1U9VA

Crystal structure of the cysteine protease human cathepsin k in complex with the covalent inhibitor nvp-abe854
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
215
structure length
215
Chain Sequence
b'APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin K
publication title Novel purine nitrile derived inhibitors of the cysteine protease cathepsin K
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 62
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2004-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1u9vA00
3AI8A 2XU5A 1PE6A 3KW9A 1Y08A 3N3KA 3OF8A 3F5VA 5CVNB 2FO5A 4PADA 2R9CA 1STFE 2YJCA 2E00A 1AU0A 4W4UA 1MEMA 4BPVA 2E01A 2OULA 1X9YA 4KLBA 2Y5BA 2HD5A 4BS5A 1POPA 4CZWA 2AUXA 2NQAA 1AYVA 4YYUA 1ATKA 1IWDA 5PADA 1BP4A 1ICFA 1KFUL 4X6IA 3P5VA 3LXSA 3BOWA 4WA6A 1EWMA 1BY8A 4BS6A 3BC3A 4CDCB 2AUZA 4Q8HA 1PXVA 1GCBA 1U9QX 2PREA 4OEMA 1AIMA 2H7JA 2R6NA 2NQIA 3DF0A 1F29A 2XU4A 2BDZA 1PBHA 2NQGA 3KSEA 3MHHA 3H6SA 4CDFB 3CH3X 1CQDA 3BWKA 2DC8A 1BQIA 3N4CA 5EGWA 2AYNA 2DCBA 1VJVA 4MZSA 2YJ2A 2AU1A 4I07A 1TL9A 2R9NA 4N8WA 2F7DA 1QDQA 2JQFR 4G54A 2DJFB 3IV2A 1AU3A 1ME3A 4CDDB 2WBFX 1U9XA 3B79A 3PDFA 4AXLA 2R9FA 4QH6A 1CTEA 3U8EA 9PAPA 2E03A 3BPFA 1MS6A 3PNRA 3I06A 1M6DA 2G6DA 2NQDB 3V6CA 3C9EA 3P5XA 1TU6A 1CB5A 4YYRA 2YJ9A 2G7YA 1AYWA 1KHPA 1AU4A 1MDWA 3QT4A 1EWLA 2GHUA 3OVZA 3H7DA 1NB3A 1YK8A 4K7CA 2FQ9A 2IBIA 3QJ3A 3RVVA 2F1GA 2FTDA 2FT2A 1PADA 2HH5A 2DC6A 1GLOA 1FH0A 3O0UA 1HUCB 1SP4B 1DF0A 5F02A 3OISA 3IHPA 3P5WA 4MSXA 4N4ZA 4I05A 3USVA 2P0RA 2VHSA 2FYEA 1AU2A 3OVXA 4YYWA 4HWYA 2HHNA 1NL6A 1DEUA 5J94A 3M99A 1NQCA 3HHIA 3HD3A 1K3BB 4RY2A 5CVMA 2XU3A 4YYVA 4QRXA 1U9VA 2DJGB 4Q8GA 4XR7A 1NLJA 2OP3A 1F2AA 1CPJA 1MIRA 1YK7A 1CVZA 5CHVA 2PADA 3P5UA 2YJBA 1XKGA 4PP2E 1CSBB 1U5IA 3KX1A 1EWOA 1PCIA 1Y4HA 1NB5A 2FRQA 2BDLA 1ITOA 1KXRA 3PW3A 3IUTA 4DMXA 3IOQA 2B1MA 3KFQA 3O1GA 3RVXA 1TLOA 4AXMA 1F2BA 3V6EA 1CJLA 2FRAA 1O0EA 3IMAA 3PBHA 4QRGA 2HXZA 2OZ2A 3CH2X 4ZUXU 2ARYA 2YJ8A 1BGOA 4FK5A 3K8UA 2B1NA 2VHFA 2G8JA 1QMYA 3WXEA 1GMYA 2G8EA 3LFYA 1PPDA 4DMYA 5JA7A 2AIMA 3NHEA 5JH3A 1MEGA 3IEJA 4FIPA 3TNXA 3GCBA 1AYUA 3K9MA 3CBKA 2CIOA 4N79A 4YVAA 4FJCA 3ERVA 4MZOA 4PI3A 3HWNA 3I3TA 4X6HA 5CVOB 1AECA 2DCAA 2O6XA 1KFXL 4P6GA 7PCKA 4QBBA 3D6SA 3WXFA 2DC7A 3S3RA 1GECE 3F75A 2GFOA 2DC9A 2P86A 3H8CA 3S3QA 1THEA 5CHTA 5FPWA 4W5BA 3KWBX 1PPOA 1JQPA 1PPPA 2R9MA 3MTNA 2ACTA 3ZUAA 5K16A 8PCHA 3KWZA 5EF4A 3WXGA 5A24A 3H89A 3CBJA 1ME4A 1PPNA 1VSNA 4YYQA 3OF9A 