1F2CA

Crystal structure analysis of cryzain bound to vinyl sulfone derived inhibitor (iv)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
215
structure length
215
Chain Sequence
APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQLDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A target within the target: probing cruzain's P1' site to define structural determinants for the Chagas' disease protease.
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Hydrolase
molecule keywords CRUZAIN
total genus 64
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.51: Cruzipain.
pdb deposition date 2000-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1f2cA00
4K7CA 3CBKA 4DMXA 1AYVA 1F2CA 3KSEA 1AECA 2DC7A 2YJ8A 2F7DA 5JH3A 2E01A 1FH0A 1PADA 3I3TA 3BPMA 3V6EA 1KHQA 1KFUL 2AYNA 2AYOA 1QMYA 3P5VA 2NQDB 1ATKA 1KFXL 3H6SA 2NQAA 1EWOA 1QXPA 1TL9A 1YK7A 4KLBA 8PCHA 1AU3A 2FTDA 1F29A 5J94A 1AU0A 1JQPA 4BSQA 3BCNA 4W4UA 3IHPA 4XUIA 7PCKA 4CDDB 2H7JA 2DJFB 2YJCA 3OVZA 2HHNA 1NB3A 2B1MA 2FRAA 1M6DA 1TU6A 2G6DA 5A24A 4MZSA 3D6SA 3O1GA 2DJGB 5K16A 3H89A 4XR7A 1YVBA 2G8EA 3H8CA 1QDQA 1ZIVA 2NQIA 4OEMA 4X6IA 1U9QX 3K24A 2BDLA 4WA6A 4CDFB 3H8BA 3OF9A 3LXSA 1AIMA 3GCBA 4YYVA 5EF4A 4FK5A 3IUTA 4BS6A 3AI8A 3H7DA 4N79A 1QOLA 1AU4A 1CTEA 1PCIA 3K9MA 1Y4HA 2DCCA 4DMYA 1NLJA 2P7UA 4BS5A 4OELA 1PIPA 1BGOA 2JQFR 3QJ3A 2ACTA 1BQIA 2AVWA 1VJVA 4CDEB 1KXRA 1STFE 1Y08A 2Y5BA 4MSXA 2XU3A 2CIOA 3HD3A 2AU1A 9PAPA 3F5VA 3N4CA 1S4VA 1ME4A 3ERVA 1VSNA 3IOQA 5CVMA 4AXLA 2R9NA 1MHWA 1YALA 1NB5A 1AYUA 3KFQA 1CQDA 2WBFX 3BOWA 1O0EA 2E00A 1SNKA 2AS8A 4PP2E 4P6EA 2OULA 1ME3A 2Y6EA 1ZCMA 2DZYA 3WXGA 5PADA 2C0YA 3F75A 4PI3A 3RVVA 1EWMA 1U5IA 3MHHA 2R6NA 1GECE 4I05A 3I06A 3HHIA 2B1NA 1MEGA 1PPDA 1THEA 3B79A 2FO5A 4I07A 1MEMA 2XU4A 4YYSA 1CSBB 2P86A 3QT4A 1NQCA 1TLOA 1YK8A 1NPZA 5CVNB 1PPOA 1POPA 1Q6KA 1ITOA 2G7YA 2FQ9A 2R9MA 2AIMA 1SP4B 4BQVA 2PNSA 2DZZA 2HD5A 2P0RA 1PE6A 3OF8A 4MZOA 3PW3A 4YYUA 2R9FA 1DF0A 1CJLA 5CVOB 1DEUA 3M99A 3HHAA 3IEJA 2OZ2A 3KX1A 5CHVA 4PP1A 3KWZA 4W5BA 2FT2A 3MTNA 1F2AA 5JA7A 2XU1A 2E02A 4CDCB 1K3BB 3N3KA 1PXVA 1CVZA 2HH5A 3DF0A 2BDZA 3KKUA 1NL6A 2AUXA 3IV2A 4QBBA 2DC9A 2YJBA 1KHPA 1U9VA 3C9EA 2GFOA 2FRQA 6PADA 3RVXA 1CS8A 1ICFA 3MORA 4FIPA 1PPPA 2VHSA 3HWNA 4PADA 2ARYA 1XKGA 3K8UA 1EWLA 1AU2A 4Q8HA 3KWBX 2DCDA 2G8JA 3V6CA 1GCBA 1GLOA 3QSDA 4AXMA 1IWDA 2R9OA 1U9XA 5CHTA 4QRVA 2DC6A 1CPJA 4X6HA 2YJ9A 3TNXA 2F1GA 1X9YA 3P5WA 3O0UA 4YV8A 3NHEA 4G54A 2GHUA 3KW9A 3BC3A 4ZUXU 4N4ZA 