1F2CA

Crystal structure analysis of cryzain bound to vinyl sulfone derived inhibitor (iv)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
215
structure length
215
Chain Sequence
b'APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQLDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CRUZAIN
publication title A target within the target: probing cruzain's P1' site to define structural determinants for the Chagas' disease protease.
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Hydrolase
total genus 64
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.51: Cruzipain.
pdb deposition date 2000-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1f2cA00
2XU5A 1SP4B 2GFOA 1U9XA 1PIPA 2E02A 3PNRA 1GECE 2FO5A 1CPJA 1CTEA 3QT4A 1PPOA 1MEMA 1PPNA 2F7DA 3AI8A 3O0UA 4QH6A 1EWMA 2G8EA 2DCBA 3TNXA 3H8CA 3MTNA 1ME4A 1MHWA 2FQ9A 4X6IA 2DCDA 2FUDA 2HXZA 1IWDA 4YYUA 2Y5BA 4ZUXU 2FT2A 3LXSA 2DC8A 2R9CA 2E01A 3D6SA 3H89A 1YVBA 2P86A 2YJ9A 2ACTA 4I05A 2IPPB 1CV8A 4P6EA 4W5BA 3KWZA 5JA7A 2YJ8A 4QRXA 3CH2X 2P7UA 2DZZA 1AIMA 4MSXA 5CHTA 3O1GA 1NL6A 2OZ2A 4AXMA 3CBJA 2HD5A 1PPDA 2G6DA 3BC3A 2O6XA 1X9YA 4XR7A 1ZCMA 2BDZA 4N4ZA 1AECA 1CSBB 1GCBA 2NQIA 3CBKA 3HHIA 2E00A 1STFE 1EWLA 4MZSA 3P5VA 5CHVA 4N79A 3I06A 3LFYA 3IOQA 5A24A 4YYVA 4BQVA 2AS8A 3BOWA 3IUTA 3OVZA 1PXVA 2P0RA 1KFXL 1CQDA 2NQDB 4DMYA 2R9NA 4FJCA 2H7JA 4PI3A 1AU4A 2R9MA 2R6NA 3USVA 1NB5A 3QJ3A 4X6JA 3KKUA 1QMYA 2YJBA 3V6CA 5EGWA 2FTDA 1BP4A 3WXFA 3GCBA 3BPMA 1MEGA 4RY2A 3WXGA 5CVNB 1PPPA 1VJVA 1POPA 4OEMA 1AU0A 3KFQA 3CH3X 5CVOB 3PW3A 2BDLA 2XU3A 3RVVA 2NQAA 2PREA 1U9VA 4XUIA 4YYWA 4OELA 4W5CA 4YYSA 1NB3A 1VSNA 3N4CA 1ATKA 4FIPA 1F29A 4BS5A 3E1ZB 3PBHA 5JH3A 2PNSA 2F1GA 3U8EA 3HWNA 2YJ2A 1SNKA 2XU4A 1F2AA 3HHAA 3KW9A 3ZUAA 1MIRA 3MORA 2R9FA 4PP2E 3OF9A 4QBBA 3OISA 1GLOA 2IBIA 1FH0A 1HUCB 4CZWA 3K24A 1F2CA 1NQCA 5EF4A 4DMXA 1MDWA 5J94A 4X6HA 3KSEA 1A6RA 1TLOA 1ICFA 1ITOA 5FPWA 4CDFB 3WXEA 3BWKA 1PBHA 3RVXA 2PBHA 2DC9A 1U9WA 1NLJA 3N3GA 2G8JA 2ATOA 1XKGA 1EF7A 3M99A 1AU2A 1THEA 1PCIA 3OF8A 3H8BA 2VHSA 1BY8A 1JQPA 3KWBX 1O0EA 3F5VA 2C0YA 2OULA 1GMYA 1CVZA 4P6GA 2CIOA 2DCCA 4HWYA 2HH5A 1PADA 2Y6EA 1Y08A 1F2BA 3I3TA 4W4UA 2G7YA 2DC7A 2AYNA 4G54A 5K16A 3BPFA 2CB5A 4CDCB 1KXRA 1MS6A 2WBFX 4QRVA 1KHQA 3H6SA 3H7DA 1CS8A 3B79A 1CJLA 4MZOA 2AUXA 3S3RA 5F02A 4PADA 2FYEA 3IV2A 1BGOA 3BCNA 1AU3A 1U9QX 1YALA 2E03A 4BPVA 2JQGR 2AYOA 1M6DA 3ERVA 4BS6A 4YVAA 2FRQA 2FRAA 5CVMA 5PADA 4Q8HA 1K3BB 1NPZA 3F75A 3IMAA 3NHEA 4YYRA 3K9MA 