1U9VA

Crystal structure of the cysteine protease human cathepsin k in complex with the covalent inhibitor nvp-abe854
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel purine nitrile derived inhibitors of the cysteine protease cathepsin K
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Cathepsin K
total genus 62
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2004-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1u9vA00
3K9MA 5EF4A 1VSNA 2AIMA 1POPA 3KSEA 3C9EA 3OVXA 4P6GA 2F7DA 1ME3A 4OEMA 2YJBA 2YJCA 3LFYA 1HUCB 1CSBB 2VHFA 1U9XA 2GHUA 3CH2X 4BSQA 2R9NA 3O0UA 1O0EA 1DF0A 3BPMA 1CB5A 2G8EA 1K3BB 3QJ3A 1MS6A 1A6RA 3TNXA 4FJCA 1ICFA 1YK8A 5K16A 2P0RA 4DMXA 2JQGR 3GCBA 2CIOA 4OELA 1NB3A 6PADA 1GCBA 1KFXL 2NQDB 1EWMA 2FRQA 3K24A 3USVA 3F75A 4P6EA 3CBJA 4I05A 3WXEA 1MEGA 1PPPA 1ZCMA 2YJ2A 1IWDA 4Q8GA 1EWOA 5CVMA 4RY2A 3H6SA 2XU3A 1BQIA 4Q8HA 2H7JA 4YYVA 1XKGA 1NQCA 3ZUAA 3IMAA 2YJ8A 2NQAA 2E02A 1ZIVA 3O1GA 1ITOA 1JQPA 2AU1A 1TLOA 1Y4HA 3LXSA 4W5CA 2PNSA 2DC8A 1YVBA 2XU4A 4PI3A 3BC3A 5PADA 4MZSA 1PPNA 1Y08A 5FPWA 3HHAA 3KFQA 3B79A 1F2CA 4AXMA 3OF8A 1TU6A 1CVZA 1GMYA 4KLBA 1MHWA 4DMYA 2AYOA 2HH5A 1PXVA 1AYUA 1CTEA 3BWKA 2VHSA 2NQGA 2DZZA 3BOWA 1NB5A 4YYUA 3H8BA 2FT2A 1YALA 3N3KA 5CHVA 8PCHA 1QDQA 2IPPB 2DC7A 3S3QA 2Y6EA 2Y5BA 1VJVA 2P7UA 3MHHA 3PNRA 1EF7A 3RVWA 2HD5A 2XU5A 1AYVA 3QT4A 1SNKA 1Q6KA 1FH0A 2DCCA 4QH6A 2R9FA 2IBIA 2FRAA 3MORA 1PE6A 3AI8A 3P5WA 4XR7A 3M99A 4XUIA 4K7CA 4QRXA 3P5UA 1MDWA 1AECA 1PADA 3KKUA 5J94A 2AVWA 2AS8A 3CBKA 2AUXA 4YVAA 3NHEA 4W4UA 3H8CA 4YYQA 1AU4A 1GLOA 1CQDA 2R9OA 1NLJA 3PDFA 4ZUXU 1PPOA 1ME4A 4MSXA 5CVOB 2OULA 1SP4B 2FO5A 2FUDA 2NQIA 2OZ2A 2P86A 1GECE 2R9MA 3N3GA 1KHQA 2DCAA 4FK5A 4CDCB 3U8EA 1STFE 2G6DA 2B1MA 3BCNA 2DC6A 3IUTA 3OF9A 1MEMA 1QXPA 2FTDA 4CDDB 1U5IA 3OISA 1AU0A 3K8UA 3P5VA 2DZYA 2ATOA 5CVNB 3KW9A 3PBHA 3HHIA 1X9YA 3D6SA 3IV2A 3QSDA 4AXLA 3DF0A 2DJFB 2DC9A 1PPDA 2FYEA 2BDLA 4QBBA 3V6EA 2ARYA 3IOQA 2PBHA 1F2AA 4YV8A 1U9VA 2YJ9A 3H7DA 1U9WA 2WBFX 1AYWA 3MTNA 3N4CA 5EGWA 5A24A 2G7YA 4YYSA 2PREA 5JA7A 3HD3A 4FIPA 3I06A 4BQVA 1AU2A 2B1NA 2FQ9A 3MHSA 2R9CA 4MZOA 1NPZA 1KXRA 2R6NA 3CH3X 1U9QX 4N79A 9PAPA 3IHPA 2E01A 1M6DA 2GFOA 1F2BA 3WXFA 5F02A 1DEUA 3H89A 2HXZA 2DCBA 4X6HA 3V6CA 2F1GA 2JQFR 4PADA 3F5VA 4CZWA 2C0YA 3HWNA 1EWLA 1EWPA 4BS6A 1KHPA 4N8WA 1AU3A 1PIPA 4X6JA 