4BQVA 4YV8A 4XUIA 6PADA 2XU1A 3K24A 1MHWA 2IPPB 2DZZA 2PNSA 4OELA 3N3GA 2JQGR 1CS8A 3KKUA 4CDEB 4I04A 4QRVA 2R9OA 3HHAA 2ATOA 4X6JA 4W5CA 2CB5A 1YALA 1ZCMA 3E1ZB 1EF7A 1PIPA 1A6RA 2PBHA 1EWPA 3H8BA 1U9WA 3BCNA 2DCCA 4P6EA 1S4VA 2E02A 4PP1A 3QSDA 3RVWA 1YT7A 1SNKA 1ZIVA 2AS8A 1YVBA 2P7UA 3MHSA 1NPZA 4BSQA 1Q6KA 4YYSA 2DZYA 1KHQA 2FUDA 1QOLA 1CV8A 2Y6EA 3MORA 2AVWA 1QXPA 2DCDA 2C0YA 1F2CA 3BPMA 2AYOA
chains in the Genus database with same CATH superfamily
3AI8A 2BU3A 3PRMA 2XU5A 1PE6A 3KW9A 1Y08A 3N3KA 3OF8A 3F5VA 5CVNB 2FO5A 4PADA 2R9CA 3PHUA 1STFE 2YJCA 4D8BA 2E00A 1AU0A 4W4UA 1MEMA 4BPVA 2E01A 2OULA 4P16A 1X9YA 4KLBA 2Y5BA 2HD5A 5EZSA 4BS5A 1POPA 4CZWA 2AUXA 2NQAA 1AYVA 3C0RA 3PHWA 4YYUA 1ATKA 1IWDA 4IUMA 5PADA 1BP4A 1ICFA 1KFUL 4X6IA 3P5VA 5KO3A 3LXSA 3BOWA 4WA6A 1EWMA 1BY8A 4BS6A 3BC3A 4CDCB 2AUZA 4Q8HA 1PXVA 1GCBA 1U9QX 2PREA 4OEMA 1AIMA 2H7JA 2R6NA 2NQIA 3DF0A 4BOSA 1F29A 2XU4A 2BDZA 1PBHA 2NQGA 3KSEA 3MHHA 3H6SA 4CDFB 3CH3X 1CQDA 3BWKA 2DC8A 1BQIA 3PT2A 3N4CA 5EGWA 3MJ5A 2AYNA 2DCBA 1VJVA 4MZSA 2YJ2A 2AU1A 4I07A 1TL9A 2R9NA 4N8WA 2F7DA 3W31A 1QDQA 2JQFR 4HXDB 4G54A 2DJFB 2J7QC 3IV2A 1AU3A 1ME3A 4CDDB 2WBFX 4R3DA 1U9XA 3B79A 3PDFA 4AXLA 3RNVA 2R9FA 3W30A 4QH6A 1CTEA 4OW0A 3U8EA 9PAPA 2E03A 3BPFA 1MS6A 3TMPA 3PNRA 3I06A 1M6DA 2G6DA 2NQDB 3V6CA 2FE8A 3C9EA 3P5XA 1TU6A 1CB5A 4YYRA 2YJ9A 2G7YA 1AYWA 1KHPA 1AU4A 1MDWA 3QT4A 1EWLA 2GHUA 3OVZA 3H7DA 1NB3A 1YK8A 4K7CA 2FQ9A 2IBIA 3QJ3A 3RVVA 2F1GA 2FTDA 2FT2A 1PADA 2HH5A 2DC6A 1GLOA 3OQCA 3PSEA 2AGAA 1FH0A 3O0UA 1HUCB 1SP4B 1DF0A 2HWKA 4GUAA 4RKXA 5F02A 3OISA 3IHPA 3P5WA 4MSXA 4N4ZA 4I05A 4RF1A 1YZBA 3USVA 3BB7A 2P0RA 4IP3A 2VHSA 2FYEA 1AU2A 3OVXA 4YYWA 3TRKA 4HWYA 2HHNA 5JZEA 1NL6A 4BOQA 1DEUA 3BBAA 5J94A 3M99A 1NQCA 3HHIA 3HD3A 1K3BB 4RY2A 2DOSA 2J7QA 5CVMA 2XU3A 4YYVA 4QRXA 1U9VA 2DJGB 5E6JA 4Q8GA 4XR7A 1NLJA 2OP3A 1F2AA 1CPJA 1MIRA 1YK7A 1CVZA 5CHVA 2PADA 3P5UA 2YJBA 1XKGA 4PP2E 1CSBB 1U5IA 3KX1A 1EWOA 1PCIA 3PHXA 1Y4HA 1PVJA 1NB5A 2BTWB 2FRQA 4XZXA 2BDLA 1ITOA 1KXRA 3PW3A 3IUTA 4DMXA 3IOQA 2B1MA 3KFQA 3O1GA 3RVXA 1TLOA 4AXMA 1F2BA 3V6EA 1CJLA 2FRAA 1O0EA 3IMAA 3MTVA 3PBHA 4QRGA 2HXZA 1UKFA 2OZ2A 3CH2X 4BOZA 4ZUXU 2ARYA 2UZJA 2YJ8A 1BGOA 4FK5A 3K8UA 2B1NA 2VHFA 2G8JA 1QMYA 3WXEA 1GMYA 2G8EA 2BTWA 3LFYA 1PPDA 4DMYA 5JA7A 2AIMA 3NHEA 5JH3A 1MEGA 3IEJA 4FIPA 3BY4A 3TNXA 3GCBA 1AYUA 3K9MA 3CBKA 2CIOA 1DKIA 4N79A 4YVAA 4FJCA 3ERVA 4MZOA 4PI3A 3HWNA 3I3TA 4X6HA 5CVOB 3MP2A 1AECA 2DCAA 2O6XA 3E9SA 1KFXL 4P6GA 