4BSQA 1DEUA 3P5UA 1YK8A 7PCKA 1Q6KA 3K8UA 3C9EA 4CDEB 3MHSA 3P5WA 4FK5A 4AXLA 2DJFB 1S4VA 2AUZA 9PAPA 1TU6A 4KLBA 3V6EA 1KHPA 3OVXA 1BQIA 4I04A 2DZYA 1U5IA 8PCHA 2DJGB 4PP1A 1Y4HA 2DC6A 2ARYA 3DF0A 1TL9A 2OP3A 3N3KA 2JQFR 2VHFA 2R9OA 3IEJA 4N8WA 4YV8A 3HD3A 1YK7A 2YJCA 2AU1A 2AIMA 4Q8GA 1DF0A 3PDFA 3RVWA 4WA6A 2PADA 1ZIVA 1AYVA 1QOLA 3IHPA 6PADA 4CDDB 1QDQA 1AYWA 1QXPA 1EWPA 3P5XA 1PE6A 2B1NA 4K7CA 1AYUA 2AVWA 2DCAA 1YT7A 4I07A 2HHNA 2B1MA 3MHHA 2NQGA 4QRGA 3S3QA 1EWOA 3QSDA 1KFUL 1ME3A 1CB5A 2GHUA 2XU1A 4YYQA 3KX1A
chains in the Genus database with same CATH superfamily
2XU5A 1SP4B 2GFOA 3PHWA 1U9XA 1PIPA 2E02A 3PNRA 3BBAA 1GECE 2FO5A 1CPJA 1CTEA 3BY4A 3QT4A 1PPOA 1MEMA 1PPNA 2F7DA 3AI8A 3O0UA 4QH6A 1EWMA 3MP2A 2DOSA 2G8EA 2DCBA 3E9SA 3TNXA 3H8CA 3MTNA 1ME4A 1MHWA 2FQ9A 4X6IA 2DCDA 2FUDA 2HXZA 1IWDA 4YYUA 2Y5BA 4ZUXU 2FT2A 3LXSA 2DC8A 2R9CA 2E01A 4BOQA 4D8IA 3D6SA 3H89A 1YVBA 2P86A 3PHXA 2YJ9A 2ACTA 4I05A 2IPPB 1CV8A 4P6EA 4W5BA 3KWZA 5JA7A 2YJ8A 4QRXA 3CH2X 2P7UA 2DZZA 1AIMA 4MSXA 5CHTA 3MJ5A 3O1GA 1NL6A 2OZ2A 3O65A 2HWKA 4AXMA 4P16A 3CBJA 2HD5A 1PPDA 2G6DA 3BC3A 2O6XA 1X9YA 4XR7A 1ZCMA 2BDZA 4ZTBA 4N4ZA 1AECA 4A5UA 1CSBB 1GCBA 2NQIA 3CBKA 3HHIA 2E00A 1STFE 1EWLA 4MZSA 3P5VA 5CHVA 4N79A 1PVJA 3I06A 3LFYA 3IOQA 5A24A 4YYVA 4BOZA 3B21A 4BQVA 2AS8A 2J7QC 3BOWA 3IUTA 4BOPA 3OVZA 1PXVA 2JRIA 2P0RA 1KFXL 5E6JA 1CQDA 2NQDB 3W30A 4RF1A 4DMYA 2R9NA 4FJCA 2H7JA 4PI3A 1AU4A 4OVZB 2R9MA 2R6NA 3USVA 1NB5A 3QJ3A 4X6JA 3KKUA 1QMYA 2YJBA 3V6CA 5EGWA 4IUMA 2FTDA 2BTWB 1BP4A 3WXFA 3GCBA 3BPMA 1MEGA 3C0RA 4RY2A 3WXGA 5CVNB 1PPPA 1VJVA 1POPA 2JTCA 4OEMA 1AU0A 3KFQA 4HXDB 3TMPA 3CH3X 5CVOB 3TRKA 3PW3A 2BDLA 2XU3A 3RVVA 2NQAA 2PREA 1U9VA 4XUIA 4YYWA 4OELA 2FE8A 4W5CA 3IFUA 4YYSA 4RF0A 1NB3A 4IP3A 1VSNA 3N4CA 1ATKA 4MM3B 4FIPA 1F29A 4BS5A 3PSEA 3E1ZB 3PBHA 4OW0A 5JH3A 2PNSA 2F1GA 3U8EA 3HWNA 2YJ2A 1SNKA 2XU4A 1F2AA 4REZA 3HHAA 3KW9A 3ZUAA 1MIRA 3MORA 2R9FA 4PP2E 3PRMA 3OF9A 4QBBA 4GUAA 3OISA 1GLOA 2IBIA 1FH0A 5EZSA 1HUCB 4CZWA 3K24A 1F2CA 1NQCA 5EF4A 4DMXA 1MDWA 5J94A 4X6HA 3KSEA 1A6RA 1TLOA 3PRPA 1ICFA 1ITOA 5FPWA 4CDFB 3WXEA 3BWKA 1PBHA 3RVXA 2PBHA 2DC9A 5EZQA 1U9WA 1NLJA 3N3GA 2G8JA 3PT2A 4BOUA 2ATOA 1XKGA 1EF7A 3M99A 1AU2A 2J7QA 1THEA 1PCIA 3OF8A 3H8BA 2VHSA 1BY8A 1JQPA 2Z84A 3KWBX 1O0EA 3F5VA 2C0YA 2OULA 1GMYA 1CVZA 4P6GA 2CIOA 2DCCA 4HWYA 2HH5A 3RNVA 1PADA 2Y6EA 1Y08A 1F2BA 3I3TA 4W4UA 2G7YA 4R3DA 2DC7A 2AYNA 4G54A 5K16A 3BPFA 2CB5A 4CDCB 1KXRA 1MS6A 2WBFX 4QRVA 1KHQA 3H6SA 3H7DA 2AGAA 