2HXZA 4I04A 4QH6A 3RVWA 4RY2A 3PNRA 1HUCB 3PBHA 1GMYA 2JQGR 2O6XA 2ATOA 4YVAA 3S3RA 4N8WA 1F2BA 2E03A 2NQGA 3PDFA 3OVXA 4CZWA 3WXFA 3BPFA 1PBHA 2FYEA 4FJCA 4P6GA 5FPWA 2IBIA 3P5XA 4BPVA 2YJ2A 4HWYA 2AUZA 3N3GA 3CBJA 1MIRA 1EF7A 3OISA 2CB5A 3MHSA 3S3QA 3USVA 2PBHA 2DCAA 1A6RA 2R9CA 3BWKA 4YYQA 1CB5A 4QRXA 5EGWA 1U9WA 3P5UA 2FUDA 1AYWA 2PADA 2OP3A 1PPNA 1BY8A 1EWPA 3U8EA 2XU5A 1MDWA 1YT7A 4YYRA 4X6JA 3CH2X 3E1ZB 2VHFA 4W5CA 2PREA 5F02A 2DC8A 1CV8A 2IPPB 4YYWA 2DCBA 3LFYA 3CH3X 1BP4A 4QRGA 3ZUAA 4Q8GA 3IMAA 1MS6A 3WXEA
chains in the Genus database with same CATH superfamily
4K7CA 3CBKA 4DMXA 1AYVA 1F2CA 3KSEA 1AECA 2DC7A 4RF0A 2YJ8A 2F7DA 3MJ5A 5JH3A 2E01A 1FH0A 1PADA 4OVZB 3I3TA 3BPMA 3V6EA 1KHQA 1KFUL 2AYNA 2AYOA 1QMYA 3P5VA 2NQDB 1ATKA 1KFXL 3H6SA 2NQAA 1EWOA 2BU3A 1QXPA 1TL9A 1YK7A 4IP3A 4KLBA 8PCHA 4R3DA 1AU3A 2FTDA 4OVZA 1F29A 5J94A 3MTVA 1AU0A 1JQPA 4BSQA 3BCNA 4D8IA 4W4UA 3IHPA 4XUIA 7PCKA 4CDDB 2H7JA 2DJFB 2YJCA 3OVZA 2HHNA 3ZNHA 1NB3A 2B1MA 2FRAA 1M6DA 1TU6A 4BOSA 2G6DA 5A24A 4MZSA 4RKXA 3D6SA 3O1GA 2DJGB 3BB7A 5K16A 3H89A 4XR7A 1YVBA 2G8EA 3H8CA 1QDQA 1ZIVA 2NQIA 4OEMA 4X6IA 1U9QX 3K24A 2BDLA 4WA6A 4CDFB 3H8BA 3OF9A 4WURA 3LXSA 1AIMA 3GCBA 4YYVA 5EF4A 4FK5A 3IUTA 4BS6A 3AI8A 3H7DA 4N79A 1QOLA 1AU4A 1CTEA 1PCIA 3K9MA 1Y4HA 2DCCA 4DMYA 1NLJA 4RNAA 2P7UA 4BS5A 4OELA 1PIPA 3TMPA 1BGOA 2JQFR 4MI7A 4RF1A 3QJ3A 2ACTA 1BQIA 2AVWA 1VJVA 4CDEB 1KXRA 1STFE 1Y08A 2DOSA 2Y5BA 4MSXA 3C0RA 2XU3A 2CIOA 3HD3A 2AU1A 9PAPA 3F5VA 3N4CA 1S4VA 1ME4A 3ERVA 1VSNA 3IOQA 5CVMA 4AXLA 2R9NA 1MHWA 1YALA 1NB5A 1AYUA 3KFQA 1CQDA 1PVJA 2WBFX 3BOWA 1O0EA 2E00A 5E6JA 1SNKA 2AS8A 4PP2E 4P6EA 2OULA 1ME3A 4BOQA 2Y6EA 1ZCMA 2DZYA 4P16A 5PADA 3WXGA 3O65A 2C0YA 3F75A 3PT2A 3PRPA 4PI3A 3RVVA 1EWMA 1U5IA 2J7QC 3MHHA 2R6NA 1GECE 4I05A 3I06A 3HHIA 2B1NA 1MEGA 1PPDA 1THEA 3B79A 3BBAA 2FO5A 4I07A 1MEMA 2XU4A 3PSEA 2AGAA 3W30A 4YYSA 1CSBB 2P86A 3QT4A 1NQCA 1TLOA 1YK8A 4PT5A 2Z84A 1NPZA 5CVNB 1PPOA 1POPA 1Q6KA 1ITOA 2G7YA 2FQ9A 2R9MA 2AIMA 1SP4B 4BQVA 2PNSA 2DZZA 2HD5A 2P0RA 1PE6A 3PRMA 3OF8A 4MZOA 3PW3A 4YYUA 4REZA 2R9FA 4M0WA 1DF0A 1CJLA 5CVOB 1DEUA 3M99A 2J7QA 3W31A 3HHAA 3IEJA 2OZ2A 3KX1A 5CHVA 4PP1A 3KWZA 4W5BA 2FT2A 3MTNA 1F2AA 5JA7A 2XU1A 2E02A 4CDCB 4BOZA 1K3BB 3N3KA 4D8BA 5JZEA 1PXVA 1CVZA 2HH5A 3DF0A 2BDZA 3KKUA 1NL6A 2AUXA 3PHXA 3IV2A 4QBBA 2DC9A 2YJBA 1KHPA 1U9VA 3C9EA 2GFOA 2FRQA 6PADA 3RVXA 1CS8A 1ICFA 3PHUA 3MORA 4FIPA 1PPPA 2VHSA 1YZBA 3HWNA 4PADA 2ARYA 3MP2A 1XKGA 3K8UA 1EWLA 1AU2A 4A5UA 4D8EA 