7PCKA 4QBBA 3D6SA 3WXFA 4BOPA 4OVZA 2DC7A 3S3RA 1GECE 3F75A 2GFOA 2DC9A 2P86A 3H8CA 3S3QA 4D8IA 1THEA 5CHTA 5FPWA 4MI7A 4W5BA 4WURA 3B21A 3KWBX 1PPOA 1JQPA 1PPPA 2JRIA 2R9MA 3MTNA 2ACTA 3ZUAA 5K16A 8PCHA 3KWZA 5EF4A 3WXGA 5A24A 3H89A 4RF0A 4A5UA 3CBJA 1ME4A 1PPNA 1VSNA 4YYQA 3OF9A 4BQVA 4YV8A 4XUIA 6PADA 4RNAA 2XU1A 3K24A 3PRPA 1MHWA 2IPPB 4BOUA 2DZZA 2PNSA 4OELA 3N3GA 3IFUA 2JQGR 1CS8A 3KKUA 4M0WA 4CDEB 4I04A 4QRVA 2R9OA 3HHAA 2ATOA 4X6JA 2JTCA 4W5CA 3ZNHA 2CB5A 1YALA 4ZTBA 1ZCMA 3E1ZB 1EF7A 4MM3B 1PIPA 1A6RA 2PBHA 1EWPA 3H8BA 1U9WA 3BCNA 3O65A 2DCCA 4P6EA 1S4VA 2E02A 4PP1A 5EZQA 3QSDA 3RVWA 1YT7A 1SNKA 1ZIVA 2AS8A 1YVBA 2P7UA 3MHSA 4OVZB 1NPZA 4BSQA 4REZA 1Q6KA 4YYSA 2DZYA 4PT5A 1KHQA 2Z84A 2FUDA 1QOLA 1CV8A 2Y6EA 3MORA 2AVWA 1QXPA 2DCDA 2C0YA 1F2CA 4D8EA 3BPMA 2AYOA
chains in the Genus database with same CATH topology
3AI8A 2XU5A 1PE6A 3KW9A 1Y08A 3N3KA 3OF8A 3F5VA 5CVNB 2FO5A 4PADA 2R9CA 1STFE 2YJCA 2E00A 1AU0A 4W4UA 1MEMA 4BPVA 2E01A 2OULA 1X9YA 4KLBA 2Y5BA 2HD5A 4C5PA 4BS5A 1POPA 4CZWA 2AUXA 2NQAA 1AYVA 1E2TA 4YYUA 1ATKA 1IWDA 5PADA 1BP4A 1ICFA 1KFUL 4X6IA 3P5VA 3LXSA 3BOWA 4WA6A 1EWMA 1BY8A 4BS6A 3BC3A 4CDCB 2AUZA 4Q8HA 1PXVA 1GCBA 1U9QX 2PREA 4OEMA 1AIMA 2H7JA 2R6NA 2NQIA 3DF0A 1F29A 2XU4A 2BDZA 1PBHA 2NQGA 3KSEA 3MHHA 3H6SA 4CDFB 3CH3X 1CQDA 3BWKA 2DC8A 1BQIA 3N4CA 5EGWA 2AYNA 2DCBA 1VJVA 4MZSA 2YJ2A 2AU1A 4I07A 1TL9A 2R9NA 4N8WA 2F7DA 1QDQA 2JQFR 4G54A 2DJFB 3IV2A 1AU3A 1ME3A 4CDDB 2WBFX 1U9XA 3B79A 3PDFA 4AXLA 4B55A 2R9FA 4QH6A 2BSZA 4NV7A 1CTEA 3U8EA 9PAPA 2E03A 3BPFA 1MS6A 3PNRA 3I06A 1M6DA 2G6DA 2NQDB 3V6CA 3C9EA 3P5XA 1TU6A 1CB5A 4YYRA 2YJ9A 2G7YA 1AYWA 1KHPA 1AU4A 1MDWA 3QT4A 1EWLA 2GHUA 3OVZA 3H7DA 1NB3A 4K7CA 1YK8A 2FQ9A 4BGFA 2IBIA 3QJ3A 3RVVA 2F1GA 2FTDA 2FT2A 1PADA 2HH5A 2DC6A 1GLOA 1W6FA 1FH0A 1GX3A 3O0UA 1HUCB 1SP4B 1DF0A 5F02A 3OISA 3IHPA 3P5WA 4MSXA 2VFCA 4N4ZA 4I05A 3USVA 2P0RA 2VHSA 2FYEA 1AU2A 3OVXA 4YYWA 4HWYA 2HHNA 1NL6A 1DEUA 5J94A 3M99A 1NQCA 3HHIA 3HD3A 1K3BB 4RY2A 5CVMA 2XU3A 4YYVA 4QRXA 1U9VA 2DJGB 4Q8GA 4XR7A 1NLJA 2OP3A 1F2AA 1CPJA 1MIRA 1YK7A 1CVZA 5CHVA 2PADA 3P5UA 2YJBA 1XKGA 4PP2E 1CSBB 1U5IA 3KX1A 1EWOA 1PCIA 1Y4HA 1NB5A 2FRQA 2BDLA 1ITOA 1KXRA 3PW3A 3IUTA 4DMXA 3IOQA 2B1MA 3KFQA 3O1GA 3RVXA 1TLOA 4AXMA 1F2BA 3V6EA 1CJLA 2FRAA 1O0EA 3IMAA 3PBHA 4QRGA 2HXZA 2OZ2A 3CH2X 4ZUXU 2ARYA 2YJ8A 1BGOA 4FK5A 3K8UA 2B1NA 2VHFA 1W5RA 2G8JA 1QMYA 3WXEA 1GMYA 2G8EA 3LFYA 1PPDA 4DMYA 5JA7A 2AIMA 3NHEA 5JH3A 1MEGA 3IEJA 4FIPA 3TNXA 