1U9VA

Crystal structure of the cysteine protease human cathepsin k in complex with the covalent inhibitor nvp-abe854
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin K
publication title Novel purine nitrile derived inhibitors of the cysteine protease cathepsin K
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 62
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2004-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1u9vA00
1MS6A 1TLOA 2R9FA 1ZIVA 3H7DA 3P5XA 4AXMA 2HXZA 1M6DA 3KFQA 2P86A 4N79A 2DC9A 5JH3A 4K7CA 5A24A 2F7DA 1XKGA 2CB5A 1ME4A 2NQAA 1DEUA 2G8JA 2AIMA 2E00A 3ZUAA 2F1GA 1VSNA 1S4VA 1TL9A 1HUCB 3KKUA 1ITOA 4YVAA 3BC3A 3P5VA 1U9QX 4CDCB 7PCKA 2ARYA 1O0EA 2NQDB 2YJBA 2JQFR 1CV8A 2FRAA 5CVOB 4HWYA 4FK5A 2IBIA 3N4CA 4Q8GA 2Y6EA 1BQIA 3HHIA 4YYRA 2FYEA 1FH0A 4CDFB 1AU2A 5JA7A 4PADA 4MZSA 1AYWA 1YALA 3IEJA 3USVA 2OULA 1STFE 2NQIA 2E03A 3DF0A 4OELA 2C0YA 2R9CA 2AUXA 4RY2A 3V6CA 4ZUXU 4N4ZA 3P5UA 2YJ9A 5CVNB 3CH2X 4YYWA 2AVWA 1GMYA 2FO5A 2DC6A 1CJLA 1NB5A 4I04A 4YYSA 1POPA 4P6EA 2P0RA 2WBFX 5PADA 3O0UA 2ACTA 3S3QA 1ICFA 5EF4A 3BWKA 1KXRA 4BS6A 1JQPA 1PCIA 3PW3A 3OISA 1CTEA 1EWLA 3OVXA 1THEA 1NB3A 3K8UA 1DF0A 1KHPA 1BGOA 5K16A 3B79A 2FT2A 5EGWA 4BQVA 4FIPA 2XU1A 2DCAA 2HD5A 3OVZA 2XU5A 2BDLA 3BOWA 3C9EA 3U8EA 3CH3X 3F5VA 2AUZA 1GECE 1MIRA 3GCBA 2GHUA 1PPPA 2ATOA 1PIPA 3RVWA 1QOLA 8PCHA 5FPWA 1PXVA 1SP4B 3D6SA 1U9XA 1A6RA 2YJ2A 3WXGA 3IHPA 2R6NA 4YYQA 9PAPA 1EWMA 2DJFB 1Q6KA 2R9MA 3I06A 2G6DA 3QJ3A 2FTDA 1NL6A 1YT7A 3ERVA 2FUDA 1GCBA 2YJ8A 2G8EA 6PADA 4PP1A 3TNXA 3CBKA 1AYUA 4QBBA 4PI3A 3PBHA 1NPZA 1KFUL 4CDDB 2DC8A 3F75A 1PBHA 3IUTA 3MHSA 2XU4A 2R9OA 4XR7A 3KSEA 1ZCMA 1BY8A 3PDFA 1CB5A 4BS5A 4G54A 1CVZA 4QRVA 1MEGA 3OF8A 5F02A 1CS8A 3IOQA 2AYNA 4X6JA 1EF7A 1F2CA 3BCNA 1SNKA 1Y4HA 1YK7A 3MTNA 3K24A 4BSQA 2JQGR 1GLOA 3S3RA 2NQGA 1TU6A 1EWPA 1U9VA 3E1ZB 1CQDA 3WXEA 3WXFA 2VHSA 3MHHA 4I05A 3HD3A 1KFXL 1AYVA 4CDEB 4DMXA 4OEMA 1K3BB 2DC7A 4AXLA 2G7YA 3M99A 1BP4A 2YJCA 5CHVA 4QRXA 3QT4A 3V6EA 2Y5BA 3NHEA 1PADA 3KWBX 1CSBB 1U5IA 1F2BA 2AS8A 4N8WA 1NLJA 4CZWA 2DCBA 2BDZA 2CIOA 2DCCA 2AU1A 3BPFA 3N3KA 4FJCA 1AU4A 1PPNA 1PPDA 3HHAA 4KLBA 1EWOA 3LXSA 3KWZA 2DJGB 4W5BA 4YV8A 3I3TA 1F29A 3H89A 2B1MA 1U9WA 2FRQA 2XU3A 2VHFA 4MSXA 4YYUA 1X9YA 3LFYA 4W5CA 2GFOA 1Y08A 2HH5A 1AU0A 1AIMA 1ME3A 5J94A 3MORA 2PNSA 1F2AA 4I07A 2DCDA 1KHQA 2IPPB 3RVXA 1QMYA 4PP2E 3KW9A 4QRGA 2HHNA 3CBJA 2OP3A 2E02A 3IV2A 2DZZA 1AECA 4BPVA 1IWDA 1MHWA 2R9NA 3RVVA 1YVBA 1MEMA 2DZYA 2OZ2A 2O6XA 4WA6A 2PADA 3HWNA 2AYOA 4XUIA 1YK8A 1ATKA 3AI8A 3QSDA 1PPOA 3H6SA 4MZOA 5CHTA 3H8CA 3H8BA 3P5WA 2PREA 4QH6A 1AU3A 4P6GA 3PNRA 2B1NA 2H7JA 4W4UA 1QDQA 3K9MA 3BPMA 3IMAA 4YYVA 3KX1A 2PBHA 4DMYA 4Q8HA 3OF9A 4X6HA 3O1GA 4X6IA 2FQ9A 1MDWA 1CPJA 5CVMA 2E01A 3N3GA 1PE6A 1QXPA 2P7UA 1NQCA 1VJVA