1CS8A 3B79A 1CJLA 4MZOA 4D8EA 2AUXA 3S3RA 4MI7A 5F02A 4PADA 2FYEA 3IV2A 1BGOA 3BCNA 1AU3A 1U9QX 1YALA 2E03A 4BPVA 2JQGR 2AYOA 1M6DA 3ERVA 4BS6A 4YVAA 2FRQA 2FRAA 5CVMA 4OVZA 5PADA 4Q8HA 1K3BB 1NPZA 3PHUA 2BTWA 3F75A 3OQCA 3IMAA 3NHEA 4YYRA 3K9MA 4BSQA 1DEUA 3P5UA 1YK8A 7PCKA 1Q6KA 2BU3A 3K8UA 3C9EA 4CDEB 3MHSA 3P5WA 4FK5A 4AXLA 2DJFB 1DKIA 1S4VA 2AUZA 1UKFA 9PAPA 1TU6A 4KLBA 3V6EA 3MTVA 1KHPA 4PT5A 3OVXA 1BQIA 4RKXA 4I04A 2DZYA 1U5IA 8PCHA 2DJGB 4PP1A 1Y4HA 2DC6A 2ARYA 3DF0A 1TL9A 2OP3A 3N3KA 2JQFR 2VHFA 2R9OA 3BB7A 4XZXA 1YZBA 3IEJA 4N8WA 4YV8A 3HD3A 1YK7A 3W31A 2YJCA 2AU1A 4RNAA 2AIMA 4Q8GA 1DF0A 3PDFA 3RVWA 4D8BA 4WA6A 2PADA 1ZIVA 1AYVA 1QOLA 3IHPA 6PADA 4CDDB 1QDQA 1AYWA 1QXPA 1EWPA 3P5XA 1PE6A 4M0WA 2B1NA 4WURA 4K7CA 1AYUA 2AVWA 2DCAA 1YT7A 4I07A 5JZEA 2HHNA 2B1MA 3MHHA 2NQGA 4BOSA 4QRGA 3S3QA 3ZNHA 1EWOA 3QSDA 1KFUL 1ME3A 1CB5A 2GHUA 2UZJA 5KO3A 2XU1A 4YYQA 3KX1A
chains in the Genus database with same CATH topology
2XU5A 1SP4B 2GFOA 1U9XA 4BGFA 1PIPA 2E02A 3PNRA 1GECE 2FO5A 1CPJA 1CTEA 2VFBA 3QT4A 1PPOA 1MEMA 1PPNA 2F7DA 3AI8A 4NV7A 3O0UA 4QH6A 1EWMA 2G8EA 2DCBA 3TNXA 3H8CA 3MTNA 1ME4A 1MHWA 2FQ9A 4X6IA 2DCDA 2FUDA 2HXZA 1IWDA 4YYUA 2Y5BA 4ZUXU 2FT2A 3LXSA 2DC8A 2R9CA 2E01A 3D6SA 3H89A 1YVBA 2P86A 2YJ9A 2ACTA 4I05A 2IPPB 1CV8A 4P6EA 4W5BA 3KWZA 5JA7A 2YJ8A 4QRXA 3CH2X 2P7UA 2DZZA 1AIMA 4MSXA 5CHTA 3O1GA 1NL6A 2OZ2A 2VFCA 4AXMA 3CBJA 2HD5A 1PPDA 2G6DA 3BC3A 2O6XA 1X9YA 4XR7A 1ZCMA 2BDZA 4N4ZA 1AECA 1CSBB 1GCBA 2NQIA 3CBKA 3HHIA 2E00A 1STFE 1EWLA 4MZSA 3P5VA 5CHVA 4N79A 3I06A 3LFYA 3IOQA 5A24A 4YYVA 4BQVA 2AS8A 3BOWA 3IUTA 3OVZA 1PXVA 2P0RA 1KFXL 1CQDA 2NQDB 4DMYA 2R9NA 4FJCA 2H7JA 4PI3A 1AU4A 2R9MA 2R6NA 3USVA 1NB5A 3QJ3A 4X6JA 3KKUA 1QMYA 2YJBA 3V6CA 5EGWA 2FTDA 1BP4A 3WXFA 3GCBA 3BPMA 1MEGA 4RY2A 3WXGA 5CVNB 1PPPA 1VJVA 1POPA 1E2TA 4OEMA 1AU0A 3KFQA 3CH3X 5CVOB 3PW3A 2BDLA 2XU3A 4C5PA 3RVVA 2NQAA 2PREA 1U9VA 4XUIA 4YYWA 4OELA 4W5CA 4YYSA 1NB3A 1VSNA 3N4CA 1ATKA 4FIPA 1F29A 4BS5A 3E1ZB 3PBHA 5JH3A 2PNSA 2F1GA 3U8EA 3HWNA 2YJ2A 1SNKA 2XU4A 1F2AA 3HHAA 3KW9A 1GX3A 3ZUAA 1MIRA 3MORA 1W6FA 2R9FA 3LTWA 4PP2E 3OF9A 4QBBA 3OISA 1GLOA 2IBIA 1FH0A 1HUCB 4CZWA 3K24A 1F2CA 1NQCA 5EF4A 4DMXA 1MDWA 5J94A 4X6HA 3KSEA 1A6RA 1TLOA 1ICFA 1ITOA 5FPWA 4CDFB 3WXEA 3BWKA 1PBHA 3RVXA 2PBHA 2DC9A 1U9WA 1NLJA 3N3GA 2G8JA 2ATOA 1XKGA 1EF7A 3M99A 1AU2A 1THEA 1PCIA 3OF8A 3H8BA 2VHSA 1BY8A 1JQPA 3KWBX 1O0EA 3F5VA 2C0YA 2OULA 1GMYA 1CVZA 4P6GA 2CIOA 2DCCA 4HWYA 2HH5A 1PADA 2Y6EA 1Y08A 1F2BA 3I3TA 