4Q8HA 3KWBX 2DCDA 2G8JA 2UZJA 3V6CA 4GUAA 1GCBA 1GLOA 3QSDA 4AXMA 1IWDA 2R9OA 1U9XA 5CHTA 4QRVA 2DC6A 1CPJA 4X6HA 2YJ9A 3TNXA 1DKIA 2F1GA 5KO3A 1X9YA 3P5WA 3O0UA 4YV8A 3NHEA 4OW0A 3KW9A 4G54A 2GHUA 3BC3A 4ZUXU 4N4ZA 4BOUA 2HXZA 4I04A 4QH6A 3RVWA 4RY2A 3PNRA 1HUCB 5EZQA 3IFUA 3PBHA 4BOPA 1GMYA 2JQGR 2O6XA 2ATOA 3E9SA 4YVAA 3S3RA 4N8WA 1F2BA 2E03A 2NQGA 3B21A 3PDFA 3OVXA 4CZWA 3WXFA 3BPFA 1PBHA 5EZSA 3RNVA 2FYEA 3BY4A 4FJCA 4P6GA 5FPWA 2IBIA 3P5XA 4BPVA 2YJ2A 2BTWB 4HWYA 2FE8A 2AUZA 3N3GA 3CBJA 1MIRA 1EF7A 3PHWA 1UKFA 4IUMA 3OISA 2CB5A 4HXDB 3MHSA 3S3QA 3USVA 4XZXA 2BTWA 2PBHA 2DCAA 1A6RA 2R9CA 3BWKA 4YYQA 1CB5A 4QRXA 2JRIA 5EGWA 1U9WA 3P5UA 2FUDA 1AYWA 2PADA 2OP3A 4ZTBA 1PPNA 3OQCA 1BY8A 1EWPA 3U8EA 2XU5A 1MDWA 1YT7A 4YYRA 4X6JA 3CH2X 2HWKA 3E1ZB 2VHFA 4W5CA 3TRKA 2PREA 5F02A 2DC8A 1CV8A 2IPPB 4YYWA 2DCBA 3LFYA 2JTCA 3CH3X 1BP4A 4QRGA 3ZUAA 4Q8GA 4MM3B 3IMAA 1MS6A 3WXEA
chains in the Genus database with same CATH topology
4K7CA 3CBKA 4DMXA 1AYVA 1F2CA 3KSEA 1AECA 2DC7A 2YJ8A 2F7DA 5JH3A 2E01A 1FH0A 1PADA 3I3TA 3BPMA 3V6EA 1KHQA 1KFUL 2AYNA 2VFBA 2AYOA 1QMYA 3P5VA 2NQDB 1ATKA 1KFXL 3H6SA 2NQAA 1EWOA 1QXPA 1TL9A 1YK7A 4KLBA 8PCHA 4GUZA 1AU3A 2FTDA 1F29A 5J94A 1AU0A 1JQPA 4BSQA 3BCNA 4W4UA 3IHPA 4XUIA 7PCKA 4CDDB 2H7JA 2DJFB 2YJCA 3OVZA 2HHNA 1NB3A 2B1MA 2FRAA 1M6DA 1TU6A 1W6FA 2G6DA 5A24A 4MZSA 3D6SA 3O1GA 2DJGB 5K16A 3H89A 4XR7A 1YVBA 2G8EA 3H8CA 1QDQA 1ZIVA 2NQIA 4OEMA 4X6IA 1U9QX 3K24A 2BDLA 4WA6A 4CDFB 3H8BA 3OF9A 3LXSA 1AIMA 3GCBA 4YYVA 5EF4A 4FK5A 3IUTA 4BS6A 3AI8A 3H7DA 4N79A 1QOLA 1W4TA 1AU4A 1CTEA 1PCIA 3K9MA 1Y4HA 2DCCA 4DMYA 1NLJA 2P7UA 4BS5A 4OELA 1PIPA 1BGOA 2JQFR 3QJ3A 2ACTA 1BQIA 2AVWA 1VJVA 4CDEB 1KXRA 1STFE 1Y08A 2Y5BA 4MSXA 2XU3A 2CIOA 3HD3A 2AU1A 9PAPA 3F5VA 4NV8A 2BSZA 3N4CA 1S4VA 1ME4A 3ERVA 1VSNA 3IOQA 5CVMA 4AXLA 2R9NA 1MHWA 4NV7A 1YALA 1NB5A 1AYUA 3KFQA 1CQDA 2WBFX 3BOWA 1O0EA 2E00A 1SNKA 2AS8A 4PP2E 4P6EA 2OULA 1ME3A 2Y6EA 1ZCMA 2DZYA 3WXGA 5PADA 2C0YA 3F75A 4PI3A 3RVVA 1EWMA 1U5IA 3MHHA 2R6NA 1GECE 4I05A 3I06A 3HHIA 2B1NA 1MEGA 1PPDA 1THEA 3B79A 2FO5A 4I07A 1MEMA 2XU4A 4YYSA 1CSBB 2P86A 3QT4A 1NQCA 1TLOA 1YK8A 1NPZA 5CVNB 1PPOA 1POPA 1Q6KA 1ITOA 1E2TA 2G7YA 2FQ9A 2R9MA 2AIMA 1SP4B 4BQVA 2PNSA 2DZZA 2HD5A 2P0RA 1PE6A 3OF8A 4MZOA 3PW3A 4YYUA 2R9FA 2VFCA 1DF0A 1CJLA 5CVOB 1DEUA 3M99A 3HHAA 3IEJA 2OZ2A 3KX1A 5CHVA 4PP1A 3KWZA 4W5BA 2FT2A 3MTNA 1F2AA 5JA7A 2XU1A 2E02A 4CDCB 1K3BB 3N3KA 1PXVA 1W5RA 1CVZA 2HH5A 3DF0A 2BDZA 3KKUA 1NL6A 2AUXA 3IV2A 4QBBA 2DC9A 