chains in the Genus database with same CATH superfamily
1MS6A 1TLOA 2R9FA 1ZIVA 4D8IA 3H7DA 3P5XA 4AXMA 2HXZA 3PRMA 1M6DA 3KFQA 2P86A 4N79A 2DC9A 5JH3A 4K7CA 5A24A 2JTCA 2F7DA 1XKGA 2CB5A 1ME4A 2NQAA 1DEUA 2G8JA 2AIMA 2E00A 3ZUAA 2F1GA 1VSNA 1S4VA 1TL9A 4IUMA 1HUCB 3KKUA 3BBAA 3PHUA 3B21A 1ITOA 4YVAA 3BC3A 3P5VA 1U9QX 4GUAA 4CDCB 7PCKA 2ARYA 1O0EA 2NQDB 2YJBA 2JQFR 1CV8A 2FRAA 5CVOB 4HWYA 4FK5A 4A5UA 2IBIA 3N4CA 4Q8GA 3W31A 2Y6EA 1BQIA 3HHIA 4YYRA 2FYEA 3MTVA 1FH0A 4CDFB 1AU2A 5JA7A 4BOQA 4PADA 4MZSA 1AYWA 1YALA 3IEJA 3USVA 2OULA 3E9SA 1STFE 4OVZB 2NQIA 2E03A 3DF0A 4OELA 2C0YA 2R9CA 2AUXA 4RY2A 3V6CA 4ZUXU 4RNAA 4N4ZA 3P5UA 2YJ9A 5CVNB 3CH2X 4YYWA 2AVWA 1GMYA 2FO5A 4PT5A 2DC6A 1CJLA 3PHWA 1NB5A 4I04A 4YYSA 1POPA 4P6EA 5EZQA 2P0RA 2WBFX 3W30A 5PADA 3O0UA 2ACTA 3S3QA 1ICFA 4REZA 5EF4A 3BWKA 3PHXA 5JZEA 1KXRA 4BS6A 1JQPA 1PCIA 3PW3A 1DKIA 3OISA 1CTEA 1EWLA 3OVXA 1THEA 4BOPA 1NB3A 3K8UA 2BTWA 1DF0A 1KHPA 1BGOA 5K16A 3B79A 2FT2A 5EGWA 4BQVA 4FIPA 2XU1A 2DCAA 4P16A 2HD5A 3OVZA 3PSEA 2XU5A 2BDLA 3BOWA 3C9EA 3U8EA 3CH3X 3F5VA 3ZNHA 2AUZA 1GECE 1MIRA 3GCBA 2GHUA 1PPPA 3IFUA 2ATOA 1PIPA 3RVWA 1QOLA 8PCHA 5FPWA 1PXVA 1SP4B 3D6SA 1U9XA 1UKFA 1A6RA 2FE8A 2YJ2A 3WXGA 3IHPA 2R6NA 3BB7A 4YYQA 9PAPA 1EWMA 4M0WA 2DJFB 1Q6KA 2R9MA 3I06A 2G6DA 3PRPA 3QJ3A 2FTDA 1NL6A 4IP3A 1YT7A 3ERVA 2FUDA 1GCBA 2YJ8A 2G8EA 6PADA 4PP1A 3TNXA 4MM3B 3RNVA 3CBKA 1AYUA 4QBBA 4PI3A 3PBHA 1NPZA 1KFUL 4CDDB 2DC8A 3F75A 1PBHA 3IUTA 3MHSA 2XU4A 4HXDB 2R9OA 4XR7A 3KSEA 1ZCMA 1BY8A 3PDFA 1CB5A 4BS5A 4G54A 1CVZA 4QRVA 1MEGA 2UZJA 3OF8A 5F02A 3O65A 1CS8A 4XZXA 3IOQA 4D8EA 2AYNA 4X6JA 1EF7A 1F2CA 3BCNA 2DOSA 1SNKA 1Y4HA 1YK7A 3MTNA 2HWKA 3K24A 4BSQA 2JQGR 2Z84A 1GLOA 3S3RA 3BY4A 2NQGA 1TU6A 1EWPA 1U9VA 2JRIA 1CQDA 3E1ZB 3WXEA 4BOSA 3WXFA 4WURA 2VHSA 5E6JA 3TRKA 4RKXA 3MHHA 4I05A 3HD3A 1KFXL 1AYVA 4ZTBA 4CDEB 4DMXA 4OEMA 1K3BB 4MI7A 2DC7A 4AXLA 2G7YA 4BOZA 3M99A 2J7QC 1BP4A 2YJCA 5CHVA 4QRXA 3QT4A 3V6EA 2Y5BA 3TMPA 3NHEA 1PADA 3KWBX 4OVZA 1YZBA 4RF1A 3MJ5A 1CSBB 1U5IA 1F2BA 2AS8A 5EZSA 4N8WA 1NLJA 4CZWA 2DCBA 2BDZA 2CIOA 3OQCA 2DCCA 2AU1A 3BPFA 3N3KA 1AU4A 4FJCA 1PPNA 1PPDA 3HHAA 