3GCBA 1AYUA 3K9MA 3CBKA 2CIOA 4N79A 4YVAA 4FJCA 3ERVA 4MZOA 4PI3A 3HWNA 3I3TA 4X6HA 5CVOB 1AECA 2DCAA 2O6XA 1KFXL 4P6GA 7PCKA 4QBBA 3D6SA 4NV8A 3WXFA 2DC7A 3S3RA 1GECE 3F75A 2GFOA 2DC9A 2P86A 3H8CA 3S3QA 1THEA 5CHTA 5FPWA 4W5BA 3KWBX 1PPOA 1JQPA 1PPPA 2R9MA 3MTNA 2ACTA 3ZUAA 5K16A 8PCHA 3KWZA 5EF4A 3WXGA 5A24A 3H89A 3CBJA 1ME4A 1PPNA 1VSNA 4YYQA 3OF9A 4BQVA 4YV8A 4XUIA 6PADA 2XU1A 3K24A 1MHWA 2IPPB 2DZZA 2PNSA 4OELA 3N3GA 2JQGR 1CS8A 3KKUA 4CDEB 4I04A 4QRVA 2R9OA 3HHAA 2ATOA 4X6JA 4W5CA 2CB5A 1YALA 1ZCMA 3E1ZB 1EF7A 1PIPA 2VFBA 1A6RA 2PBHA 1EWPA 3H8BA 3D9WA 1U9WA 3BCNA 3LTWA 2DCCA 4P6EA 1S4VA 2E02A 4PP1A 1W4TA 3QSDA 3RVWA 1YT7A 1SNKA 1ZIVA 2AS8A 1YVBA 2P7UA 3MHSA 1NPZA 4BSQA 1Q6KA 4YYSA 2DZYA 1KHQA 4GUZA 2FUDA 1QOLA 1CV8A 2Y6EA 3MORA 2AVWA 1QXPA 2DCDA 2C0YA 1F2CA 3BPMA 2AYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AI8 A;  2XU5 A;  1PE6 A;  3KW9 A;  1Y08 A;  3N3K A;  3OF8 A;  3F5V A;  5CVN B;  2FO5 A;  4PAD A;  2R9C A;  1STF E;  2YJC A;  2E00 A;  1AU0 A;  4W4U A;  1MEM A;  4BPV A;  2E01 A;  2OUL A;  1X9Y A;  4KLB A;  2Y5B A;  2HD5 A;  4BS5 A;  1POP A;  4CZW A;  2AUX A;  2NQA A;  1AYV A;  4YYU A;  1ATK A;  1IWD A;  5PAD A;  1BP4 A;  1ICF A;  1KFU L;  4X6I A;  3P5V A;  3LXS A;  3BOW A;  4WA6 A;  1EWM A;  1BY8 A;  4BS6 A;  3BC3 A;  4CDC B;  2AUZ A;  4Q8H A;  1PXV A;  1GCB A;  1U9Q X;  2PRE A;  4OEM A;  1AIM A;  2H7J A;  2R6N A;  2NQI A;  3DF0 A;  1F29 A;  2XU4 A;  2BDZ A;  1PBH A;  2NQG A;  3KSE A;  3MHH A;  3H6S A;  4CDF B;  3CH3 X;  1CQD A;  3BWK A;  2DC8 A;  1BQI A;  3N4C A;  5EGW A;  2AYN A;  2DCB A;  1VJV A;  4MZS A;  2YJ2 A;  2AU1 A;  4I07 A;  1TL9 A;  2R9N A;  4N8W A;  2F7D A;  1QDQ A;  2JQF R;  4G54 A;  2DJF B;  3IV2 A;  1AU3 A;  1ME3 A;  4CDD B;  2WBF X;  1U9X A;  3B79 A;  3PDF A;  4AXL A;  2R9F A;  4QH6 A;  1CTE A;  3U8E A;  9PAP A;  2E03 A;  3BPF A;  1MS6 A;  3PNR A;  3I06 A;  1M6D A;  2G6D A;  2NQD B;  3V6C A;  3C9E A;  3P5X A;  1TU6 A;  1CB5 A;  4YYR A;  2YJ9 A;  2G7Y A;  1AYW A;  1KHP A;  1AU4 A;  1MDW A;  3QT4 A;  1EWL A;  2GHU A;  3OVZ A;  3H7D A;  1NB3 A;  1YK8 A;  4K7C A;  2FQ9 A;  2IBI A;  3QJ3 A;  3RVV A;  2F1G A;  2FTD A;  2FT2 A;  1PAD A;  2HH5 A;  2DC6 A;  1GLO A;  1FH0 A;  3O0U A;  1HUC B;  1SP4 B;  1DF0 A;  5F02 A;  3OIS A;  3IHP A;  3P5W A;  4MSX A;  4N4Z A;  4I05 A;  3USV A;  2P0R A;  2VHS A;  2FYE A;  1AU2 A;  3OVX A;  4YYW A;  4HWY A;  2HHN A;  1NL6 A;  1DEU A;  5J94 A;  3M99 A;  1NQC A;  3HHI A;  3HD3 A;  1K3B B;  4RY2 