4W4UA 2G7YA 2DC7A 2AYNA 3D9WA 4G54A 5K16A 3BPFA 2CB5A 4CDCB 1KXRA 1MS6A 2WBFX 4NV8A 4QRVA 1KHQA 3H6SA 3H7DA 1CS8A 3B79A 1CJLA 4MZOA 2AUXA 3S3RA 5F02A 4PADA 1W5RA 2FYEA 3IV2A 1BGOA 3BCNA 1AU3A 1U9QX 1YALA 2E03A 4BPVA 2JQGR 2AYOA 1M6DA 3ERVA 4BS6A 4YVAA 2FRQA 2FRAA 5CVMA 5PADA 4Q8HA 1K3BB 1NPZA 3F75A 3IMAA 3NHEA 4YYRA 3K9MA 4BSQA 1DEUA 3P5UA 1YK8A 7PCKA 1Q6KA 4GUZA 3K8UA 3C9EA 4CDEB 3MHSA 3P5WA 4FK5A 4AXLA 2DJFB 1S4VA 2AUZA 9PAPA 1TU6A 4KLBA 3V6EA 1KHPA 3OVXA 1BQIA 2BSZA 4I04A 1W4TA 1U5IA 2DZYA 8PCHA 2DJGB 4PP1A 1Y4HA 2DC6A 2ARYA 3DF0A 1TL9A 2OP3A 3N3KA 2JQFR 2VHFA 2R9OA 3IEJA 4N8WA 4B55A 4YV8A 3HD3A 1YK7A 2YJCA 2AU1A 2AIMA 4Q8GA 1DF0A 3PDFA 3RVWA 4WA6A 2PADA 1ZIVA 1AYVA 1QOLA 3IHPA 6PADA 4CDDB 1QDQA 1AYWA 1QXPA 1EWPA 3P5XA 1PE6A 2B1NA 4K7CA 1AYUA 2AVWA 2DCAA 1YT7A 4I07A 2HHNA 2B1MA 3MHHA 2NQGA 4QRGA 3S3QA 1EWOA 3QSDA 1KFUL 1ME3A 1CB5A 2GHUA 2XU1A 4YYQA 3KX1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XU5 A;  1SP4 B;  2GFO A;  1U9X A;  1PIP A;  2E02 A;  3PNR A;  1GEC E;  2FO5 A;  1CPJ A;  1CTE A;  3QT4 A;  1PPO A;  1MEM A;  1PPN A;  2F7D A;  3AI8 A;  3O0U A;  4QH6 A;  1EWM A;  2G8E A;  2DCB A;  3TNX A;  3H8C A;  3MTN A;  1ME4 A;  1MHW A;  2FQ9 A;  4X6I A;  2DCD A;  2FUD A;  2HXZ A;  1IWD A;  4YYU A;  2Y5B A;  4ZUX U;  2FT2 A;  3LXS A;  2DC8 A;  2R9C A;  2E01 A;  3D6S A;  3H89 A;  1YVB A;  2P86 A;  2YJ9 A;  2ACT A;  4I05 A;  2IPP B;  1CV8 A;  4P6E A;  4W5B A;  3KWZ A;  5JA7 A;  2YJ8 A;  4QRX A;  3CH2 X;  2P7U A;  2DZZ A;  1AIM A;  4MSX A;  5CHT A;  3O1G A;  1NL6 A;  2OZ2 A;  4AXM A;  3CBJ A;  2HD5 A;  1PPD A;  2G6D A;  3BC3 A;  2O6X A;  1X9Y A;  4XR7 A;  1ZCM A;  2BDZ A;  4N4Z A;  1AEC A;  1CSB B;  1GCB A;  2NQI A;  3CBK A;  3HHI A;  2E00 A;  1STF E;  1EWL A;  4MZS A;  3P5V A;  5CHV A;  4N79 A;  3I06 A;  3LFY A;  3IOQ A;  5A24 A;  4YYV A;  4BQV A;  2AS8 A;  3BOW A;  3IUT A;  3OVZ A;  1PXV A;  2P0R A;  1KFX L;  1CQD A;  2NQD B;  4DMY A;  2R9N A;  4FJC A;  2H7J A;  4PI3 A;  1AU4 A;  2R9M A;  2R6N A;  3USV A;  1NB5 A;  3QJ3 A;  4X6J A;  3KKU A;  1QMY A;  2YJB A;  3V6C A;  5EGW A;  2FTD A;  1BP4 A;  3WXF A;  3GCB A;  3BPM A;  1MEG A;  4RY2 A;  3WXG A;  5CVN B;  1PPP A;  1VJV A;  1POP A;  4OEM A;  1AU0 A;  3KFQ A;  3CH3 X;  5CVO B;  3PW3 A;  2BDL A;  2XU3 A;  3RVV A;  2NQA A;  2PRE A;  1U9V A;  4XUI A;  4YYW A;  4OEL A;  4W5C A;  4YYS A;  1NB3 A;  1VSN A;  3N4C A;  1ATK A;  4FIP A;  1F29 A;  4BS5 A;  3E1Z B;  3PBH A;  5JH3 A;  2PNS A;  2F1G A;  3U8E A;  3HWN A;  2YJ2 A;  