4KLBA 1EWOA 3LXSA 3KWZA 2DJGB 4W5BA 2BTWB 4YV8A 3I3TA 3PT2A 1F29A 3H89A 2B1MA 1U9WA 2FRQA 2XU3A 2VHFA 4MSXA 4YYUA 1X9YA 3LFYA 4RF0A 4W5CA 2GFOA 1Y08A 2HH5A 1AU0A 1AIMA 1ME3A 2BU3A 5J94A 3MORA 2PNSA 1F2AA 4I07A 2DCDA 1KHQA 2IPPB 3RVXA 1QMYA 4PP2E 3KW9A 4BOUA 2HHNA 4QRGA 3CBJA 2OP3A 2E02A 3IV2A 2DZZA 1AECA 4BPVA 1IWDA 1MHWA 2R9NA 4OW0A 4D8BA 3RVVA 1YVBA 1MEMA 2DZYA 2OZ2A 2O6XA 4WA6A 2PADA 2AGAA 3HWNA 2AYOA 4XUIA 1YK8A 1ATKA 3AI8A 3QSDA 1PVJA 1PPOA 3H6SA 4MZOA 5CHTA 3H8CA 3H8BA 3P5WA 2PREA 4QH6A 1AU3A 4P6GA 2J7QA 3PNRA 2B1NA 2H7JA 4W4UA 1QDQA 3K9MA 3BPMA 4R3DA 3IMAA 5KO3A 4YYVA 3KX1A 2PBHA 4DMYA 4Q8HA 3OF9A 4X6HA 3O1GA 4X6IA 2FQ9A 1MDWA 1CPJA 5CVMA 2E01A 3N3GA 1PE6A 3C0RA 1QXPA 2P7UA 1NQCA 1VJVA 3MP2A
chains in the Genus database with same CATH topology
1MS6A 1TLOA 2R9FA 1ZIVA 3H7DA 3P5XA 4AXMA 2HXZA 1M6DA 3KFQA 4C5PA 2P86A 4N79A 2DC9A 5JH3A 4K7CA 5A24A 2F7DA 1XKGA 2CB5A 1ME4A 3D9WA 2NQAA 1DEUA 2G8JA 2AIMA 2E00A 3ZUAA 2F1GA 1VSNA 1S4VA 1TL9A 1HUCB 3KKUA 1ITOA 4YVAA 3BC3A 3P5VA 1U9QX 4CDCB 7PCKA 2ARYA 1O0EA 1W4TA 2NQDB 2YJBA 2JQFR 1CV8A 2FRAA 5CVOB 4HWYA 4FK5A 2IBIA 3N4CA 4Q8GA 2Y6EA 1BQIA 3HHIA 4YYRA 2FYEA 1FH0A 4CDFB 1AU2A 5JA7A 4PADA 4MZSA 1AYWA 1YALA 3IEJA 3USVA 2OULA 1STFE 2NQIA 1GX3A 2E03A 3DF0A 4OELA 2C0YA 2R9CA 2AUXA 4RY2A 3V6CA 4ZUXU 4N4ZA 3P5UA 2YJ9A 5CVNB 3CH2X 4YYWA 2AVWA 1GMYA 2FO5A 2DC6A 1CJLA 1NB5A 4I04A 4YYSA 1POPA 4P6EA 2VFCA 2P0RA 2WBFX 5PADA 3O0UA 2ACTA 3S3QA 1ICFA 5EF4A 3BWKA 4GUZA 1KXRA 4BS6A 1JQPA 1PCIA 3PW3A 3OISA 1CTEA 1EWLA 3OVXA 1THEA 1NB3A 3K8UA 1DF0A 1KHPA 1BGOA 5K16A 3B79A 2FT2A 5EGWA 4BQVA 4FIPA 2XU1A 2DCAA 2HD5A 3OVZA 2XU5A 2BDLA 3BOWA 3C9EA 3U8EA 3CH3X 3F5VA 2AUZA 1GECE 1MIRA 3GCBA 2GHUA 1PPPA 2ATOA 1PIPA 3RVWA 1QOLA 8PCHA 5FPWA 1PXVA 1SP4B 3D6SA 1U9XA 1A6RA 2YJ2A 4B55A 3WXGA 3IHPA 2R6NA 4YYQA 9PAPA 4NV8A 1EWMA 2DJFB 1Q6KA 2R9MA 3I06A 2G6DA 3QJ3A 2VFBA 2FTDA 1NL6A 1YT7A 3ERVA 2FUDA 1GCBA 2YJ8A 2G8EA 6PADA 4NV7A 4PP1A 3TNXA 3CBKA 1AYUA 4QBBA 4PI3A 3PBHA 1NPZA 1KFUL 4CDDB 2DC8A 3F75A 1PBHA 3IUTA 3MHSA 2XU4A 2R9OA 4XR7A 3KSEA 1ZCMA 1BY8A 3PDFA 1CB5A 4BS5A 4G54A 1CVZA 4QRVA 1MEGA 3OF8A 5F02A 1CS8A 3IOQA 2AYNA 4X6JA 1EF7A 1F2CA 3BCNA 1SNKA 1Y4HA 1YK7A 3MTNA 3K24A 4BSQA 2JQGR 1GLOA 3S3RA 2NQGA 1TU6A 1EWPA 1U9VA 3E1ZB 1CQDA 3WXEA 3WXFA 2BSZA 2VHSA 3MHHA 4I05A 3HD3A 1KFXL 1AYVA 4CDEB 4DMXA 4OEMA 1K3BB 1W5RA 2DC7A 4AXLA 2G7YA 3M99A 1BP4A 2YJCA 5CHVA 4QRXA 3QT4A 3V6EA 2Y5BA 3NHEA 1PADA 3KWBX 1CSBB 1U5IA 1F2BA 2AS8A 4N8WA 1NLJA 