A;  5CVM A;  2XU3 A;  4YYV A;  4QRX A;  1U9V A;  2DJG B;  4Q8G A;  4XR7 A;  1NLJ A;  2OP3 A;  1F2A A;  1CPJ A;  1MIR A;  1YK7 A;  1CVZ A;  5CHV A;  2PAD A;  3P5U A;  2YJB A;  1XKG A;  4PP2 E;  1CSB B;  1U5I A;  3KX1 A;  1EWO A;  1PCI A;  1Y4H A;  1NB5 A;  2FRQ A;  2BDL A;  1ITO A;  1KXR A;  3PW3 A;  3IUT A;  4DMX A;  3IOQ A;  2B1M A;  3KFQ A;  3O1G A;  3RVX A;  1TLO A;  4AXM A;  1F2B A;  3V6E A;  1CJL A;  2FRA A;  1O0E A;  3IMA A;  3PBH A;  4QRG A;  2HXZ A;  2OZ2 A;  3CH2 X;  4ZUX U;  2ARY A;  2YJ8 A;  1BGO A;  4FK5 A;  3K8U A;  2B1N A;  2VHF A;  2G8J A;  1QMY A;  3WXE A;  1GMY A;  2G8E A;  3LFY A;  1PPD A;  4DMY A;  5JA7 A;  2AIM A;  3NHE A;  5JH3 A;  1MEG A;  3IEJ A;  4FIP A;  3TNX A;  3GCB A;  1AYU A;  3K9M A;  3CBK A;  2CIO A;  4N79 A;  4YVA A;  4FJC A;  3ERV A;  4MZO A;  4PI3 A;  3HWN A;  3I3T A;  4X6H A;  5CVO B;  1AEC A;  2DCA A;  2O6X A;  1KFX L;  4P6G A;  7PCK A;  4QBB A;  3D6S A;  3WXF A;  2DC7 A;  3S3R A;  1GEC E;  3F75 A;  2GFO A;  2DC9 A;  2P86 A;  3H8C A;  3S3Q A;  1THE A;  5CHT A;  5FPW A;  4W5B A;  3KWB X;  1PPO A;  1JQP A;  1PPP A;  2R9M A;  3MTN A;  2ACT A;  3ZUA A;  5K16 A;  8PCH A;  3KWZ A;  5EF4 A;  3WXG A;  5A24 A;  3H89 A;  3CBJ A;  1ME4 A;  1PPN A;  1VSN A;  4YYQ A;  3OF9 A;  4BQV A;  4YV8 A;  4XUI A;  6PAD A;  2XU1 A;  3K24 A;  1MHW A;  2IPP B;  2DZZ A;  2PNS A;  4OEL A;  3N3G A;  2JQG R;  1CS8 A;  3KKU A;  4CDE B;  4I04 A;  4QRV A;  2R9O A;  3HHA A;  2ATO A;  4X6J A;  4W5C A;  2CB5 A;  1YAL A;  1ZCM A;  3E1Z B;  1EF7 A;  1PIP A;  1A6R A;  2PBH A;  1EWP A;  3H8B A;  1U9W A;  3BCN A;  2DCC A;  4P6E A;  1S4V A;  2E02 A;  4PP1 A;  3QSD A;  3RVW A;  1YT7 A;  1SNK A;  1ZIV A;  2AS8 A;  1YVB A;  2P7U A;  3MHS A;  1NPZ A;  4BSQ A;  1Q6K A;  4YYS A;  2DZY A;  1KHQ A;  2FUD A;  1QOL A;  1CV8 A;  2Y6E A;  3MOR A;  2AVW A;  1QXP A;  2DCD A;  2C0Y A;  1F2C A;  3BPM A;  2AYO A; 
#chains in the Genus database with same CATH topology
 3AI8 A;  2BU3 A;  3PRM A;  2XU5 A;  1PE6 A;  3KW9 A;  1Y08 A;  3N3K A;  3OF8 A;  3F5V A;  5CVN B;  2FO5 A;  4PAD A;  2R9C A;  3PHU A;  1STF E;  2YJC A;  4D8B A;  2E00 A;  1AU0 A;  4W4U A;  1MEM A;  4BPV A;  2E01 A;  2OUL A;  4P16 A;  1X9Y A;  4KLB A;  2Y5B A;  2HD5 A;  5EZS A;  4BS5 A;  1POP A;  4CZW A;  2AUX A;  2NQA A;  1AYV A;  3C0R A;  3PHW A;  4YYU A;  1ATK A;  1IWD A;  4IUM A;  5PAD A;  1BP4 A;  1ICF A;  1KFU L;  4X6I A;  3P5V A;  5KO3 A;  3LXS A;  3BOW A;  4WA6 A;  1EWM A;  1BY8 A;  4BS6 A;  3BC3 A;  4CDC