1SNK A;  2XU4 A;  1F2A A;  3HHA A;  3KW9 A;  3ZUA A;  1MIR A;  3MOR A;  2R9F A;  4PP2 E;  3OF9 A;  4QBB A;  3OIS A;  1GLO A;  2IBI A;  1FH0 A;  1HUC B;  4CZW A;  3K24 A;  1F2C A;  1NQC A;  5EF4 A;  4DMX A;  1MDW A;  5J94 A;  4X6H A;  3KSE A;  1A6R A;  1TLO A;  1ICF A;  1ITO A;  5FPW A;  4CDF B;  3WXE A;  3BWK A;  1PBH A;  3RVX A;  2PBH A;  2DC9 A;  1U9W A;  1NLJ A;  3N3G A;  2G8J A;  2ATO A;  1XKG A;  1EF7 A;  3M99 A;  1AU2 A;  1THE A;  1PCI A;  3OF8 A;  3H8B A;  2VHS A;  1BY8 A;  1JQP A;  3KWB X;  1O0E A;  3F5V A;  2C0Y A;  2OUL A;  1GMY A;  1CVZ A;  4P6G A;  2CIO A;  2DCC A;  4HWY A;  2HH5 A;  1PAD A;  2Y6E A;  1Y08 A;  1F2B A;  3I3T A;  4W4U A;  2G7Y A;  2DC7 A;  2AYN A;  4G54 A;  5K16 A;  3BPF A;  2CB5 A;  4CDC B;  1KXR A;  1MS6 A;  2WBF X;  4QRV A;  1KHQ A;  3H6S A;  3H7D A;  1CS8 A;  3B79 A;  1CJL A;  4MZO A;  2AUX A;  3S3R A;  5F02 A;  4PAD A;  2FYE A;  3IV2 A;  1BGO A;  3BCN A;  1AU3 A;  1U9Q X;  1YAL A;  2E03 A;  4BPV A;  2JQG R;  2AYO A;  1M6D A;  3ERV A;  4BS6 A;  4YVA A;  2FRQ A;  2FRA A;  5CVM A;  5PAD A;  4Q8H A;  1K3B B;  1NPZ A;  3F75 A;  3IMA A;  3NHE A;  4YYR A;  3K9M A;  4BSQ A;  1DEU A;  3P5U A;  1YK8 A;  7PCK A;  1Q6K A;  3K8U A;  3C9E A;  4CDE B;  3MHS A;  3P5W A;  4FK5 A;  4AXL A;  2DJF B;  1S4V A;  2AUZ A;  9PAP A;  1TU6 A;  4KLB A;  3V6E A;  1KHP A;  3OVX A;  1BQI A;  4I04 A;  2DZY A;  1U5I A;  8PCH A;  2DJG B;  4PP1 A;  1Y4H A;  2DC6 A;  2ARY A;  3DF0 A;  1TL9 A;  2OP3 A;  3N3K A;  2JQF R;  2VHF A;  2R9O A;  3IEJ A;  4N8W A;  4YV8 A;  3HD3 A;  1YK7 A;  2YJC A;  2AU1 A;  2AIM A;  4Q8G A;  1DF0 A;  3PDF A;  3RVW A;  4WA6 A;  2PAD A;  1ZIV A;  1AYV A;  1QOL A;  3IHP A;  6PAD A;  4CDD B;  1QDQ A;  1AYW A;  1QXP A;  1EWP A;  3P5X A;  1PE6 A;  2B1N A;  4K7C A;  1AYU A;  2AVW A;  2DCA A;  1YT7 A;  4I07 A;  2HHN A;  2B1M A;  3MHH A;  2NQG A;  4QRG A;  3S3Q A;  1EWO A;  3QSD A;  1KFU L;  1ME3 A;  1CB5 A;  2GHU A;  2XU1 A;  4YYQ A;  3KX1 A; 
#chains in the Genus database with same CATH topology
 2XU5 A;  1SP4 B;  2GFO A;  3PHW A;  1U9X A;  1PIP A;  2E02 A;  3PNR A;  3BBA A;  1GEC E;  2FO5 A;  1CPJ A;  1CTE A;  3BY4 A;  3QT4 A;  1PPO A;  1MEM A;  1PPN A;  2F7D A;  3AI8 A;  3O0U A;  4QH6 A;  1EWM A;  3MP2 A;  2DOS A;  2G8E A;  2DCB A;  3E9S A;  3TNX A;  3H8C A;  3MTN A;  1ME4 A;  1MHW A;  2FQ9 A;  4X6I A;  2DCD A;  2FUD A;  2HXZ A;  1IWD A;  4YYU A;  2Y5B A;  4ZUX U;  2FT2 A;  3LXS A;  2DC8 A;  2R9C A;  2E01 A;  4BOQ A;  4D8I A;  3D6S A;  3H89 A;  1YVB A;  