4X6IA 1NL6A 2CB5A 2ACTA 2PADA 1F29A 2OP3A 4PP1A 1BGOA 5JH3A 2DJGB 1CS8A 4BPVA 3ERVA 4PP2E 2DCDA 3RVXA 1AIMA 1PBHA 2E00A 2E03A 7PCKA 2BDZA 1YT7A 4I04A 3KWBX 3BPFA 4YYRA 1KFUL 4W5BA 2AUZA 1S4VA 4WA6A 5CHTA 4CDEB 1BY8A 3OVZA 1PCIA 3P5XA 3KWZA 4G54A 3S3RA 1BP4A 3E1ZB 2HHNA 1CJLA 3PW3A 4N4ZA 1TL9A 2G8JA 2O6XA 1YK7A 3WXGA 4CDFB 3IEJA 3RVVA 4BS5A 4QRVA 1ATKA 1MIRA 4QRGA 4YYWA 3KX1A 1CV8A 2XU1A 4HWYA 4I07A 2AYNA 1QOLA 1QMYA 1CPJA 1THEA 3I3TA
chains in the Genus database with same CATH superfamily
3K9MA 5EF4A 1VSNA 2AIMA 1POPA 3KSEA 3C9EA 3OVXA 4P6GA 2AGAA 2F7DA 1ME3A 4OEMA 2YJBA 3W30A 2YJCA 3LFYA 4ZTBA 1HUCB 1CSBB 4GUAA 4MM3B 2VHFA 1U9XA 4PT5A 3C0RA 2GHUA 3CH2X 4BSQA 2R9NA 3O0UA 4WURA 1O0EA 1DF0A 3BPMA 1CB5A 2G8EA 1K3BB 4OVZB 3QJ3A 1MS6A 1A6RA 3TNXA 4FJCA 1ICFA 1YK8A 5K16A 2P0RA 4DMXA 4BOQA 2JQGR 3GCBA 2CIOA 3PSEA 4OELA 1NB3A 6PADA 1GCBA 1KFXL 2NQDB 1EWMA 2FRQA 3K24A 3USVA 3F75A 4P6EA 3CBJA 4I05A 3WXEA 1MEGA 4OVZA 3BBAA 1PPPA 1ZCMA 2UZJA 2YJ2A 4IUMA 1IWDA 4Q8GA 2JTCA 2BU3A 1EWOA 5CVMA 2JRIA 4IP3A 3H6SA 4RY2A 2XU3A 1BQIA 4RF0A 4Q8HA 2H7JA 4YYVA 1XKGA 1NQCA 3ZUAA 3IMAA 2YJ8A 4RF1A 2NQAA 2E02A 1ZIVA 3O1GA 1ITOA 1JQPA 3PHXA 2AU1A 1TLOA 1Y4HA 3LXSA 4W5CA 2PNSA 2DC8A 1YVBA 2XU4A 4PI3A 3BC3A 5PADA 4MZSA 1PPNA 1Y08A 5FPWA 3HHAA 3KFQA 3B79A 1F2CA 4AXMA 3OF8A 1TU6A 1CVZA 1GMYA 4KLBA 1MHWA 4DMYA 2AYOA 2HH5A 1PXVA 1AYUA 1CTEA 3BWKA 4R3DA 2VHSA 2NQGA 4MI7A 2DZZA 2DOSA 3BOWA 1NB5A 4YYUA 3H8BA 2J7QA 2FT2A 4REZA 2Z84A 1YALA 3N3KA 5CHVA 8PCHA 2J7QC 1QDQA 2IPPB 2DC7A 3S3QA 2Y6EA 2Y5BA 4BOZA 1VJVA 2P7UA 3MHHA 3PNRA 1EF7A 2HD5A 3RVWA 2XU5A 1AYVA 2HWKA 3QT4A 1SNKA 1Q6KA 1FH0A 2DCCA 4QH6A 2R9FA 2IBIA 2FRAA 3MORA 1PE6A 3AI8A 4RKXA 3P5WA 4XR7A 3M99A 4XUIA 3IFUA 4K7CA 3PRMA 4RNAA 4QRXA 3P5UA 3B21A 1MDWA 1PVJA 1AECA 1PADA 3KKUA 4BOPA 5J94A 2AVWA 2AS8A 3CBKA 2AUXA 4YVAA 3NHEA 4W4UA 3H8CA 4YYQA 1AU4A 4OW0A 1GLOA 3ZNHA 1CQDA 2R9OA 1NLJA 3PDFA 4ZUXU 1PPOA 1ME4A 3PHUA 4MSXA 5CVOB 2OULA 1SP4B 2FO5A 2FUDA 2NQIA 2OZ2A 2P86A 5EZSA 1GECE 2R9MA 4D8IA 3N3GA 1KHQA 2DCAA 4FK5A 4CDCB 4BOUA 3U8EA 1DKIA 5JZEA 1STFE 4HXDB 4BOSA 2G6DA 2B1MA 3BCNA 2DC6A 3IUTA 3PRPA 4XZXA 3OF9A 1MEMA 1QXPA 2FTDA 4CDDB 1U5IA 3OISA 1AU0A 2BTWB 3K8UA 3P5VA 2DZYA 3PT2A 2ATOA 5CVNB 3KW9A 3PBHA 3HHIA 1X9YA 3D6SA 3IV2A 3QSDA 4AXLA 3O65A 3DF0A 2DJFB 2DC9A 1PPDA 2FYEA 2BDLA 4QBBA 2BTWA 3V6EA 2ARYA 3IOQA 