B;  2AUZ A;  4Q8H A;  1PXV A;  1GCB A;  1U9Q X;  2PRE A;  4OEM A;  1AIM A;  2H7J A;  2R6N A;  2NQI A;  3DF0 A;  4BOS A;  1F29 A;  2XU4 A;  2BDZ A;  1PBH A;  2NQG A;  3KSE A;  3MHH A;  3H6S A;  4CDF B;  3CH3 X;  1CQD A;  3BWK A;  2DC8 A;  1BQI A;  3PT2 A;  3N4C A;  5EGW A;  3MJ5 A;  2AYN A;  2DCB A;  1VJV A;  4MZS A;  2YJ2 A;  2AU1 A;  4I07 A;  1TL9 A;  2R9N A;  4N8W A;  2F7D A;  3W31 A;  1QDQ A;  2JQF R;  4HXD B;  4G54 A;  2DJF B;  2J7Q C;  3IV2 A;  1AU3 A;  1ME3 A;  4CDD B;  2WBF X;  4R3D A;  1U9X A;  3B79 A;  3PDF A;  4AXL A;  3RNV A;  2R9F A;  3W30 A;  4QH6 A;  1CTE A;  4OW0 A;  3U8E A;  9PAP A;  2E03 A;  3BPF A;  1MS6 A;  3TMP A;  3PNR A;  3I06 A;  1M6D A;  2G6D A;  2NQD B;  3V6C A;  2FE8 A;  3C9E A;  3P5X A;  1TU6 A;  1CB5 A;  4YYR A;  2YJ9 A;  2G7Y A;  1AYW A;  1KHP A;  1AU4 A;  1MDW A;  3QT4 A;  1EWL A;  2GHU A;  3OVZ A;  3H7D A;  1NB3 A;  1YK8 A;  4K7C A;  2FQ9 A;  2IBI A;  3QJ3 A;  3RVV A;  2F1G A;  2FTD A;  2FT2 A;  1PAD A;  2HH5 A;  2DC6 A;  1GLO A;  3OQC A;  3PSE A;  2AGA A;  1FH0 A;  3O0U A;  1HUC B;  1SP4 B;  1DF0 A;  2HWK A;  4GUA A;  4RKX A;  5F02 A;  3OIS A;  3IHP A;  3P5W A;  4MSX A;  4N4Z A;  4I05 A;  4RF1 A;  1YZB A;  3USV A;  3BB7 A;  2P0R A;  4IP3 A;  2VHS A;  2FYE A;  1AU2 A;  3OVX A;  4YYW A;  3TRK A;  4HWY A;  2HHN A;  5JZE A;  1NL6 A;  4BOQ A;  1DEU A;  3BBA A;  5J94 A;  3M99 A;  1NQC A;  3HHI A;  3HD3 A;  1K3B B;  4RY2 A;  2DOS A;  2J7Q A;  5CVM A;  2XU3 A;  4YYV A;  4QRX A;  1U9V A;  2DJG B;  5E6J A;  4Q8G A;  4XR7 A;  1NLJ A;  2OP3 A;  1F2A A;  1CPJ A;  1MIR A;  1YK7 A;  1CVZ A;  5CHV A;  2PAD A;  3P5U A;  2YJB A;  1XKG A;  4PP2 E;  1CSB B;  1U5I A;  3KX1 A;  1EWO A;  1PCI A;  3PHX A;  1Y4H A;  1PVJ A;  1NB5 A;  2BTW B;  2FRQ A;  4XZX A;  2BDL A;  1ITO A;  1KXR A;  3PW3 A;  3IUT A;  4DMX A;  3IOQ A;  2B1M A;  3KFQ A;  3O1G A;  3RVX A;  1TLO A;  4AXM A;  1F2B A;  3V6E A;  1CJL A;  2FRA A;  1O0E A;  3IMA A;  3MTV A;  3PBH A;  4QRG A;  2HXZ A;  1UKF A;  2OZ2 A;  3CH2 X;  4BOZ A;  4ZUX U;  2ARY A;  2UZJ A;  2YJ8 A;  1BGO A;  4FK5 A;  3K8U A;  2B1N A;  2VHF A;  2G8J A;  1QMY A;  3WXE A;  1GMY A;  2G8E A;  2BTW A;  3LFY A;  1PPD A;  4DMY A;  5JA7 A;  2AIM A;  3NHE A;  5JH3 A;  1MEG A;  3IEJ A;  4FIP A;  3BY4 A;  3TNX A;  3GCB A;  1AYU A;  3K9M A;  3CBK A;  2CIO A;  1DKI A;  4N79 A;  4YVA A;  4FJC A;  3ERV A;  4MZO A;  4PI3 A;  3HWN A;  3I3T A;  4X6H A;  5CVO B;  3MP2 A;  1AEC A;  2DCA A;  2O6X A;  3E9S A;  1KFX L;  4P6G A;  7PCK A;  