2P86 A;  3PHX A;  2YJ9 A;  2ACT A;  4I05 A;  2IPP B;  1CV8 A;  4P6E A;  4W5B A;  3KWZ A;  5JA7 A;  2YJ8 A;  4QRX A;  3CH2 X;  2P7U A;  2DZZ A;  1AIM A;  4MSX A;  5CHT A;  3MJ5 A;  3O1G A;  1NL6 A;  2OZ2 A;  3O65 A;  2HWK A;  4AXM A;  4P16 A;  3CBJ A;  2HD5 A;  1PPD A;  2G6D A;  3BC3 A;  2O6X A;  1X9Y A;  4XR7 A;  1ZCM A;  2BDZ A;  4ZTB A;  4N4Z A;  1AEC A;  4A5U A;  1CSB B;  1GCB A;  2NQI A;  3CBK A;  3HHI A;  2E00 A;  1STF E;  1EWL A;  4MZS A;  3P5V A;  5CHV A;  4N79 A;  1PVJ A;  3I06 A;  3LFY A;  3IOQ A;  5A24 A;  4YYV A;  4BOZ A;  3B21 A;  4BQV A;  2AS8 A;  2J7Q C;  3BOW A;  3IUT A;  4BOP A;  3OVZ A;  1PXV A;  2JRI A;  2P0R A;  1KFX L;  5E6J A;  1CQD A;  2NQD B;  3W30 A;  4RF1 A;  4DMY A;  2R9N A;  4FJC A;  2H7J A;  4PI3 A;  1AU4 A;  4OVZ B;  2R9M A;  2R6N A;  3USV A;  1NB5 A;  3QJ3 A;  4X6J A;  3KKU A;  1QMY A;  2YJB A;  3V6C A;  5EGW A;  4IUM A;  2FTD A;  2BTW B;  1BP4 A;  3WXF A;  3GCB A;  3BPM A;  1MEG A;  3C0R A;  4RY2 A;  3WXG A;  5CVN B;  1PPP A;  1VJV A;  1POP A;  2JTC A;  4OEM A;  1AU0 A;  3KFQ A;  4HXD B;  3TMP A;  3CH3 X;  5CVO B;  3TRK A;  3PW3 A;  2BDL A;  2XU3 A;  3RVV A;  2NQA A;  2PRE A;  1U9V A;  4XUI A;  4YYW A;  4OEL A;  2FE8 A;  4W5C A;  3IFU A;  4YYS A;  4RF0 A;  1NB3 A;  4IP3 A;  1VSN A;  3N4C A;  1ATK A;  4MM3 B;  4FIP A;  1F29 A;  4BS5 A;  3PSE A;  3E1Z B;  3PBH A;  4OW0 A;  5JH3 A;  2PNS A;  2F1G A;  3U8E A;  3HWN A;  2YJ2 A;  1SNK A;  2XU4 A;  1F2A A;  4REZ A;  3HHA A;  3KW9 A;  3ZUA A;  1MIR A;  3MOR A;  2R9F A;  4PP2 E;  3PRM A;  3OF9 A;  4QBB A;  4GUA A;  3OIS A;  1GLO A;  2IBI A;  1FH0 A;  5EZS A;  1HUC B;  4CZW A;  3K24 A;  1F2C A;  1NQC A;  5EF4 A;  4DMX A;  1MDW A;  5J94 A;  4X6H A;  3KSE A;  1A6R A;  1TLO A;  3PRP A;  1ICF A;  1ITO A;  5FPW A;  4CDF B;  3WXE A;  3BWK A;  1PBH A;  3RVX A;  2PBH A;  2DC9 A;  5EZQ A;  1U9W A;  1NLJ A;  3N3G A;  2G8J A;  3PT2 A;  4BOU A;  2ATO A;  1XKG A;  1EF7 A;  3M99 A;  1AU2 A;  2J7Q A;  1THE A;  1PCI A;  3OF8 A;  3H8B A;  2VHS A;  1BY8 A;  1JQP A;  2Z84 A;  3KWB X;  1O0E A;  3F5V A;  2C0Y A;  2OUL A;  1GMY A;  1CVZ A;  4P6G A;  2CIO A;  2DCC A;  4HWY A;  2HH5 A;  3RNV A;  1PAD A;  2Y6E A;  1Y08 A;  1F2B A;  3I3T A;  4W4U A;  2G7Y A;  4R3D A;  2DC7 A;  2AYN A;  4G54 A;  5K16 A;  3BPF A;  2CB5 A;  4CDC B;  1KXR A;  1MS6 A;  2WBF X;  4QRV A;  1KHQ A;  3H6S A;  3H7D A;  2AGA A;  1CS8 A;  3B79 A;  1CJL A;  4MZO A;  4D8E A;  2AUX A;  3S3R A;  4MI7 A;  5F02 A;  4PAD A;  2FYE A;  3IV2 A;  1BGO A;  3BCN A;  