2YJBA 1KHPA 1U9VA 3C9EA 2GFOA 2FRQA 6PADA 3RVXA 1CS8A 1ICFA 3MORA 4FIPA 1GX3A 1PPPA 2VHSA 3HWNA 4PADA 2ARYA 1XKGA 4B55A 3K8UA 1EWLA 1AU2A 4Q8HA 3KWBX 4C5PA 2DCDA 2G8JA 3V6CA 1GCBA 1GLOA 3QSDA 4AXMA 1IWDA 2R9OA 1U9XA 5CHTA 4QRVA 2DC6A 1CPJA 4X6HA 2YJ9A 3LTWA 3TNXA 2F1GA 1X9YA 3P5WA 3O0UA 4YV8A 3NHEA 3D9WA 3KW9A 4G54A 2GHUA 3BC3A 4ZUXU 4N4ZA 2HXZA 4I04A 4QH6A 3RVWA 4RY2A 3PNRA 1HUCB 3PBHA 1GMYA 2JQGR 2O6XA 2ATOA 4YVAA 3S3RA 4N8WA 1F2BA 2E03A 2NQGA 3PDFA 3OVXA 4CZWA 3WXFA 3BPFA 1PBHA 2FYEA 4FJCA 4P6GA 5FPWA 2IBIA 3P5XA 4BPVA 2YJ2A 4HWYA 2AUZA 3N3GA 3CBJA 1MIRA 1EF7A 3OISA 2CB5A 3MHSA 3S3QA 3USVA 2PBHA 2DCAA 1A6RA 2R9CA 3BWKA 4BGFA 4YYQA 1CB5A 4QRXA 5EGWA 1U9WA 3P5UA 2FUDA 1AYWA 2PADA 2OP3A 1PPNA 1BY8A 1EWPA 3U8EA 2XU5A 1MDWA 1YT7A 4YYRA 4X6JA 3CH2X 3E1ZB 2VHFA 4W5CA 2PREA 5F02A 2DC8A 1CV8A 2IPPB 4YYWA 2DCBA 3LFYA 3CH3X 1BP4A 4QRGA 3ZUAA 4Q8GA 3IMAA 1MS6A 3WXEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K7C A;  3CBK A;  4DMX A;  1AYV A;  1F2C A;  3KSE A;  1AEC A;  2DC7 A;  2YJ8 A;  2F7D A;  5JH3 A;  2E01 A;  1FH0 A;  1PAD A;  3I3T A;  3BPM A;  3V6E A;  1KHQ A;  1KFU L;  2AYN A;  2AYO A;  1QMY A;  3P5V A;  2NQD B;  1ATK A;  1KFX L;  3H6S A;  2NQA A;  1EWO A;  1QXP A;  1TL9 A;  1YK7 A;  4KLB A;  8PCH A;  1AU3 A;  2FTD A;  1F29 A;  5J94 A;  1AU0 A;  1JQP A;  4BSQ A;  3BCN A;  4W4U A;  3IHP A;  4XUI A;  7PCK A;  4CDD B;  2H7J A;  2DJF B;  2YJC A;  3OVZ A;  2HHN A;  1NB3 A;  2B1M A;  2FRA A;  1M6D A;  1TU6 A;  2G6D A;  5A24 A;  4MZS A;  3D6S A;  3O1G A;  2DJG B;  5K16 A;  3H89 A;  4XR7 A;  1YVB A;  2G8E A;  3H8C A;  1QDQ A;  1ZIV A;  2NQI A;  4OEM A;  4X6I A;  1U9Q X;  3K24 A;  2BDL A;  4WA6 A;  4CDF B;  3H8B A;  3OF9 A;  3LXS A;  1AIM A;  3GCB A;  4YYV A;  5EF4 A;  4FK5 A;  3IUT A;  4BS6 A;  3AI8 A;  3H7D A;  4N79 A;  1QOL A;  1AU4 A;  1CTE A;  1PCI A;  3K9M A;  1Y4H A;  2DCC A;  4DMY A;  1NLJ A;  2P7U A;  4BS5 A;  4OEL A;  1PIP A;  1BGO A;  2JQF R;  3QJ3 A;  2ACT A;  1BQI A;  2AVW A;  1VJV A;  4CDE B;  1KXR A;  1STF E;  1Y08 A;  2Y5B A;  4MSX A;  2XU3 A;  2CIO A;  3HD3 A;  2AU1 A;  9PAP A;  3F5V A;  3N4C A;  1S4V A;  1ME4 A;  3ERV A;  1VSN A;  3IOQ A;  5CVM A;  4AXL A;  2R9N A;  1MHW A;  1YAL A;  1NB5 A;  1AYU A;  3KFQ A;  1CQD A;  2WBF X;  3BOW A;  1O0E A;  2E00 A;  1SNK A;  2AS8 A;  4PP2 E;  4P6E A;  2OUL A;  1ME3 A;  2Y6E A;  1ZCM A;  2DZY A;  3WXG A;  5PAD A;  2C0Y A;  3F75 A;  4PI3 A;  3RVV A;  1EWM A;  1U5I A;  3MHH A;  2R6N A;  1GEC E;  4I05 A;  3I06 A;  3HHI A;  