4CZWA 2DCBA 2BDZA 4BGFA 2CIOA 2DCCA 2AU1A 3BPFA 3N3KA 4FJCA 1AU4A 1PPNA 1PPDA 3LTWA 3HHAA 4KLBA 1EWOA 3LXSA 3KWZA 2DJGB 4W5BA 4YV8A 3I3TA 1F29A 3H89A 2B1MA 1U9WA 2FRQA 2XU3A 2VHFA 4MSXA 4YYUA 1X9YA 3LFYA 4W5CA 2GFOA 1Y08A 2HH5A 1AU0A 1AIMA 1ME3A 5J94A 3MORA 2PNSA 1F2AA 4I07A 2DCDA 1KHQA 2IPPB 3RVXA 1QMYA 4PP2E 3KW9A 1W6FA 2HHNA 4QRGA 3CBJA 2OP3A 2E02A 3IV2A 2DZZA 1AECA 4BPVA 1IWDA 1MHWA 2R9NA 3RVVA 1YVBA 1MEMA 2DZYA 2OZ2A 2O6XA 4WA6A 2PADA 3HWNA 2AYOA 4XUIA 1YK8A 1ATKA 3AI8A 3QSDA 1PPOA 3H6SA 4MZOA 5CHTA 3H8CA 3H8BA 3P5WA 2PREA 4QH6A 1AU3A 4P6GA 3PNRA 2B1NA 2H7JA 4W4UA 1QDQA 3K9MA 3BPMA 1E2TA 3IMAA 4YYVA 3KX1A 2PBHA 4DMYA 4Q8HA 3OF9A 4X6HA 3O1GA 4X6IA 2FQ9A 1MDWA 1CPJA 5CVMA 2E01A 3N3GA 1PE6A 1QXPA 2P7UA 1NQCA 1VJVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MS6 A;  1TLO A;  2R9F A;  1ZIV A;  3H7D A;  3P5X A;  4AXM A;  2HXZ A;  1M6D A;  3KFQ A;  2P86 A;  4N79 A;  2DC9 A;  5JH3 A;  4K7C A;  5A24 A;  2F7D A;  1XKG A;  2CB5 A;  1ME4 A;  2NQA A;  1DEU A;  2G8J A;  2AIM A;  2E00 A;  3ZUA A;  2F1G A;  1VSN A;  1S4V A;  1TL9 A;  1HUC B;  3KKU A;  1ITO A;  4YVA A;  3BC3 A;  3P5V A;  1U9Q X;  4CDC B;  7PCK A;  2ARY A;  1O0E A;  2NQD B;  2YJB A;  2JQF R;  1CV8 A;  2FRA A;  5CVO B;  4HWY A;  4FK5 A;  2IBI A;  3N4C A;  4Q8G A;  2Y6E A;  1BQI A;  3HHI A;  4YYR A;  2FYE A;  1FH0 A;  4CDF B;  1AU2 A;  5JA7 A;  4PAD A;  4MZS A;  1AYW A;  1YAL A;  3IEJ A;  3USV A;  2OUL A;  1STF E;  2NQI A;  2E03 A;  3DF0 A;  4OEL A;  2C0Y A;  2R9C A;  2AUX A;  4RY2 A;  3V6C A;  4ZUX U;  4N4Z A;  3P5U A;  2YJ9 A;  5CVN B;  3CH2 X;  4YYW A;  2AVW A;  1GMY A;  2FO5 A;  2DC6 A;  1CJL A;  1NB5 A;  4I04 A;  4YYS A;  1POP A;  4P6E A;  2P0R A;  2WBF X;  5PAD A;  3O0U A;  2ACT A;  3S3Q A;  1ICF A;  5EF4 A;  3BWK A;  1KXR A;  4BS6 A;  1JQP A;  1PCI A;  3PW3 A;  3OIS A;  1CTE A;  1EWL A;  3OVX A;  1THE A;  1NB3 A;  3K8U A;  1DF0 A;  1KHP A;  1BGO A;  5K16 A;  3B79 A;  2FT2 A;  5EGW A;  4BQV A;  4FIP A;  2XU1 A;  2DCA A;  2HD5 A;  3OVZ A;  2XU5 A;  2BDL A;  3BOW A;  3C9E A;  3U8E A;  3CH3 X;  3F5V A;  2AUZ A;  1GEC E;  1MIR A;  3GCB A;  2GHU A;  1PPP A;  2ATO A;  1PIP A;  3RVW A;  1QOL A;  8PCH A;  5FPW A;  1PXV A;  1SP4 B;  3D6S A;  1U9X A;  1A6R A;  2YJ2 A;  3WXG A;  3IHP A;  2R6N A;  4YYQ A;  9PAP A;  1EWM A;  2DJF B;  1Q6K A;  2R9M A;  3I06 A;  2G6D A;  3QJ3 A;  2FTD A;  1NL6 A;  1YT7 A;  3ERV A;  2FUD A;  1GCB A;  2YJ8 A;  2G8E A;  6PAD A;  4PP1 A;  3TNX A;  3CBK A;  1AYU