1AU3 A;  1U9Q X;  1YAL A;  2E03 A;  4BPV A;  2JQG R;  2AYO A;  1M6D A;  3ERV A;  4BS6 A;  4YVA A;  2FRQ A;  2FRA A;  5CVM A;  4OVZ A;  5PAD A;  4Q8H A;  1K3B B;  1NPZ A;  3PHU A;  2BTW A;  3F75 A;  3OQC A;  3IMA A;  3NHE A;  4YYR A;  3K9M A;  4BSQ A;  1DEU A;  3P5U A;  1YK8 A;  7PCK A;  1Q6K A;  2BU3 A;  3K8U A;  3C9E A;  4CDE B;  3MHS A;  3P5W A;  4FK5 A;  4AXL A;  2DJF B;  1DKI A;  1S4V A;  2AUZ A;  1UKF A;  9PAP A;  1TU6 A;  4KLB A;  3V6E A;  3MTV A;  1KHP A;  4PT5 A;  3OVX A;  1BQI A;  4RKX A;  4I04 A;  2DZY A;  1U5I A;  8PCH A;  2DJG B;  4PP1 A;  1Y4H A;  2DC6 A;  2ARY A;  3DF0 A;  1TL9 A;  2OP3 A;  3N3K A;  2JQF R;  2VHF A;  2R9O A;  3BB7 A;  4XZX A;  1YZB A;  3IEJ A;  4N8W A;  4YV8 A;  3HD3 A;  1YK7 A;  3W31 A;  2YJC A;  2AU1 A;  4RNA A;  2AIM A;  4Q8G A;  1DF0 A;  3PDF A;  3RVW A;  4D8B A;  4WA6 A;  2PAD A;  1ZIV A;  1AYV A;  1QOL A;  3IHP A;  6PAD A;  4CDD B;  1QDQ A;  1AYW A;  1QXP A;  1EWP A;  3P5X A;  1PE6 A;  4M0W A;  2B1N A;  4WUR A;  4K7C A;  1AYU A;  2AVW A;  2DCA A;  1YT7 A;  4I07 A;  5JZE A;  2HHN A;  2B1M A;  3MHH A;  2NQG A;  4BOS A;  4QRG A;  3S3Q A;  3ZNH A;  1EWO A;  3QSD A;  1KFU L;  1ME3 A;  1CB5 A;  2GHU A;  2UZJ A;  5KO3 A;  2XU1 A;  4YYQ A;  3KX1 A; 
#chains in the Genus database with same CATH homology
 2XU5 A;  1SP4 B;  2GFO A;  1U9X A;  4BGF A;  1PIP A;  2E02 A;  3PNR A;  1GEC E;  2FO5 A;  1CPJ A;  1CTE A;  2VFB A;  3QT4 A;  1PPO A;  1MEM A;  1PPN A;  2F7D A;  3AI8 A;  4NV7 A;  3O0U A;  4QH6 A;  1EWM A;  2G8E A;  2DCB A;  3TNX A;  3H8C A;  3MTN A;  1ME4 A;  1MHW A;  2FQ9 A;  4X6I A;  2DCD A;  2FUD A;  2HXZ A;  1IWD A;  4YYU A;  2Y5B A;  4ZUX U;  2FT2 A;  3LXS A;  2DC8 A;  2R9C A;  2E01 A;  3D6S A;  3H89 A;  1YVB A;  2P86 A;  2YJ9 A;  2ACT A;  4I05 A;  2IPP B;  1CV8 A;  4P6E A;  4W5B A;  3KWZ A;  5JA7 A;  2YJ8 A;  4QRX A;  3CH2 X;  2P7U A;  2DZZ A;  1AIM A;  4MSX A;  5CHT A;  3O1G A;  1NL6 A;  2OZ2 A;  2VFC A;  4AXM A;  3CBJ A;  2HD5 A;  1PPD A;  2G6D A;  3BC3 A;  2O6X A;  1X9Y A;  4XR7 A;  1ZCM A;  2BDZ A;  4N4Z A;  1AEC A;  1CSB B;  1GCB A;  2NQI A;  3CBK A;  3HHI A;  2E00 A;  1STF E;  1EWL A;  4MZS A;  3P5V A;  5CHV A;  4N79 A;  3I06 A;  3LFY A;  3IOQ A;  5A24 A;  4YYV A;  4BQV A;  2AS8 A;  3BOW A;  3IUT A;  3OVZ A;  1PXV A;  2P0R A;  1KFX L;  1CQD A;  2NQD B;  4DMY A;  2R9N A;  4FJC A;  2H7J A;  4PI3 A;  1AU4 A;  2R9M A;  2R6N A;  3USV A;  1NB5 A;  3QJ3 A;  4X6J A;  3KKU A;  1QMY A;  2YJB A;  3V6C A;  5EGW A;  2FTD A;  1BP4 A;  3WXF A;  3GCB