2B1N A;  1MEG A;  1PPD A;  1THE A;  3B79 A;  2FO5 A;  4I07 A;  1MEM A;  2XU4 A;  4YYS A;  1CSB B;  2P86 A;  3QT4 A;  1NQC A;  1TLO A;  1YK8 A;  1NPZ A;  5CVN B;  1PPO A;  1POP A;  1Q6K A;  1ITO A;  2G7Y A;  2FQ9 A;  2R9M A;  2AIM A;  1SP4 B;  4BQV A;  2PNS A;  2DZZ A;  2HD5 A;  2P0R A;  1PE6 A;  3OF8 A;  4MZO A;  3PW3 A;  4YYU A;  2R9F A;  1DF0 A;  1CJL A;  5CVO B;  1DEU A;  3M99 A;  3HHA A;  3IEJ A;  2OZ2 A;  3KX1 A;  5CHV A;  4PP1 A;  3KWZ A;  4W5B A;  2FT2 A;  3MTN A;  1F2A A;  5JA7 A;  2XU1 A;  2E02 A;  4CDC B;  1K3B B;  3N3K A;  1PXV A;  1CVZ A;  2HH5 A;  3DF0 A;  2BDZ A;  3KKU A;  1NL6 A;  2AUX A;  3IV2 A;  4QBB A;  2DC9 A;  2YJB A;  1KHP A;  1U9V A;  3C9E A;  2GFO A;  2FRQ A;  6PAD A;  3RVX A;  1CS8 A;  1ICF A;  3MOR A;  4FIP A;  1PPP A;  2VHS A;  3HWN A;  4PAD A;  2ARY A;  1XKG A;  3K8U A;  1EWL A;  1AU2 A;  4Q8H A;  3KWB X;  2DCD A;  2G8J A;  3V6C A;  1GCB A;  1GLO A;  3QSD A;  4AXM A;  1IWD A;  2R9O A;  1U9X A;  5CHT A;  4QRV A;  2DC6 A;  1CPJ A;  4X6H A;  2YJ9 A;  3TNX A;  2F1G A;  1X9Y A;  3P5W A;  3O0U A;  4YV8 A;  3NHE A;  4G54 A;  2GHU A;  3KW9 A;  3BC3 A;  4ZUX U;  4N4Z A;  2HXZ A;  4I04 A;  4QH6 A;  3RVW A;  4RY2 A;  3PNR A;  1HUC B;  3PBH A;  1GMY A;  2JQG R;  2O6X A;  2ATO A;  4YVA A;  3S3R A;  4N8W A;  1F2B A;  2E03 A;  2NQG A;  3PDF A;  3OVX A;  4CZW A;  3WXF A;  3BPF A;  1PBH A;  2FYE A;  4FJC A;  4P6G A;  5FPW A;  2IBI A;  3P5X A;  4BPV A;  2YJ2 A;  4HWY A;  2AUZ A;  3N3G A;  3CBJ A;  1MIR A;  1EF7 A;  3OIS A;  2CB5 A;  3MHS A;  3S3Q A;  3USV A;  2PBH A;  2DCA A;  1A6R A;  2R9C A;  3BWK A;  4YYQ A;  1CB5 A;  4QRX A;  5EGW A;  1U9W A;  3P5U A;  2FUD A;  1AYW A;  2PAD A;  2OP3 A;  1PPN A;  1BY8 A;  1EWP A;  3U8E A;  2XU5 A;  1MDW A;  1YT7 A;  4YYR A;  4X6J A;  3CH2 X;  3E1Z B;  2VHF A;  4W5C A;  2PRE A;  5F02 A;  2DC8 A;  1CV8 A;  2IPP B;  4YYW A;  2DCB A;  3LFY A;  3CH3 X;  1BP4 A;  4QRG A;  3ZUA A;  4Q8G A;  3IMA A;  1MS6 A;  3WXE A; 
#chains in the Genus database with same CATH topology
 4K7C A;  3CBK A;  4DMX A;  1AYV A;  1F2C A;  3KSE A;  1AEC A;  2DC7 A;  4RF0 A;  2YJ8 A;  2F7D A;  3MJ5 A;  5JH3 A;  2E01 A;  1FH0 A;  1PAD A;  4OVZ B;  3I3T A;  3BPM A;  3V6E A;  1KHQ A;  1KFU L;  2AYN A;  2AYO A;  1QMY A;  3P5V A;  2NQD B;  1ATK A;  1KFX L;  3H6S A;  2NQA A;  1EWO A;  2BU3 A;  1QXP A;  1TL9 A;  1YK7 A;  4IP3 A;  4KLB A;  8PCH A;  4R3D A;  1AU3 A;  2FTD A;  4OVZ A;  1F29 A;  5J94 A;  3MTV A;  1AU0 A;  1JQP A;  4BSQ A;  3BCN A;  4D8I A;  4W4U A;  