A;  4QBB A;  4PI3 A;  3PBH A;  1NPZ A;  1KFU L;  4CDD B;  2DC8 A;  3F75 A;  1PBH A;  3IUT A;  3MHS A;  2XU4 A;  2R9O A;  4XR7 A;  3KSE A;  1ZCM A;  1BY8 A;  3PDF A;  1CB5 A;  4BS5 A;  4G54 A;  1CVZ A;  4QRV A;  1MEG A;  3OF8 A;  5F02 A;  1CS8 A;  3IOQ A;  2AYN A;  4X6J A;  1EF7 A;  1F2C A;  3BCN A;  1SNK A;  1Y4H A;  1YK7 A;  3MTN A;  3K24 A;  4BSQ A;  2JQG R;  1GLO A;  3S3R A;  2NQG A;  1TU6 A;  1EWP A;  1U9V A;  3E1Z B;  1CQD A;  3WXE A;  3WXF A;  2VHS A;  3MHH A;  4I05 A;  3HD3 A;  1KFX L;  1AYV A;  4CDE B;  4DMX A;  4OEM A;  1K3B B;  2DC7 A;  4AXL A;  2G7Y A;  3M99 A;  1BP4 A;  2YJC A;  5CHV A;  4QRX A;  3QT4 A;  3V6E A;  2Y5B A;  3NHE A;  1PAD A;  3KWB X;  1CSB B;  1U5I A;  1F2B A;  2AS8 A;  4N8W A;  1NLJ A;  4CZW A;  2DCB A;  2BDZ A;  2CIO A;  2DCC A;  2AU1 A;  3BPF A;  3N3K A;  4FJC A;  1AU4 A;  1PPN A;  1PPD A;  3HHA A;  4KLB A;  1EWO A;  3LXS A;  3KWZ A;  2DJG B;  4W5B A;  4YV8 A;  3I3T A;  1F29 A;  3H89 A;  2B1M A;  1U9W A;  2FRQ A;  2XU3 A;  2VHF A;  4MSX A;  4YYU A;  1X9Y A;  3LFY A;  4W5C A;  2GFO A;  1Y08 A;  2HH5 A;  1AU0 A;  1AIM A;  1ME3 A;  5J94 A;  3MOR A;  2PNS A;  1F2A A;  4I07 A;  2DCD A;  1KHQ A;  2IPP B;  3RVX A;  1QMY A;  4PP2 E;  3KW9 A;  4QRG A;  2HHN A;  3CBJ A;  2OP3 A;  2E02 A;  3IV2 A;  2DZZ A;  1AEC A;  4BPV A;  1IWD A;  1MHW A;  2R9N A;  3RVV A;  1YVB A;  1MEM A;  2DZY A;  2OZ2 A;  2O6X A;  4WA6 A;  2PAD A;  3HWN A;  2AYO A;  4XUI A;  1YK8 A;  1ATK A;  3AI8 A;  3QSD A;  1PPO A;  3H6S A;  4MZO A;  5CHT A;  3H8C A;  3H8B A;  3P5W A;  2PRE A;  4QH6 A;  1AU3 A;  4P6G A;  3PNR A;  2B1N A;  2H7J A;  4W4U A;  1QDQ A;  3K9M A;  3BPM A;  3IMA A;  4YYV A;  3KX1 A;  2PBH A;  4DMY A;  4Q8H A;  3OF9 A;  4X6H A;  3O1G A;  4X6I A;  2FQ9 A;  1MDW A;  1CPJ A;  5CVM A;  2E01 A;  3N3G A;  1PE6 A;  1QXP A;  2P7U A;  1NQC A;  1VJV A; 
#chains in the Genus database with same CATH topology
 1MS6 A;  1TLO A;  2R9F A;  1ZIV A;  4D8I A;  3H7D A;  3P5X A;  4AXM A;  2HXZ A;  3PRM A;  1M6D A;  3KFQ A;  2P86 A;  4N79 A;  2DC9 A;  5JH3 A;  4K7C A;  5A24 A;  2JTC A;  2F7D A;  1XKG A;  2CB5 A;  1ME4 A;  2NQA A;  1DEU A;  2G8J A;  2AIM A;  2E00 A;  3ZUA A;  2F1G A;  1VSN A;  1S4V A;  1TL9 A;  4IUM A;  1HUC B;  3KKU A;  3BBA A;  3PHU A;  3B21 A;  1ITO A;  4YVA A;  3BC3 A;  3P5V A;  1U9Q X;  4GUA A;  4CDC B;  7PCK A;  2ARY A;  1O0E A;  2NQD B;  2YJB A;  2JQF R;  1CV8 A;  2FRA A;  5CVO B;  4HWY A;  4FK5 A;  4A5U A;  2IBI A;  3N4C A;  4Q8G A;  3W31 