A;  3BPM A;  1MEG A;  4RY2 A;  3WXG A;  5CVN B;  1PPP A;  1VJV A;  1POP A;  1E2T A;  4OEM A;  1AU0 A;  3KFQ A;  3CH3 X;  5CVO B;  3PW3 A;  2BDL A;  2XU3 A;  4C5P A;  3RVV A;  2NQA A;  2PRE A;  1U9V A;  4XUI A;  4YYW A;  4OEL A;  4W5C A;  4YYS A;  1NB3 A;  1VSN A;  3N4C A;  1ATK A;  4FIP A;  1F29 A;  4BS5 A;  3E1Z B;  3PBH A;  5JH3 A;  2PNS A;  2F1G A;  3U8E A;  3HWN A;  2YJ2 A;  1SNK A;  2XU4 A;  1F2A A;  3HHA A;  3KW9 A;  1GX3 A;  3ZUA A;  1MIR A;  3MOR A;  1W6F A;  2R9F A;  3LTW A;  4PP2 E;  3OF9 A;  4QBB A;  3OIS A;  1GLO A;  2IBI A;  1FH0 A;  1HUC B;  4CZW A;  3K24 A;  1F2C A;  1NQC A;  5EF4 A;  4DMX A;  1MDW A;  5J94 A;  4X6H A;  3KSE A;  1A6R A;  1TLO A;  1ICF A;  1ITO A;  5FPW A;  4CDF B;  3WXE A;  3BWK A;  1PBH A;  3RVX A;  2PBH A;  2DC9 A;  1U9W A;  1NLJ A;  3N3G A;  2G8J A;  2ATO A;  1XKG A;  1EF7 A;  3M99 A;  1AU2 A;  1THE A;  1PCI A;  3OF8 A;  3H8B A;  2VHS A;  1BY8 A;  1JQP A;  3KWB X;  1O0E A;  3F5V A;  2C0Y A;  2OUL A;  1GMY A;  1CVZ A;  4P6G A;  2CIO A;  2DCC A;  4HWY A;  2HH5 A;  1PAD A;  2Y6E A;  1Y08 A;  1F2B A;  3I3T A;  4W4U A;  2G7Y A;  2DC7 A;  2AYN A;  3D9W A;  4G54 A;  5K16 A;  3BPF A;  2CB5 A;  4CDC B;  1KXR A;  1MS6 A;  2WBF X;  4NV8 A;  4QRV A;  1KHQ A;  3H6S A;  3H7D A;  1CS8 A;  3B79 A;  1CJL A;  4MZO A;  2AUX A;  3S3R A;  5F02 A;  4PAD A;  1W5R A;  2FYE A;  3IV2 A;  1BGO A;  3BCN A;  1AU3 A;  1U9Q X;  1YAL A;  2E03 A;  4BPV A;  2JQG R;  2AYO A;  1M6D A;  3ERV A;  4BS6 A;  4YVA A;  2FRQ A;  2FRA A;  5CVM A;  5PAD A;  4Q8H A;  1K3B B;  1NPZ A;  3F75 A;  3IMA A;  3NHE A;  4YYR A;  3K9M A;  4BSQ A;  1DEU A;  3P5U A;  1YK8 A;  7PCK A;  1Q6K A;  4GUZ A;  3K8U A;  3C9E A;  4CDE B;  3MHS A;  3P5W A;  4FK5 A;  4AXL A;  2DJF B;  1S4V A;  2AUZ A;  9PAP A;  1TU6 A;  4KLB A;  3V6E A;  1KHP A;  3OVX A;  1BQI A;  2BSZ A;  4I04 A;  1W4T A;  1U5I A;  2DZY A;  8PCH A;  2DJG B;  4PP1 A;  1Y4H A;  2DC6 A;  2ARY A;  3DF0 A;  1TL9 A;  2OP3 A;  3N3K A;  2JQF R;  2VHF A;  2R9O A;  3IEJ A;  4N8W A;  4B55 A;  4YV8 A;  3HD3 A;  1YK7 A;  2YJC A;  2AU1 A;  2AIM A;  4Q8G A;  1DF0 A;  3PDF A;  3RVW A;  4WA6 A;  2PAD A;  1ZIV A;  1AYV A;  1QOL A;  3IHP A;  6PAD A;  4CDD B;  1QDQ A;  1AYW A;  1QXP A;  1EWP A;  3P5X A;  1PE6 A;  2B1N A;  4K7C A;  1AYU A;  2AVW A;  2DCA A;  1YT7 A;  4I07 A;  2HHN A;  2B1M A;  3MHH A;  2NQG A;  4QRG A;  3S3Q A;  1EWO A;  3QSD A;  1KFU L;  1ME3 A;  1CB5 A;  2GHU A;  2XU1 A;  4YYQ A;  3KX1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...