2PBHA 1F2AA 4YV8A 1U9VA 2YJ9A 3H7DA 1U9WA 2WBFX 1AYWA 3MTNA 1YZBA 3N4CA 5EGWA 5A24A 3W31A 2G7YA 4YYSA 2PREA 5JA7A 3HD3A 5E6JA 4FIPA 3E9SA 3I06A 4BQVA 1AU2A 3BB7A 2B1NA 2FQ9A 3MHSA 2R9CA 4MZOA 1NPZA 1KXRA 2R6NA 3CH3X 1U9QX 4N79A 9PAPA 3IHPA 2E01A 1M6DA 2GFOA 3BY4A 1F2BA 3WXFA 5F02A 1DEUA 3MJ5A 4A5UA 3H89A 2HXZA 2DCBA 3MTVA 4X6HA 3V6CA 2F1GA 2JQFR 4D8BA 4PADA 3F5VA 4CZWA 2C0YA 3HWNA 1EWLA 1EWPA 4M0WA 4BS6A 1KHPA 4N8WA 1AU3A 1PIPA 4X6JA 4X6IA 3RNVA 1NL6A 2CB5A 2ACTA 2PADA 1F29A 3OQCA 2OP3A 3MP2A 4PP1A 1BGOA 5JH3A 2DJGB 1CS8A 4BPVA 3ERVA 4PP2E 2DCDA 3RVXA 1AIMA 4P16A 1PBHA 2E00A 2E03A 7PCKA 2BDZA 1YT7A 4I04A 3KWBX 3BPFA 4YYRA 1KFUL 4W5BA 2AUZA 3TMPA 1S4VA 4WA6A 5CHTA 4CDEB 1BY8A 3OVZA 1PCIA 3P5XA 3KWZA 1UKFA 4G54A 3S3RA 1BP4A 3E1ZB 2HHNA 1CJLA 3PW3A 4N4ZA 1TL9A 2G8JA 2O6XA 1YK7A 3WXGA 4CDFB 3IEJA 3RVVA 4BS5A 4QRVA 1ATKA 3PHWA 1MIRA 4QRGA 2FE8A 4YYWA 3KX1A 1CV8A 3TRKA 2XU1A 4HWYA 5KO3A 4I07A 2AYNA 4D8EA 1QOLA 1QMYA 5EZQA 1CPJA 1THEA 3I3TA
chains in the Genus database with same CATH topology
3K9MA 5EF4A 1VSNA 2AIMA 1POPA 3KSEA 3C9EA 3OVXA 4P6GA 2F7DA 1ME3A 4OEMA 2YJBA 2YJCA 3LFYA 1HUCB 1CSBB 2VHFA 1U9XA 2GHUA 3CH2X 4BSQA 2R9NA 3O0UA 1O0EA 1DF0A 3BPMA 1CB5A 2G8EA 1K3BB 3QJ3A 1MS6A 1A6RA 3TNXA 4FJCA 1ICFA 1YK8A 5K16A 2P0RA 4DMXA 2JQGR 3GCBA 2CIOA 4OELA 1NB3A 6PADA 1GCBA 1KFXL 2NQDB 1EWMA 2FRQA 3K24A 3USVA 3F75A 4P6EA 3CBJA 4I05A 3WXEA 1MEGA 1PPPA 1ZCMA 2YJ2A 1IWDA 4Q8GA 1EWOA 5CVMA 4RY2A 3H6SA 1GX3A 2XU3A 1BQIA 4Q8HA 2H7JA 4YYVA 1XKGA 1NQCA 3ZUAA 3IMAA 2YJ8A 2NQAA 2E02A 1ZIVA 3O1GA 1ITOA 1JQPA 2AU1A 1TLOA 1Y4HA 3LXSA 4W5CA 2PNSA 2DC8A 1YVBA 2XU4A 4PI3A 3BC3A 5PADA 4MZSA 1PPNA 1Y08A 5FPWA 3HHAA 3KFQA 3B79A 1F2CA 4AXMA 4C5PA 3OF8A 1TU6A 1CVZA 1GMYA 4KLBA 1MHWA 4DMYA 2AYOA 2HH5A 1PXVA 1AYUA 1CTEA 3BWKA 2VHSA 2NQGA 2DZZA 3BOWA 1NB5A 4YYUA 3H8BA 2FT2A 1YALA 3N3KA 5CHVA 8PCHA 1QDQA 2IPPB 2DC7A 3S3QA 2Y6EA 2Y5BA 1VJVA 2P7UA 3MHHA 3PNRA 1EF7A 2HD5A 3RVWA 2XU5A 1AYVA 3QT4A 1SNKA 1Q6KA 1FH0A 2DCCA 4QH6A 2R9FA 2IBIA 2FRAA 3MORA 1PE6A 3AI8A 3P5WA 4XR7A 3M99A 4XUIA 1W6FA 4K7CA 4QRXA 2VFCA 3P5UA 1MDWA 1AECA 1PADA 3KKUA 5J94A 2AVWA 2AS8A 3CBKA 2AUXA 4YVAA 3NHEA 4W4UA 3H8CA 4YYQA 1AU4A 1GLOA 1CQDA 2R9OA 1NLJA 3PDFA 4ZUXU 1PPOA 1ME4A 4MSXA 5CVOB 2OULA 1SP4B 2FO5A 2FUDA 4GUZA 2NQIA 2OZ2A 2P86A 1GECE 2R9MA 3N3GA 1KHQA 2DCAA 4FK5A 4CDCB 1W5RA 3U8EA 1STFE 