;  3W30 A;  3MOR A;  4OEM A;  3AI8 A;  2PNS A;  3PBH A;  2YJ9 A;  5CHV A;  3RVV A;  4REZ A;  2ACT A;  5EF4 A;  3D6S A;  2ATO A;  2E02 A;  1CB5 A;  1GEC E;  4X6I A;  9PAP A;  1K3B B;  3IOQ A;  1ICF A;  1PPN A;  3QT4 A;  3ZNH A;  4DMY A;  2FE8 A;  3PDF A;  2DJG B;  2IBI A;  3KX1 A;  5J94 A;  4AXM A;  3V6C A;  1CQD A;  2B1N A;  1PAD A;  3MHS A;  5JA7 A;  1U5I A;  1KHP A;  3PRP A;  2BTW A;  5E6J A;  3H8C A;  1CS8 A;  3K24 A;  2OZ2 A;  2JRI A;  4R3D A;  1Y08 A;  3IFU A;  4RY2 A;  4ZUX U;  2WBF X;  2JQF R;  3NHE A;  3KWB X;  3KWZ A;  1ITO A;  4FIP A;  1QDQ A;  1QMY A;  2FT2 A;  1YK8 A;  2AYO A;  3WXG A;  3MP2 A;  2CIO A;  3RVW A;  3BCN A;  3F5V A;  4ZTB A;  4BSQ A;  1CSB B;  2PRE A;  4W5C A;  2F7D A;  4YYU A;  3B79 A;  2NQD B;  2DC7 A;  2CB5 A;  4FJC A;  8PCH A;  3HD3 A;  1DEU A;  2HD5 A;  3PRM A;  1BY8 A;  2B1M A;  3K9M A;  4CDD B;  1EF7 A;  5EZQ A;  3HWN A;  4WUR A;  4I05 A;  1F2C A;  2GFO A;  1AU0 A;  4QH6 A;  2Y5B A;  4RF1 A;  2AU1 A;  3K8U A;  3OF9 A;  3BOW A;  4BOP A;  3O0U A;  4A5U A;  2HH5 A;  1VJV A;  3BWK A;  3H7D A;  2JQG R;  4WA6 A;  4RKX A;  4Q8G A;  1IWD A;  3GCB A;  4QBB A;  5CVO B;  1GLO A;  1AEC A;  2IPP B;  2DCC A;  4N79 A;  3KKU A;  3S3Q A;  2HXZ A;  4I07 A;  2FUD A;  2R9F A;  3RNV A;  3N3G A;  3TRK A;  2BU3 A;  4IUM A;  4MI7 A;  4YV8 A;  7PCK A;  3MTV A;  3OQC A;  3OVX A;  4PAD A;  4QRG A;  4P16 A;  1YZB A;  1U9V A;  2DCD A;  3DF0 A;  4M0W A;  3P5W A;  1Q6K A;  4QRX A;  2R6N A;  2C0Y A;  3KW9 A;  1DF0 A;  4YYQ A;  2FRA A;  3O1G A;  2NQI A;  3BC3 A;  1ME3 A;  4BOS A;  4FK5 A;  3ZUA A;  2P7U A;  3V6E A;  5CVM A;  1NB5 A;  3OVZ A;  3MTN A;  4BPV A;  4RNA A;  4DMX A;  1EWM A;  4BOQ A;  3BBA A;  4OEL A;  1NLJ A;  3N4C A;  1PE6 A;  1X9Y A;  1AU3 A;  1F2A A;  1NL6 A;  2G8E A;  4QRV A;  2OUL A;  1CPJ A;  2XU5 A;  4BQV A;  1AYW A; 
#chains in the Genus database with same CATH homology
 4X6J A;  4PP2 E;  1CVZ A;  1TU6 A;  1PIP A;  2YJB A;  2BDL A;  3LFY A;  2P86 A;  4BGF A;  1F29 A;  2DC6 A;  3IMA A;  4W5B A;  3WXE A;  1AIM A;  2R9N A;  2HHN A;  4BS5 A;  2Y6E A;  4BS6 A;  1YT7 A;  2G7Y A;  3HHI A;  4P6G A;  2XU1 A;  2DZZ A;  4GUZ A;  4PI3 A;  2DZY A;  2O6X A;  2DC9 A;  3WXF A;  4XR7 A;  3PNR A;  2PAD A;  2FO5 A;  4HWY A;  3TNX A;  2PBH A;  1E2T A;  2FQ9 A;  3H8B A;  3IV2 A;  1NQC A;  3N3K A;  3BPF A;  1QXP A;  1TLO A;  1M6D A;  2AVW A;  1F2B A;  4XUI A;  1U9W A;  1ZCM A;  1GMY A;  1CJL A;  2YJC A;  1EWO A;  2VHS A;  3E1Z B;  4MZO A;  2E00 A;  1U9X A;  1JQP A;  4PP1 A;  2YJ8 A;  3H6S A;  1W5R A;  3CH3 X;  4MSX A;  5CHT A;  1VSN A;  3IHP A;  2H7J A;  4P6E A;  4X6H A;  5K16 A;  2DJF B;  4N4Z A;  3MHH A;  3IEJ A;  3S3R A;  4MZS A;  1CV8 A;  3LXS A;  2FYE A;  1HUC B;  2DCA A;  1MHW A;  3LTW A;  2FTD A;  1SP4 B;  2R9O A;  4AXL A;  2XU3 A;  3OF8 A;  1XKG A;  2G6D A;  5F02 A;  2AUZ A;  1ZIV A;  2BSZ A;  1FH0 A;  3P5U A;  1ME4 A;  1STF E;  3RVX A;  2AS8 A;  2NQG A;  1PPP A;  1W6F A;  1NB3 A;  3KSE A;  4NV8 A;  3BPM A;  1GCB A;  5JH3 A;  5CVN B;  1PPD A;  1BQI A;  5FPW A;  1CTE A;  4CDC B;  4CZW A;  2GHU A;  1KFU L;  4YYR A;  4B55 A;  2XU4 A;  2ARY A;  4G54 A;  4YYS A;  1KFX L;  5EGW A;  3I3T A;  2R9M A;  1BP4 A;  4CDE B;  1MEG A;  3USV A;  1BGO A;  2F1G A;  3PW3 A;  1A6R A;  2R9C A;  1MDW A;  1AU2 A;  4KLB A;  1PCI A;  3I06 A;  2DCB A;  3QSD A;  1TL9 A;  3P5X A;  2AYN A;  2VHF A;  3OIS A;  1MS6 A;  3P5V A;  1QOL A;  5A24 A;  1U9Q X;  1YK7 A;  1MIR A;  1SNK A;  4YYV A;  3IUT A;  3CH2 X;  2YJ2 A;  1YAL A;  3H89 A;  1POP A;  1MEM A;  2NQA A;  3F75 A;  4I04 A;  4W4U A;  1PPO A;  1THE A;  1AU4 A;  3HHA A;  1EWP A;  1AYV A;  4K7C A;  2G8J A;  2AUX A;  4NV7 A;  1O0E A;  1EWL A;  2AIM A;  6PAD A;  1KHQ A;  2E01 A;  1PBH A;  3M99 A;  2FRQ A;  4YYW A;  4CDF B;  1AYU A;  3CBJ A;  1S4V A;  1Y4H A;  3KFQ A;  5PAD A;  2DC8 A;  1NPZ A;  3U8E A;  1YVB A;  4N8W A;  1ATK A;  1KXR A;  4Q8H A;  2BDZ A;  3QJ3 A;  2OP3 A;  1PXV A;  3ERV A;  3CBK A;  2P0R A;  2E03 A;  3C9E A;  4YVA A;  3D9W A;  3MOR A;  4OEM A;  3AI8 A;  2PNS A;  3PBH A;  2YJ9 A;  5CHV A;  3RVV A;  2ACT A;  5EF4 A;  3D6S A;  2ATO A;  2E02 A;  1CB5 A;  1GEC E;  4X6I A;  9PAP A;  1K3B B;  3IOQ A;  1ICF A;  1PPN A;  3QT4 A;  4DMY A;  3PDF A;  2DJG B;  2IBI A;  3KX1 A;  5J94 A;  4AXM A;  3V6C A;  1CQD A;  2B1N A;  1PAD A;  3MHS A;  5JA7 A;  1U5I A;  1KHP A;  3H8C A;  1CS8 A;  3K24 A;  2OZ2 A;  1Y08 A;  4RY2 A;  4ZUX U;  2WBF X;  2JQF R;  3NHE A;  3KWB X;  3KWZ A;  1ITO A;  4FIP A;  1QDQ A;  1QMY A;  2FT2 A;  1YK8 A;  2AYO A;  3WXG A;  2VFC A;  2CIO A;  3RVW A;  3BCN A;  3F5V A;  4BSQ A;  1CSB B;  2PRE A;  4W5C A;  2F7D A;  4YYU A;  3B79 A;  2NQD B;  2DC7 A;  2CB5 A;  4FJC A;  8PCH A;  3HD3 A;  1DEU A;  2HD5 A;  1BY8 A;  2B1M A;  3K9M A;  4CDD B;  1EF7 A;  3HWN A;  1GX3 A;  4I05 A;  1F2C A;  1W4T A;  2GFO A;  1AU0 A;  4QH6 A;  2Y5B A;  2AU1 A;  3K8U A;  3OF9 A;  3BOW A;  3O0U A;  2HH5 A;  1VJV A;  3BWK A;  3H7D A;  2JQG R;  4WA6 A;  4Q8G A;  1IWD A;  3GCB A;  4QBB A;  5CVO B;  1GLO A;  1AEC A;  2IPP B;  2DCC A;  4N79 A;  3KKU A;  3S3Q A;  2HXZ A;  4I07 A;  2FUD A;  2R9F A;  3N3G A;  4YV8 A;  7PCK A;  3OVX A;  4PAD A;  4QRG A;  1U9V A;  2DCD A;  3DF0 A;  3P5W A;  1Q6K A;  4QRX A;  2R6N A;  2C0Y A;  3KW9 A;  1DF0 A;  4YYQ A;  2FRA A;  3O1G A;  2NQI A;  3BC3 A;  1ME3 A;  4FK5 A;  3ZUA A;  2P7U A;  3V6E A;  5CVM A;  1NB5 A;  3OVZ A;  3MTN A;  4BPV A;  4DMX A;  1EWM A;  4OEL A;  1NLJ A;  3N4C A;  1PE6 A;  1X9Y A;  1AU3 A;  1F2A A;  1NL6 A;  2G8E A;  4QRV A;  2OUL A;  1CPJ A;  2XU5 A;  4BQV A;  1AYW A;  4C5P A;  2VFB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...