3IHP A;  4XUI A;  7PCK A;  4CDD B;  2H7J A;  2DJF B;  2YJC A;  3OVZ A;  2HHN A;  3ZNH A;  1NB3 A;  2B1M A;  2FRA A;  1M6D A;  1TU6 A;  4BOS A;  2G6D A;  5A24 A;  4MZS A;  4RKX A;  3D6S A;  3O1G A;  2DJG B;  3BB7 A;  5K16 A;  3H89 A;  4XR7 A;  1YVB A;  2G8E A;  3H8C A;  1QDQ A;  1ZIV A;  2NQI A;  4OEM A;  4X6I A;  1U9Q X;  3K24 A;  2BDL A;  4WA6 A;  4CDF B;  3H8B A;  3OF9 A;  4WUR A;  3LXS A;  1AIM A;  3GCB A;  4YYV A;  5EF4 A;  4FK5 A;  3IUT A;  4BS6 A;  3AI8 A;  3H7D A;  4N79 A;  1QOL A;  1AU4 A;  1CTE A;  1PCI A;  3K9M A;  1Y4H A;  2DCC A;  4DMY A;  1NLJ A;  4RNA A;  2P7U A;  4BS5 A;  4OEL A;  1PIP A;  3TMP A;  1BGO A;  2JQF R;  4MI7 A;  4RF1 A;  3QJ3 A;  2ACT A;  1BQI A;  2AVW A;  1VJV A;  4CDE B;  1KXR A;  1STF E;  1Y08 A;  2DOS A;  2Y5B A;  4MSX A;  3C0R A;  2XU3 A;  2CIO A;  3HD3 A;  2AU1 A;  9PAP A;  3F5V A;  3N4C A;  1S4V A;  1ME4 A;  3ERV A;  1VSN A;  3IOQ A;  5CVM A;  4AXL A;  2R9N A;  1MHW A;  1YAL A;  1NB5 A;  1AYU A;  3KFQ A;  1CQD A;  1PVJ A;  2WBF X;  3BOW A;  1O0E A;  2E00 A;  5E6J A;  1SNK A;  2AS8 A;  4PP2 E;  4P6E A;  2OUL A;  1ME3 A;  4BOQ A;  2Y6E A;  1ZCM A;  2DZY A;  4P16 A;  5PAD A;  3WXG A;  3O65 A;  2C0Y A;  3F75 A;  3PT2 A;  3PRP A;  4PI3 A;  3RVV A;  1EWM A;  1U5I A;  2J7Q C;  3MHH A;  2R6N A;  1GEC E;  4I05 A;  3I06 A;  3HHI A;  2B1N A;  1MEG A;  1PPD A;  1THE A;  3B79 A;  3BBA A;  2FO5 A;  4I07 A;  1MEM A;  2XU4 A;  3PSE A;  2AGA A;  3W30 A;  4YYS A;  1CSB B;  2P86 A;  3QT4 A;  1NQC A;  1TLO A;  1YK8 A;  4PT5 A;  2Z84 A;  1NPZ A;  5CVN B;  1PPO A;  1POP A;  1Q6K A;  1ITO A;  2G7Y A;  2FQ9 A;  2R9M A;  2AIM A;  1SP4 B;  4BQV A;  2PNS A;  2DZZ A;  2HD5 A;  2P0R A;  1PE6 A;  3PRM A;  3OF8 A;  4MZO A;  3PW3 A;  4YYU A;  4REZ A;  2R9F A;  4M0W A;  1DF0 A;  1CJL A;  5CVO B;  1DEU A;  3M99 A;  2J7Q A;  3W31 A;  3HHA A;  3IEJ A;  2OZ2 A;  3KX1 A;  5CHV A;  4PP1 A;  3KWZ A;  4W5B A;  2FT2 A;  3MTN A;  1F2A A;  5JA7 A;  2XU1 A;  2E02 A;  4CDC B;  4BOZ A;  1K3B B;  3N3K A;  4D8B A;  5JZE A;  1PXV A;  1CVZ A;  2HH5 A;  3DF0 A;  2BDZ A;  3KKU A;  1NL6 A;  2AUX A;  3PHX A;  3IV2 A;  4QBB A;  2DC9 A;  2YJB A;  1KHP A;  1U9V A;  3C9E A;  2GFO A;  2FRQ A;  6PAD A;  3RVX A;  1CS8 A;  1ICF A;  3PHU A;  3MOR A;  4FIP A;  1PPP A;  2VHS A;  1YZB A;  3HWN A;  4PAD A;  2ARY A;  3MP2 A;  1XKG A;  3K8U A;  1EWL A;  1AU2 A;  4A5U A;  4D8E A;  4Q8H A;  3KWB X;  2DCD A;  2G8J A;  2UZJ A;  3V6C A;  4GUA A;  1GCB A;  1GLO A;  3QSD A;  4AXM A;  1IWD A;  2R9O A;  1U9X A;  5CHT