2G6DA 2B1MA 3BCNA 2DC6A 3IUTA 3OF9A 1MEMA 1QXPA 2FTDA 4CDDB 1U5IA 3OISA 1AU0A 3K8UA 3P5VA 2DZYA 2ATOA 5CVNB 3KW9A 3PBHA 3HHIA 1X9YA 3D6SA 3IV2A 3QSDA 4AXLA 3DF0A 2DJFB 2DC9A 1PPDA 2FYEA 2BDLA 2BSZA 4QBBA 3V6EA 2ARYA 3IOQA 2PBHA 1F2AA 4YV8A 1U9VA 2YJ9A 3H7DA 1U9WA 2WBFX 1AYWA 3MTNA 3N4CA 5EGWA 5A24A 4NV8A 4B55A 2G7YA 4YYSA 2PREA 5JA7A 3HD3A 4FIPA 3I06A 4BQVA 1AU2A 2B1NA 2FQ9A 3MHSA 2R9CA 4MZOA 1NPZA 1KXRA 2R6NA 3CH3X 1U9QX 4N79A 9PAPA 3IHPA 2E01A 1M6DA 2GFOA 1F2BA 3WXFA 2VFBA 5F02A 1DEUA 3H89A 2HXZA 2DCBA 4X6HA 3V6CA 2F1GA 2JQFR 4PADA 3F5VA 4CZWA 2C0YA 3HWNA 1EWLA 1EWPA 4BS6A 1KHPA 4N8WA 1AU3A 1PIPA 3LTWA 4X6JA 4X6IA 1NL6A 2CB5A 2ACTA 2PADA 1F29A 2OP3A 3D9WA 4PP1A 1BGOA 5JH3A 2DJGB 1CS8A 4BPVA 3ERVA 4PP2E 2DCDA 3RVXA 1AIMA 1PBHA 2E00A 2E03A 7PCKA 2BDZA 1YT7A 4I04A 3KWBX 3BPFA 4YYRA 1KFUL 4W5BA 2AUZA 1S4VA 4WA6A 5CHTA 4CDEB 1BY8A 3OVZA 1PCIA 3P5XA 3KWZA 4G54A 3S3RA 1BP4A 3E1ZB 2HHNA 1CJLA 3PW3A 4N4ZA 1TL9A 2G8JA 2O6XA 1YK7A 3WXGA 4CDFB 3IEJA 3RVVA 4BS5A 4QRVA 1ATKA 1MIRA 4NV7A 4QRGA 1E2TA 4YYWA 3KX1A 1CV8A 4BGFA 2XU1A 4HWYA 4I07A 1W4TA 2AYNA 1QOLA 1QMYA 1CPJA 1THEA 3I3TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K9M A;  5EF4 A;  1VSN A;  2AIM A;  1POP A;  3KSE A;  3C9E A;  3OVX A;  4P6G A;  2F7D A;  1ME3 A;  4OEM A;  2YJB A;  2YJC A;  3LFY A;  1HUC B;  1CSB B;  2VHF A;  1U9X A;  2GHU A;  3CH2 X;  4BSQ A;  2R9N A;  3O0U A;  1O0E A;  1DF0 A;  3BPM A;  1CB5 A;  2G8E A;  1K3B B;  3QJ3 A;  1MS6 A;  1A6R A;  3TNX A;  4FJC A;  1ICF A;  1YK8 A;  5K16 A;  2P0R A;  4DMX A;  2JQG R;  3GCB A;  2CIO A;  4OEL A;  1NB3 A;  6PAD A;  1GCB A;  1KFX L;  2NQD B;  1EWM A;  2FRQ A;  3K24 A;  3USV A;  3F75 A;  4P6E A;  3CBJ A;  4I05 A;  3WXE A;  1MEG A;  1PPP A;  1ZCM A;  2YJ2 A;  1IWD A;  4Q8G A;  1EWO A;  5CVM A;  4RY2 A;  3H6S A;  2XU3 A;  1BQI A;  4Q8H A;  2H7J A;  4YYV A;  1XKG A;  1NQC A;  3ZUA A;  3IMA A;  2YJ8 A;  2NQA A;  2E02 A;  1ZIV A;  3O1G A;  1ITO A;  1JQP A;  2AU1 A;  1TLO A;  1Y4H A;  3LXS A;  4W5C A;  2PNS A;  2DC8 A;  1YVB A;  2XU4 A;  4PI3 A;  3BC3 A;  5PAD A;  4MZS A;  1PPN A;  1Y08 A;  5FPW A;  3HHA A;  3KFQ A;  3B79 A;  1F2C A;  4AXM A;  3OF8 A;  1TU6 A;  1CVZ A;  1GMY A;  4KLB A;  1MHW A;  4DMY A;  2AYO A;  2HH5 A;  1PXV A;  1AYU A;  1CTE A;  3BWK A;  2VHS A;  2NQG A;  2DZZ A;  3BOW A;  1NB5 A;  4YYU A;  3H8B A;  