A;  2Y6E A;  1BQI A;  3HHI A;  4YYR A;  2FYE A;  3MTV A;  1FH0 A;  4CDF B;  1AU2 A;  5JA7 A;  4BOQ A;  4PAD A;  4MZS A;  1AYW A;  1YAL A;  3IEJ A;  3USV A;  2OUL A;  3E9S A;  1STF E;  4OVZ B;  2NQI A;  2E03 A;  3DF0 A;  4OEL A;  2C0Y A;  2R9C A;  2AUX A;  4RY2 A;  3V6C A;  4ZUX U;  4RNA A;  4N4Z A;  3P5U A;  2YJ9 A;  5CVN B;  3CH2 X;  4YYW A;  2AVW A;  1GMY A;  2FO5 A;  4PT5 A;  2DC6 A;  1CJL A;  3PHW A;  1NB5 A;  4I04 A;  4YYS A;  1POP A;  4P6E A;  5EZQ A;  2P0R A;  2WBF X;  3W30 A;  5PAD A;  3O0U A;  2ACT A;  3S3Q A;  1ICF A;  4REZ A;  5EF4 A;  3BWK A;  3PHX A;  5JZE A;  1KXR A;  4BS6 A;  1JQP A;  1PCI A;  3PW3 A;  1DKI A;  3OIS A;  1CTE A;  1EWL A;  3OVX A;  1THE A;  4BOP A;  1NB3 A;  3K8U A;  2BTW A;  1DF0 A;  1KHP A;  1BGO A;  5K16 A;  3B79 A;  2FT2 A;  5EGW A;  4BQV A;  4FIP A;  2XU1 A;  2DCA A;  4P16 A;  2HD5 A;  3OVZ A;  3PSE A;  2XU5 A;  2BDL A;  3BOW A;  3C9E A;  3U8E A;  3CH3 X;  3F5V A;  3ZNH A;  2AUZ A;  1GEC E;  1MIR A;  3GCB A;  2GHU A;  1PPP A;  3IFU A;  2ATO A;  1PIP A;  3RVW A;  1QOL A;  8PCH A;  5FPW A;  1PXV A;  1SP4 B;  3D6S A;  1U9X A;  1UKF A;  1A6R A;  2FE8 A;  2YJ2 A;  3WXG A;  3IHP A;  2R6N A;  3BB7 A;  4YYQ A;  9PAP A;  1EWM A;  4M0W A;  2DJF B;  1Q6K A;  2R9M A;  3I06 A;  2G6D A;  3PRP A;  3QJ3 A;  2FTD A;  1NL6 A;  4IP3 A;  1YT7 A;  3ERV A;  2FUD A;  1GCB A;  2YJ8 A;  2G8E A;  6PAD A;  4PP1 A;  3TNX A;  4MM3 B;  3RNV A;  3CBK A;  1AYU A;  4QBB A;  4PI3 A;  3PBH A;  1NPZ A;  1KFU L;  4CDD B;  2DC8 A;  3F75 A;  1PBH A;  3IUT A;  3MHS A;  2XU4 A;  4HXD B;  2R9O A;  4XR7 A;  3KSE A;  1ZCM A;  1BY8 A;  3PDF A;  1CB5 A;  4BS5 A;  4G54 A;  1CVZ A;  4QRV A;  1MEG A;  2UZJ A;  3OF8 A;  5F02 A;  3O65 A;  1CS8 A;  4XZX A;  3IOQ A;  4D8E A;  2AYN A;  4X6J A;  1EF7 A;  1F2C A;  3BCN A;  2DOS A;  1SNK A;  1Y4H A;  1YK7 A;  3MTN A;  2HWK A;  3K24 A;  4BSQ A;  2JQG R;  2Z84 A;  1GLO A;  3S3R A;  3BY4 A;  2NQG A;  1TU6 A;  1EWP A;  1U9V A;  2JRI A;  1CQD A;  3E1Z B;  3WXE A;  4BOS A;  3WXF A;  4WUR A;  2VHS A;  5E6J A;  3TRK A;  4RKX A;  3MHH A;  4I05 A;  3HD3 A;  1KFX L;  1AYV A;  4ZTB A;  4CDE B;  4DMX A;  4OEM A;  1K3B B;  4MI7 A;  2DC7 A;  4AXL A;  2G7Y A;  4BOZ A;  3M99 A;  2J7Q C;  1BP4 A;  2YJC A;  5CHV A;  4QRX A;  3QT4 A;  3V6E A;  2Y5B A;  3TMP A;  3NHE A;  1PAD A;  3KWB X;  4OVZ A;  1YZB A;  4RF1 A;  3MJ5 A;  1CSB B;  1U5I A;  1F2B A;  2AS8 A;  5EZS A;  4N8W A;  1NLJ A;  4CZW A;  2DCB A;  2BDZ A;  2CIO A;  3OQC A;  2DCC