4QBB A;  3D6S A;  3WXF A;  4BOP A;  4OVZ A;  2DC7 A;  3S3R A;  1GEC E;  3F75 A;  2GFO A;  2DC9 A;  2P86 A;  3H8C A;  3S3Q A;  4D8I A;  1THE A;  5CHT A;  5FPW A;  4MI7 A;  4W5B A;  4WUR A;  3B21 A;  3KWB X;  1PPO A;  1JQP A;  1PPP A;  2JRI A;  2R9M A;  3MTN A;  2ACT A;  3ZUA A;  5K16 A;  8PCH A;  3KWZ A;  5EF4 A;  3WXG A;  5A24 A;  3H89 A;  4RF0 A;  4A5U A;  3CBJ A;  1ME4 A;  1PPN A;  1VSN A;  4YYQ A;  3OF9 A;  4BQV A;  4YV8 A;  4XUI A;  6PAD A;  4RNA A;  2XU1 A;  3K24 A;  3PRP A;  1MHW A;  2IPP B;  4BOU A;  2DZZ A;  2PNS A;  4OEL A;  3N3G A;  3IFU A;  2JQG R;  1CS8 A;  3KKU A;  4M0W A;  4CDE B;  4I04 A;  4QRV A;  2R9O A;  3HHA A;  2ATO A;  4X6J A;  2JTC A;  4W5C A;  3ZNH A;  2CB5 A;  1YAL A;  4ZTB A;  1ZCM A;  3E1Z B;  1EF7 A;  4MM3 B;  1PIP A;  1A6R A;  2PBH A;  1EWP A;  3H8B A;  1U9W A;  3BCN A;  3O65 A;  2DCC A;  4P6E A;  1S4V A;  2E02 A;  4PP1 A;  5EZQ A;  3QSD A;  3RVW A;  1YT7 A;  1SNK A;  1ZIV A;  2AS8 A;  1YVB A;  2P7U A;  3MHS A;  4OVZ B;  1NPZ A;  4BSQ A;  4REZ A;  1Q6K A;  4YYS A;  2DZY A;  4PT5 A;  1KHQ A;  2Z84 A;  2FUD A;  1QOL A;  1CV8 A;  2Y6E A;  3MOR A;  2AVW A;  1QXP A;  2DCD A;  2C0Y A;  1F2C A;  4D8E A;  3BPM A;  2AYO A; 
#chains in the Genus database with same CATH homology
 3AI8 A;  2XU5 A;  1PE6 A;  3KW9 A;  1Y08 A;  3N3K A;  3OF8 A;  3F5V A;  5CVN B;  2FO5 A;  4PAD A;  2R9C A;  1STF E;  2YJC A;  2E00 A;  1AU0 A;  4W4U A;  1MEM A;  4BPV A;  2E01 A;  2OUL A;  1X9Y A;  4KLB A;  2Y5B A;  2HD5 A;  4C5P A;  4BS5 A;  1POP A;  4CZW A;  2AUX A;  2NQA A;  1AYV A;  1E2T A;  4YYU A;  1ATK A;  1IWD A;  5PAD A;  1BP4 A;  1ICF A;  1KFU L;  4X6I A;  3P5V A;  3LXS A;  3BOW A;  4WA6 A;  1EWM A;  1BY8 A;  4BS6 A;  3BC3 A;  4CDC B;  2AUZ A;  4Q8H A;  1PXV A;  1GCB A;  1U9Q X;  2PRE A;  4OEM A;  1AIM A;  2H7J A;  2R6N A;  2NQI A;  3DF0 A;  1F29 A;  2XU4 A;  2BDZ A;  1PBH A;  2NQG A;  3KSE A;  3MHH A;  3H6S A;  4CDF B;  3CH3 X;  1CQD A;  3BWK A;  2DC8 A;  1BQI A;  3N4C A;  5EGW A;  2AYN A;  2DCB A;  1VJV A;  4MZS A;  2YJ2 A;  2AU1 A;  4I07 A;  1TL9 A;  2R9N A;  4N8W A;  2F7D A;  1QDQ A;  2JQF R;  4G54 A;  2DJF B;  3IV2 A;  1AU3 A;  1ME3 A;  4CDD B;  2WBF X;  1U9X A;  3B79 A;  3PDF A;  4AXL A;  4B55 A;  2R9F A;  4QH6 A;  2BSZ A;  4NV7 A;  1CTE A;  3U8E A;  9PAP A;  2E03 A;  3BPF A;  1MS6 A;  3PNR A;  3I06 A;  1M6D A;  2G6D A;  2NQD B;  3V6C A;  3C9E A;  3P5X A;  1TU6 A;  1CB5 A;  4YYR A;  2YJ9 A;  2G7Y A;  1AYW A;  1KHP A;  1AU4 A;  1MDW A;  3QT4 A;  