2FT2 A;  1YAL A;  3N3K A;  5CHV A;  8PCH A;  1QDQ A;  2IPP B;  2DC7 A;  3S3Q A;  2Y6E A;  2Y5B A;  1VJV A;  2P7U A;  3MHH A;  3PNR A;  1EF7 A;  3RVW A;  2HD5 A;  2XU5 A;  1AYV A;  3QT4 A;  1SNK A;  1Q6K A;  1FH0 A;  2DCC A;  4QH6 A;  2R9F A;  2IBI A;  2FRA A;  3MOR A;  1PE6 A;  3AI8 A;  3P5W A;  4XR7 A;  3M99 A;  4XUI A;  4K7C A;  4QRX A;  3P5U A;  1MDW A;  1AEC A;  1PAD A;  3KKU A;  5J94 A;  2AVW A;  2AS8 A;  3CBK A;  2AUX A;  4YVA A;  3NHE A;  4W4U A;  3H8C A;  4YYQ A;  1AU4 A;  1GLO A;  1CQD A;  2R9O A;  1NLJ A;  3PDF A;  4ZUX U;  1PPO A;  1ME4 A;  4MSX A;  5CVO B;  2OUL A;  1SP4 B;  2FO5 A;  2FUD A;  2NQI A;  2OZ2 A;  2P86 A;  1GEC E;  2R9M A;  3N3G A;  1KHQ A;  2DCA A;  4FK5 A;  4CDC B;  3U8E A;  1STF E;  2G6D A;  2B1M A;  3BCN A;  2DC6 A;  3IUT A;  3OF9 A;  1MEM A;  1QXP A;  2FTD A;  4CDD B;  1U5I A;  3OIS A;  1AU0 A;  3K8U A;  3P5V A;  2DZY A;  2ATO A;  5CVN B;  3KW9 A;  3PBH A;  3HHI A;  1X9Y A;  3D6S A;  3IV2 A;  3QSD A;  4AXL A;  3DF0 A;  2DJF B;  2DC9 A;  1PPD A;  2FYE A;  2BDL A;  4QBB A;  3V6E A;  2ARY A;  3IOQ A;  2PBH A;  1F2A A;  4YV8 A;  1U9V A;  2YJ9 A;  3H7D A;  1U9W A;  2WBF X;  1AYW A;  3MTN A;  3N4C A;  5EGW A;  5A24 A;  2G7Y A;  4YYS A;  2PRE A;  5JA7 A;  3HD3 A;  4FIP A;  3I06 A;  4BQV A;  1AU2 A;  2B1N A;  2FQ9 A;  3MHS A;  2R9C A;  4MZO A;  1NPZ A;  1KXR A;  2R6N A;  3CH3 X;  1U9Q X;  4N79 A;  9PAP A;  3IHP A;  2E01 A;  1M6D A;  2GFO A;  1F2B A;  3WXF A;  5F02 A;  1DEU A;  3H89 A;  2HXZ A;  2DCB A;  4X6H A;  3V6C A;  2F1G A;  2JQF R;  4PAD A;  3F5V A;  4CZW A;  2C0Y A;  3HWN A;  1EWL A;  1EWP A;  4BS6 A;  1KHP A;  4N8W A;  1AU3 A;  1PIP A;  4X6J A;  4X6I A;  1NL6 A;  2CB5 A;  2ACT A;  2PAD A;  1F29 A;  2OP3 A;  4PP1 A;  1BGO A;  5JH3 A;  2DJG B;  1CS8 A;  4BPV A;  3ERV A;  4PP2 E;  2DCD A;  3RVX A;  1AIM A;  1PBH A;  2E00 A;  2E03 A;  7PCK A;  2BDZ A;  1YT7 A;  4I04 A;  3KWB X;  3BPF A;  4YYR A;  1KFU L;  4W5B A;  2AUZ A;  1S4V A;  4WA6 A;  5CHT A;  4CDE B;  1BY8 A;  3OVZ A;  1PCI A;  3P5X A;  3KWZ A;  4G54 A;  3S3R A;  1BP4 A;  3E1Z B;  2HHN A;  1CJL A;  3PW3 A;  4N4Z A;  1TL9 A;  2G8J A;  2O6X A;  1YK7 A;  3WXG A;  4CDF B;  3IEJ A;  3RVV A;  4BS5 A;  4QRV A;  1ATK A;  1MIR A;  4QRG A;  4YYW A;  3KX1 A;  1CV8 A;  2XU1 A;  4HWY A;  4I07 A;  2AYN A;  1QOL A;  1QMY A;  1CPJ A;  1THE A;  3I3T A; 