A;  2AU1 A;  3BPF A;  3N3K A;  1AU4 A;  4FJC A;  1PPN A;  1PPD A;  3HHA A;  4KLB A;  1EWO A;  3LXS A;  3KWZ A;  2DJG B;  4W5B A;  2BTW B;  4YV8 A;  3I3T A;  3PT2 A;  1F29 A;  3H89 A;  2B1M A;  1U9W A;  2FRQ A;  2XU3 A;  2VHF A;  4MSX A;  4YYU A;  1X9Y A;  3LFY A;  4RF0 A;  4W5C A;  2GFO A;  1Y08 A;  2HH5 A;  1AU0 A;  1AIM A;  1ME3 A;  2BU3 A;  5J94 A;  3MOR A;  2PNS A;  1F2A A;  4I07 A;  2DCD A;  1KHQ A;  2IPP B;  3RVX A;  1QMY A;  4PP2 E;  3KW9 A;  4BOU A;  2HHN A;  4QRG A;  3CBJ A;  2OP3 A;  2E02 A;  3IV2 A;  2DZZ A;  1AEC A;  4BPV A;  1IWD A;  1MHW A;  2R9N A;  4OW0 A;  4D8B A;  3RVV A;  1YVB A;  1MEM A;  2DZY A;  2OZ2 A;  2O6X A;  4WA6 A;  2PAD A;  2AGA A;  3HWN A;  2AYO A;  4XUI A;  1YK8 A;  1ATK A;  3AI8 A;  3QSD A;  1PVJ A;  1PPO A;  3H6S A;  4MZO A;  5CHT A;  3H8C A;  3H8B A;  3P5W A;  2PRE A;  4QH6 A;  1AU3 A;  4P6G A;  2J7Q A;  3PNR A;  2B1N A;  2H7J A;  4W4U A;  1QDQ A;  3K9M A;  3BPM A;  4R3D A;  3IMA A;  5KO3 A;  4YYV A;  3KX1 A;  2PBH A;  4DMY A;  4Q8H A;  3OF9 A;  4X6H A;  3O1G A;  4X6I A;  2FQ9 A;  1MDW A;  1CPJ A;  5CVM A;  2E01 A;  3N3G A;  1PE6 A;  3C0R A;  1QXP A;  2P7U A;  1NQC A;  1VJV A;  3MP2 A; 
#chains in the Genus database with same CATH homology
 1MS6 A;  1TLO A;  2R9F A;  1ZIV A;  3H7D A;  3P5X A;  4AXM A;  2HXZ A;  1M6D A;  3KFQ A;  4C5P A;  2P86 A;  4N79 A;  2DC9 A;  5JH3 A;  4K7C A;  5A24 A;  2F7D A;  1XKG A;  2CB5 A;  1ME4 A;  3D9W A;  2NQA A;  1DEU A;  2G8J A;  2AIM A;  2E00 A;  3ZUA A;  2F1G A;  1VSN A;  1S4V A;  1TL9 A;  1HUC B;  3KKU A;  1ITO A;  4YVA A;  3BC3 A;  3P5V A;  1U9Q X;  4CDC B;  7PCK A;  2ARY A;  1O0E A;  1W4T A;  2NQD B;  2YJB A;  2JQF R;  1CV8 A;  2FRA A;  5CVO B;  4HWY A;  4FK5 A;  2IBI A;  3N4C A;  4Q8G A;  2Y6E A;  1BQI A;  3HHI A;  4YYR A;  2FYE A;  1FH0 A;  4CDF B;  1AU2 A;  5JA7 A;  4PAD A;  4MZS A;  1AYW A;  1YAL A;  3IEJ A;  3USV A;  2OUL A;  1STF E;  2NQI A;  1GX3 A;  2E03 A;  3DF0 A;  4OEL A;  2C0Y A;  2R9C A;  2AUX A;  4RY2 A;  3V6C A;  4ZUX U;  4N4Z A;  3P5U A;  2YJ9 A;  5CVN B;  3CH2 X;  4YYW A;  2AVW A;  1GMY A;  2FO5 A;  2DC6 A;  1CJL A;  1NB5 A;  4I04 A;  4YYS A;  1POP A;  4P6E A;  2VFC A;  2P0R A;  2WBF X;  5PAD A;  3O0U A;  2ACT A;  3S3Q A;  1ICF A;  5EF4 A;  3BWK A;  4GUZ A;  1KXR A;  4BS6 A;  1JQP A;  1PCI A;  3PW3 A;  3OIS A;  1CTE A;  1EWL A;  3OVX A;  1THE A;  1NB3 A;  3K8U A;  1DF0 A;  1KHP A;  1BGO A;  5K16 A;  3B79 A;  2FT2 A;  5EGW A;  4BQV A;  4FIP A;  2XU1 A;  2DCA