1EWL A;  2GHU A;  3OVZ A;  3H7D A;  1NB3 A;  4K7C A;  1YK8 A;  2FQ9 A;  4BGF A;  2IBI A;  3QJ3 A;  3RVV A;  2F1G A;  2FTD A;  2FT2 A;  1PAD A;  2HH5 A;  2DC6 A;  1GLO A;  1W6F A;  1FH0 A;  1GX3 A;  3O0U A;  1HUC B;  1SP4 B;  1DF0 A;  5F02 A;  3OIS A;  3IHP A;  3P5W A;  4MSX A;  2VFC A;  4N4Z A;  4I05 A;  3USV A;  2P0R A;  2VHS A;  2FYE A;  1AU2 A;  3OVX A;  4YYW A;  4HWY A;  2HHN A;  1NL6 A;  1DEU A;  5J94 A;  3M99 A;  1NQC A;  3HHI A;  3HD3 A;  1K3B B;  4RY2 A;  5CVM A;  2XU3 A;  4YYV A;  4QRX A;  1U9V A;  2DJG B;  4Q8G A;  4XR7 A;  1NLJ A;  2OP3 A;  1F2A A;  1CPJ A;  1MIR A;  1YK7 A;  1CVZ A;  5CHV A;  2PAD A;  3P5U A;  2YJB A;  1XKG A;  4PP2 E;  1CSB B;  1U5I A;  3KX1 A;  1EWO A;  1PCI A;  1Y4H A;  1NB5 A;  2FRQ A;  2BDL A;  1ITO A;  1KXR A;  3PW3 A;  3IUT A;  4DMX A;  3IOQ A;  2B1M A;  3KFQ A;  3O1G A;  3RVX A;  1TLO A;  4AXM A;  1F2B A;  3V6E A;  1CJL A;  2FRA A;  1O0E A;  3IMA A;  3PBH A;  4QRG A;  2HXZ A;  2OZ2 A;  3CH2 X;  4ZUX U;  2ARY A;  2YJ8 A;  1BGO A;  4FK5 A;  3K8U A;  2B1N A;  2VHF A;  1W5R A;  2G8J A;  1QMY A;  3WXE A;  1GMY A;  2G8E A;  3LFY A;  1PPD A;  4DMY A;  5JA7 A;  2AIM A;  3NHE A;  5JH3 A;  1MEG A;  3IEJ A;  4FIP A;  3TNX A;  3GCB A;  1AYU A;  3K9M A;  3CBK A;  2CIO A;  4N79 A;  4YVA A;  4FJC A;  3ERV A;  4MZO A;  4PI3 A;  3HWN A;  3I3T A;  4X6H A;  5CVO B;  1AEC A;  2DCA A;  2O6X A;  1KFX L;  4P6G A;  7PCK A;  4QBB A;  3D6S A;  4NV8 A;  3WXF A;  2DC7 A;  3S3R A;  1GEC E;  3F75 A;  2GFO A;  2DC9 A;  2P86 A;  3H8C A;  3S3Q A;  1THE A;  5CHT A;  5FPW A;  4W5B A;  3KWB X;  1PPO A;  1JQP A;  1PPP A;  2R9M A;  3MTN A;  2ACT A;  3ZUA A;  5K16 A;  8PCH A;  3KWZ A;  5EF4 A;  3WXG A;  5A24 A;  3H89 A;  3CBJ A;  1ME4 A;  1PPN A;  1VSN A;  4YYQ A;  3OF9 A;  4BQV A;  4YV8 A;  4XUI A;  6PAD A;  2XU1 A;  3K24 A;  1MHW A;  2IPP B;  2DZZ A;  2PNS A;  4OEL A;  3N3G A;  2JQG R;  1CS8 A;  3KKU A;  4CDE B;  4I04 A;  4QRV A;  2R9O A;  3HHA A;  2ATO A;  4X6J A;  4W5C A;  2CB5 A;  1YAL A;  1ZCM A;  3E1Z B;  1EF7 A;  1PIP A;  2VFB A;  1A6R A;  2PBH A;  1EWP A;  3H8B A;  3D9W A;  1U9W A;  3BCN A;  3LTW A;  2DCC A;  4P6E A;  1S4V A;  2E02 A;  4PP1 A;  1W4T A;  3QSD A;  3RVW A;  1YT7 A;  1SNK A;  1ZIV A;  2AS8 A;  1YVB A;  2P7U A;  3MHS A;  1NPZ A;  4BSQ A;  1Q6K A;  4YYS A;  2DZY A;  1KHQ A;  4GUZ A;  2FUD A;  1QOL A;  1CV8 A;  2Y6E A;  3MOR A;  2AVW A;  1QXP A;  2DCD A;  2C0Y A;  1F2C A;  3BPM A;  2AYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...