#chains in the Genus database with same CATH topology
 3K9M A;  5EF4 A;  1VSN A;  2AIM A;  1POP A;  3KSE A;  3C9E A;  3OVX A;  4P6G A;  2AGA A;  2F7D A;  1ME3 A;  4OEM A;  2YJB A;  3W30 A;  2YJC A;  3LFY A;  4ZTB A;  1HUC B;  1CSB B;  4GUA A;  4MM3 B;  2VHF A;  1U9X A;  4PT5 A;  3C0R A;  2GHU A;  3CH2 X;  4BSQ A;  2R9N A;  3O0U A;  4WUR A;  1O0E A;  1DF0 A;  3BPM A;  1CB5 A;  2G8E A;  1K3B B;  4OVZ B;  3QJ3 A;  1MS6 A;  1A6R A;  3TNX A;  4FJC A;  1ICF A;  1YK8 A;  5K16 A;  2P0R A;  4DMX A;  4BOQ A;  2JQG R;  3GCB A;  2CIO A;  3PSE A;  4OEL A;  1NB3 A;  6PAD A;  1GCB A;  1KFX L;  2NQD B;  1EWM A;  2FRQ A;  3K24 A;  3USV A;  3F75 A;  4P6E A;  3CBJ A;  4I05 A;  3WXE A;  1MEG A;  4OVZ A;  3BBA A;  1PPP A;  1ZCM A;  2UZJ A;  2YJ2 A;  4IUM A;  1IWD A;  4Q8G A;  2JTC A;  2BU3 A;  1EWO A;  5CVM A;  2JRI A;  4IP3 A;  3H6S A;  4RY2 A;  2XU3 A;  1BQI A;  4RF0 A;  4Q8H A;  2H7J A;  4YYV A;  1XKG A;  1NQC A;  3ZUA A;  3IMA A;  2YJ8 A;  4RF1 A;  2NQA A;  2E02 A;  1ZIV A;  3O1G A;  1ITO A;  1JQP A;  3PHX A;  2AU1 A;  1TLO A;  1Y4H A;  3LXS A;  4W5C A;  2PNS A;  2DC8 A;  1YVB A;  2XU4 A;  4PI3 A;  3BC3 A;  5PAD A;  4MZS A;  1PPN A;  1Y08 A;  5FPW A;  3HHA A;  3KFQ A;  3B79 A;  1F2C A;  4AXM A;  3OF8 A;  1TU6 A;  1CVZ A;  1GMY A;  4KLB A;  1MHW A;  4DMY A;  2AYO A;  2HH5 A;  1PXV A;  1AYU A;  1CTE A;  3BWK A;  4R3D A;  2VHS A;  2NQG A;  4MI7 A;  2DZZ A;  2DOS A;  3BOW A;  1NB5 A;  4YYU A;  3H8B A;  2J7Q A;  2FT2 A;  4REZ A;  2Z84 A;  1YAL A;  3N3K A;  5CHV A;  8PCH A;  2J7Q C;  1QDQ A;  2IPP B;  2DC7 A;  3S3Q A;  2Y6E A;  2Y5B A;  4BOZ A;  1VJV A;  2P7U A;  3MHH A;  3PNR A;  1EF7 A;  2HD5 A;  3RVW A;  2XU5 A;  1AYV A;  2HWK A;  3QT4 A;  1SNK A;  1Q6K A;  1FH0 A;  2DCC A;  4QH6 A;  2R9F A;  2IBI A;  2FRA A;  3MOR A;  1PE6 A;  3AI8 A;  4RKX A;  3P5W A;  4XR7 A;  3M99 A;  4XUI A;  3IFU A;  4K7C A;  3PRM A;  4RNA A;  4QRX A;  3P5U A;  3B21 A;  1MDW A;  1PVJ A;  1AEC A;  1PAD A;  3KKU A;  4BOP A;  5J94 A;  2AVW A;  2AS8 A;  3CBK A;  2AUX A;  4YVA A;  3NHE A;  4W4U A;  3H8C A;  4YYQ A;  1AU4 A;  4OW0 A;  1GLO A;  3ZNH A;  1CQD A;  2R9O A;  1NLJ A;  3PDF A;  4ZUX U;  1PPO A;  1ME4 A;  3PHU A;  4MSX A;  5CVO B;  2OUL A;  1SP4 B;  2FO5 A;  2FUD A;  2NQI A;  2OZ2 A;  2P86 A;  5EZS A;  1GEC E;  2R9M A;  4D8I A;  3N3G A;  1KHQ A;  2DCA A;  4FK5 A;  4CDC B;  