A;  4QRV A;  2DC6 A;  1CPJ A;  4X6H A;  2YJ9 A;  3TNX A;  1DKI A;  2F1G A;  5KO3 A;  1X9Y A;  3P5W A;  3O0U A;  4YV8 A;  3NHE A;  4OW0 A;  3KW9 A;  4G54 A;  2GHU A;  3BC3 A;  4ZUX U;  4N4Z A;  4BOU A;  2HXZ A;  4I04 A;  4QH6 A;  3RVW A;  4RY2 A;  3PNR A;  1HUC B;  5EZQ A;  3IFU A;  3PBH A;  4BOP A;  1GMY A;  2JQG R;  2O6X A;  2ATO A;  3E9S A;  4YVA A;  3S3R A;  4N8W A;  1F2B A;  2E03 A;  2NQG A;  3B21 A;  3PDF A;  3OVX A;  4CZW A;  3WXF A;  3BPF A;  1PBH A;  5EZS A;  3RNV A;  2FYE A;  3BY4 A;  4FJC A;  4P6G A;  5FPW A;  2IBI A;  3P5X A;  4BPV A;  2YJ2 A;  2BTW B;  4HWY A;  2FE8 A;  2AUZ A;  3N3G A;  3CBJ A;  1MIR A;  1EF7 A;  3PHW A;  1UKF A;  4IUM A;  3OIS A;  2CB5 A;  4HXD B;  3MHS A;  3S3Q A;  3USV A;  4XZX A;  2BTW A;  2PBH A;  2DCA A;  1A6R A;  2R9C A;  3BWK A;  4YYQ A;  1CB5 A;  4QRX A;  2JRI A;  5EGW A;  1U9W A;  3P5U A;  2FUD A;  1AYW A;  2PAD A;  2OP3 A;  4ZTB A;  1PPN A;  3OQC A;  1BY8 A;  1EWP A;  3U8E A;  2XU5 A;  1MDW A;  1YT7 A;  4YYR A;  4X6J A;  3CH2 X;  2HWK A;  3E1Z B;  2VHF A;  4W5C A;  3TRK A;  2PRE A;  5F02 A;  2DC8 A;  1CV8 A;  2IPP B;  4YYW A;  2DCB A;  3LFY A;  2JTC A;  3CH3 X;  1BP4 A;  4QRG A;  3ZUA A;  4Q8G A;  4MM3 B;  3IMA A;  1MS6 A;  3WXE A; 
#chains in the Genus database with same CATH homology
 4K7C A;  3CBK A;  4DMX A;  1AYV A;  1F2C A;  3KSE A;  1AEC A;  2DC7 A;  2YJ8 A;  2F7D A;  5JH3 A;  2E01 A;  1FH0 A;  1PAD A;  3I3T A;  3BPM A;  3V6E A;  1KHQ A;  1KFU L;  2AYN A;  2VFB A;  2AYO A;  1QMY A;  3P5V A;  2NQD B;  1ATK A;  1KFX L;  3H6S A;  2NQA A;  1EWO A;  1QXP A;  1TL9 A;  1YK7 A;  4KLB A;  8PCH A;  4GUZ A;  1AU3 A;  2FTD A;  1F29 A;  5J94 A;  1AU0 A;  1JQP A;  4BSQ A;  3BCN A;  4W4U A;  3IHP A;  4XUI A;  7PCK A;  4CDD B;  2H7J A;  2DJF B;  2YJC A;  3OVZ A;  2HHN A;  1NB3 A;  2B1M A;  2FRA A;  1M6D A;  1TU6 A;  1W6F A;  2G6D A;  5A24 A;  4MZS A;  3D6S A;  3O1G A;  2DJG B;  5K16 A;  3H89 A;  4XR7 A;  1YVB A;  2G8E A;  3H8C A;  1QDQ A;  1ZIV A;  2NQI A;  4OEM A;  4X6I A;  1U9Q X;  3K24 A;  2BDL A;  4WA6 A;  4CDF B;  3H8B A;  3OF9 A;  3LXS A;  1AIM A;  3GCB A;  4YYV A;  5EF4 A;  4FK5 A;  3IUT A;  4BS6 A;  3AI8 A;  3H7D A;  4N79 A;  1QOL A;  1W4T A;  1AU4 A;  1CTE A;  1PCI A;  3K9M A;  1Y4H A;  2DCC A;  4DMY A;  1NLJ A;  2P7U A;  4BS5 A;  4OEL A;  1PIP A;  1BGO A;  2JQF R;  3QJ3 A;  2ACT A;  1BQI A;  2AVW A;  1VJV A;  4CDE B;  1KXR A;  1STF E;  1Y08 A;  2Y5B A;  4MSX A;  2XU3 A;  2CIO A;  3HD3 A;  2AU1 A;  9PAP A;  3F5V A;  4NV8 A;  2BSZ A;  3N4C A;  1S4V A;  1ME4 A;  3ERV A;  1VSN A;  3IOQ A;  5CVM A;  4AXL A;  2R9N A;  1MHW A;  4NV7 A;  1YAL A;  1NB5 A;  1AYU A;  3KFQ A;  1CQD A;  2WBF X;  3BOW A;  1O0E A;  2E00 A;  1SNK A;  2AS8 A;  4PP2 E;  4P6E A;  2OUL A;  1ME3 A;  2Y6E A;  1ZCM A;  2DZY A;  3WXG A;  5PAD A;  2C0Y A;  3F75 A;  4PI3 A;  3RVV A;  1EWM A;  1U5I A;  3MHH A;  2R6N A;  1GEC E;  4I05 A;  3I06 A;  3HHI A;  2B1N A;  1MEG A;  1PPD A;  1THE A;  3B79 A;  2FO5 A;  4I07 A;  1MEM A;  2XU4 A;  4YYS A;  1CSB B;  2P86 A;  3QT4 A;  1NQC A;  1TLO A;  1YK8 A;  1NPZ A;  5CVN B;  1PPO A;  1POP A;  1Q6K A;  1ITO A;  1E2T A;  2G7Y A;  2FQ9 A;  2R9M A;  2AIM A;  1SP4 B;  4BQV A;  2PNS A;  2DZZ A;  2HD5 A;  2P0R A;  1PE6 A;  3OF8 A;  4MZO A;  3PW3 A;  4YYU A;  2R9F A;  2VFC A;  1DF0 A;  1CJL A;  5CVO B;  1DEU A;  3M99 A;  3HHA A;  3IEJ A;  2OZ2 A;  3KX1 A;  5CHV A;  4PP1 A;  3KWZ A;  4W5B A;  2FT2 A;  3MTN A;  1F2A A;  5JA7 A;  2XU1 A;  2E02 A;  4CDC B;  1K3B B;  3N3K A;  1PXV A;  1W5R A;  1CVZ A;  2HH5 A;  3DF0 A;  2BDZ A;  3KKU A;  1NL6 A;  2AUX A;  3IV2 A;  4QBB A;  2DC9 A;  2YJB A;  1KHP A;  1U9V A;  3C9E A;  2GFO A;  2FRQ A;  6PAD A;  3RVX A;  1CS8 A;  1ICF A;  3MOR A;  4FIP A;  1GX3 A;  1PPP A;  2VHS A;  3HWN A;  4PAD A;  2ARY A;  1XKG A;  4B55 A;  3K8U A;  1EWL A;  1AU2 A;  4Q8H A;  3KWB X;  4C5P A;  2DCD A;  2G8J A;  3V6C A;  1GCB A;  1GLO A;  3QSD A;  4AXM A;  1IWD A;  2R9O A;  1U9X A;  5CHT A;  4QRV A;  2DC6 A;  1CPJ A;  4X6H A;  2YJ9 A;  3LTW A;  3TNX A;  2F1G A;  1X9Y A;  3P5W A;  3O0U A;  4YV8 A;  3NHE A;  3D9W A;  3KW9 A;  4G54 A;  2GHU A;  3BC3 A;  4ZUX U;  4N4Z A;  2HXZ A;  4I04 A;  4QH6 A;  3RVW A;  4RY2 A;  3PNR A;  1HUC B;  3PBH A;  1GMY A;  2JQG R;  2O6X A;  2ATO A;  4YVA A;  3S3R A;  4N8W A;  1F2B A;  2E03 A;  2NQG A;  3PDF A;  3OVX A;  4CZW A;  3WXF A;  3BPF A;  1PBH A;  2FYE A;  4FJC A;  4P6G A;  5FPW A;  2IBI A;  3P5X A;  4BPV A;  2YJ2 A;  4HWY A;  2AUZ A;  3N3G A;  3CBJ A;  1MIR A;  1EF7 A;  3OIS A;  2CB5 A;  3MHS A;  3S3Q A;  3USV A;  2PBH A;  2DCA A;  1A6R A;  2R9C A;  3BWK A;  4BGF A;  4YYQ A;  1CB5 A;  4QRX A;  5EGW A;  1U9W A;  3P5U A;  2FUD A;  1AYW A;  2PAD A;  2OP3 A;  1PPN A;  1BY8 A;  1EWP A;  3U8E A;  2XU5 A;  1MDW A;  1YT7 A;  4YYR A;  4X6J A;  3CH2 X;  3E1Z B;  2VHF A;  4W5C A;  2PRE A;  5F02 A;  2DC8 A;  1CV8 A;  2IPP B;  4YYW A;  2DCB A;  3LFY A;  3CH3 X;  1BP4 A;  4QRG A;  3ZUA A;  4Q8G A;  3IMA A;  1MS6 A;  3WXE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...