A;  2HD5 A;  3OVZ A;  2XU5 A;  2BDL A;  3BOW A;  3C9E A;  3U8E A;  3CH3 X;  3F5V A;  2AUZ A;  1GEC E;  1MIR A;  3GCB A;  2GHU A;  1PPP A;  2ATO A;  1PIP A;  3RVW A;  1QOL A;  8PCH A;  5FPW A;  1PXV A;  1SP4 B;  3D6S A;  1U9X A;  1A6R A;  2YJ2 A;  4B55 A;  3WXG A;  3IHP A;  2R6N A;  4YYQ A;  9PAP A;  4NV8 A;  1EWM A;  2DJF B;  1Q6K A;  2R9M A;  3I06 A;  2G6D A;  3QJ3 A;  2VFB A;  2FTD A;  1NL6 A;  1YT7 A;  3ERV A;  2FUD A;  1GCB A;  2YJ8 A;  2G8E A;  6PAD A;  4NV7 A;  4PP1 A;  3TNX A;  3CBK A;  1AYU A;  4QBB A;  4PI3 A;  3PBH A;  1NPZ A;  1KFU L;  4CDD B;  2DC8 A;  3F75 A;  1PBH A;  3IUT A;  3MHS A;  2XU4 A;  2R9O A;  4XR7 A;  3KSE A;  1ZCM A;  1BY8 A;  3PDF A;  1CB5 A;  4BS5 A;  4G54 A;  1CVZ A;  4QRV A;  1MEG A;  3OF8 A;  5F02 A;  1CS8 A;  3IOQ A;  2AYN A;  4X6J A;  1EF7 A;  1F2C A;  3BCN A;  1SNK A;  1Y4H A;  1YK7 A;  3MTN A;  3K24 A;  4BSQ A;  2JQG R;  1GLO A;  3S3R A;  2NQG A;  1TU6 A;  1EWP A;  1U9V A;  3E1Z B;  1CQD A;  3WXE A;  3WXF A;  2BSZ A;  2VHS A;  3MHH A;  4I05 A;  3HD3 A;  1KFX L;  1AYV A;  4CDE B;  4DMX A;  4OEM A;  1K3B B;  1W5R A;  2DC7 A;  4AXL A;  2G7Y A;  3M99 A;  1BP4 A;  2YJC A;  5CHV A;  4QRX A;  3QT4 A;  3V6E A;  2Y5B A;  3NHE A;  1PAD A;  3KWB X;  1CSB B;  1U5I A;  1F2B A;  2AS8 A;  4N8W A;  1NLJ A;  4CZW A;  2DCB A;  2BDZ A;  4BGF A;  2CIO A;  2DCC A;  2AU1 A;  3BPF A;  3N3K A;  4FJC A;  1AU4 A;  1PPN A;  1PPD A;  3LTW A;  3HHA A;  4KLB A;  1EWO A;  3LXS A;  3KWZ A;  2DJG B;  4W5B A;  4YV8 A;  3I3T A;  1F29 A;  3H89 A;  2B1M A;  1U9W A;  2FRQ A;  2XU3 A;  2VHF A;  4MSX A;  4YYU A;  1X9Y A;  3LFY A;  4W5C A;  2GFO A;  1Y08 A;  2HH5 A;  1AU0 A;  1AIM A;  1ME3 A;  5J94 A;  3MOR A;  2PNS A;  1F2A A;  4I07 A;  2DCD A;  1KHQ A;  2IPP B;  3RVX A;  1QMY A;  4PP2 E;  3KW9 A;  1W6F A;  2HHN A;  4QRG A;  3CBJ A;  2OP3 A;  2E02 A;  3IV2 A;  2DZZ A;  1AEC A;  4BPV A;  1IWD A;  1MHW A;  2R9N A;  3RVV A;  1YVB A;  1MEM A;  2DZY A;  2OZ2 A;  2O6X A;  4WA6 A;  2PAD A;  3HWN A;  2AYO A;  4XUI A;  1YK8 A;  1ATK A;  3AI8 A;  3QSD A;  1PPO A;  3H6S A;  4MZO A;  5CHT A;  3H8C A;  3H8B A;  3P5W A;  2PRE A;  4QH6 A;  1AU3 A;  4P6G A;  3PNR A;  2B1N A;  2H7J A;  4W4U A;  1QDQ A;  3K9M A;  3BPM A;  1E2T A;  3IMA A;  4YYV A;  3KX1 A;  2PBH A;  4DMY A;  4Q8H A;  3OF9 A;  4X6H A;  3O1G A;  4X6I A;  2FQ9 A;  1MDW A;  1CPJ A;  5CVM A;  2E01 A;  3N3G A;  1PE6 A;  1QXP A;  2P7U A;  1NQC A;  1VJV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...