4BOU A;  3U8E A;  1DKI A;  5JZE A;  1STF E;  4HXD B;  4BOS A;  2G6D A;  2B1M A;  3BCN A;  2DC6 A;  3IUT A;  3PRP A;  4XZX A;  3OF9 A;  1MEM A;  1QXP A;  2FTD A;  4CDD B;  1U5I A;  3OIS A;  1AU0 A;  2BTW B;  3K8U A;  3P5V A;  2DZY A;  3PT2 A;  2ATO A;  5CVN B;  3KW9 A;  3PBH A;  3HHI A;  1X9Y A;  3D6S A;  3IV2 A;  3QSD A;  4AXL A;  3O65 A;  3DF0 A;  2DJF B;  2DC9 A;  1PPD A;  2FYE A;  2BDL A;  4QBB A;  2BTW A;  3V6E A;  2ARY A;  3IOQ A;  2PBH A;  1F2A A;  4YV8 A;  1U9V A;  2YJ9 A;  3H7D A;  1U9W A;  2WBF X;  1AYW A;  3MTN A;  1YZB A;  3N4C A;  5EGW A;  5A24 A;  3W31 A;  2G7Y A;  4YYS A;  2PRE A;  5JA7 A;  3HD3 A;  5E6J A;  4FIP A;  3E9S A;  3I06 A;  4BQV A;  1AU2 A;  3BB7 A;  2B1N A;  2FQ9 A;  3MHS A;  2R9C A;  4MZO A;  1NPZ A;  1KXR A;  2R6N A;  3CH3 X;  1U9Q X;  4N79 A;  9PAP A;  3IHP A;  2E01 A;  1M6D A;  2GFO A;  3BY4 A;  1F2B A;  3WXF A;  5F02 A;  1DEU A;  3MJ5 A;  4A5U A;  3H89 A;  2HXZ A;  2DCB A;  3MTV A;  4X6H A;  3V6C A;  2F1G A;  2JQF R;  4D8B A;  4PAD A;  3F5V A;  4CZW A;  2C0Y A;  3HWN A;  1EWL A;  1EWP A;  4M0W A;  4BS6 A;  1KHP A;  4N8W A;  1AU3 A;  1PIP A;  4X6J A;  4X6I A;  3RNV A;  1NL6 A;  2CB5 A;  2ACT A;  2PAD A;  1F29 A;  3OQC A;  2OP3 A;  3MP2 A;  4PP1 A;  1BGO A;  5JH3 A;  2DJG B;  1CS8 A;  4BPV A;  3ERV A;  4PP2 E;  2DCD A;  3RVX A;  1AIM A;  4P16 A;  1PBH A;  2E00 A;  2E03 A;  7PCK A;  2BDZ A;  1YT7 A;  4I04 A;  3KWB X;  3BPF A;  4YYR A;  1KFU L;  4W5B A;  2AUZ A;  3TMP A;  1S4V A;  4WA6 A;  5CHT A;  4CDE B;  1BY8 A;  3OVZ A;  1PCI A;  3P5X A;  3KWZ A;  1UKF A;  4G54 A;  3S3R A;  1BP4 A;  3E1Z B;  2HHN A;  1CJL A;  3PW3 A;  4N4Z A;  1TL9 A;  2G8J A;  2O6X A;  1YK7 A;  3WXG A;  4CDF B;  3IEJ A;  3RVV A;  4BS5 A;  4QRV A;  1ATK A;  3PHW A;  1MIR A;  4QRG A;  2FE8 A;  4YYW A;  3KX1 A;  1CV8 A;  3TRK A;  2XU1 A;  4HWY A;  5KO3 A;  4I07 A;  2AYN A;  4D8E A;  1QOL A;  1QMY A;  5EZQ A;  1CPJ A;  1THE A;  3I3T A; 
#chains in the Genus database with same CATH homology
 3K9M A;  5EF4 A;  1VSN A;  2AIM A;  1POP A;  3KSE A;  3C9E A;  3OVX A;  4P6G A;  2F7D A;  1ME3 A;  4OEM A;  2YJB A;  2YJC A;  3LFY A;  1HUC B;  1CSB B;  2VHF A;  1U9X A;  2GHU A;  3CH2 X;  4BSQ A;  2R9N A;  3O0U A;  1O0E A;  1DF0 A;  3BPM A;  1CB5 A;  2G8E A;  1K3B B;  3QJ3 A;  1MS6 A;  1A6R A;  3TNX A;  4FJC A;  1ICF A;  1YK8 A;  5K16 A;  2P0R A;  4DMX A;  2JQG R;  3GCB A;  2CIO A;  4OEL A;  1NB3 A;  6PAD A;  1GCB A;  1KFX L;  2NQD B;  1EWM A;  2FRQ A;  3K24 A;  3USV A;  3F75 A;  4P6E A;  3CBJ A;  4I05 A;  3WXE A;  1MEG A;  1PPP A;  1ZCM A;  2YJ2 A;  1IWD A;  4Q8G A;  1EWO A;  5CVM A;  4RY2 A;  3H6S A;  1GX3 A;  2XU3 A;  1BQI A;  4Q8H A;  2H7J A;  4YYV A;  1XKG A;  1NQC A;  3ZUA A;  3IMA A;  2YJ8 A;  2NQA A;  2E02 A;  1ZIV A;  3O1G A;  1ITO A;  1JQP A;  2AU1 A;  1TLO A;  1Y4H A;  3LXS A;  4W5C A;  2PNS A;  2DC8 A;  1YVB A;  2XU4 A;  4PI3 A;  3BC3 A;  5PAD A;  4MZS A;  1PPN A;  1Y08 A;  5FPW A;  3HHA A;  3KFQ A;  3B79 A;  1F2C A;  4AXM A;  4C5P A;  3OF8 A;  1TU6 A;  1CVZ A;  1GMY A;  4KLB A;  1MHW A;  4DMY A;  2AYO A;  2HH5 A;  1PXV A;  1AYU A;  1CTE A;  3BWK A;  2VHS A;  2NQG A;  2DZZ A;  3BOW A;  1NB5 A;  4YYU A;  3H8B A;  2FT2 A;  1YAL A;  3N3K A;  5CHV A;  8PCH A;  1QDQ A;  2IPP B;  2DC7 A;  3S3Q A;  2Y6E A;  2Y5B A;  1VJV A;  2P7U A;  3MHH A;  3PNR A;  1EF7 A;  2HD5 A;  3RVW A;  2XU5 A;  1AYV A;  3QT4 A;  1SNK A;  1Q6K A;  1FH0 A;  2DCC A;  4QH6 A;  2R9F A;  2IBI A;  2FRA A;  3MOR A;  1PE6 A;  3AI8 A;  3P5W A;  4XR7 A;  3M99 A;  4XUI A;  1W6F A;  4K7C A;  4QRX A;  2VFC A;  3P5U A;  1MDW A;  1AEC A;  1PAD A;  3KKU A;  5J94 A;  2AVW A;  2AS8 A;  3CBK A;  2AUX A;  4YVA A;  3NHE A;  4W4U A;  3H8C A;  4YYQ A;  1AU4 A;  1GLO A;  1CQD A;  2R9O A;  1NLJ A;  3PDF A;  4ZUX U;  1PPO A;  1ME4 A;  4MSX A;  5CVO B;  2OUL A;  1SP4 B;  2FO5 A;  2FUD A;  4GUZ A;  2NQI A;  2OZ2 A;  2P86 A;  1GEC E;  2R9M A;  3N3G A;  1KHQ A;  2DCA A;  4FK5 A;  4CDC B;  1W5R A;  3U8E A;  1STF E;  2G6D A;  2B1M A;  3BCN A;  2DC6 A;  3IUT A;  3OF9 A;  1MEM A;  1QXP A;  2FTD A;  4CDD B;  1U5I A;  3OIS A;  1AU0 A;  3K8U A;  3P5V A;  2DZY A;  2ATO A;  5CVN B;  3KW9 A;  3PBH A;  3HHI A;  1X9Y A;  3D6S A;  3IV2 A;  3QSD A;  4AXL A;  3DF0 A;  2DJF B;  2DC9 A;  1PPD A;  2FYE A;  2BDL A;  2BSZ A;  4QBB A;  3V6E A;  2ARY A;  3IOQ A;  2PBH A;  1F2A A;  4YV8 A;  1U9V A;  2YJ9 A;  3H7D A;  1U9W A;  2WBF X;  1AYW A;  3MTN A;  3N4C A;  5EGW A;  5A24 A;  4NV8 A;  4B55 A;  2G7Y A;  4YYS A;  2PRE A;  5JA7 A;  3HD3 A;  4FIP A;  3I06 A;  4BQV A;  1AU2 A;  2B1N A;  2FQ9 A;  3MHS A;  2R9C A;  4MZO A;  1NPZ A;  1KXR A;  2R6N A;  3CH3 X;  1U9Q X;  4N79 A;  9PAP A;  3IHP A;  2E01 A;  1M6D A;  2GFO A;  1F2B A;  3WXF A;  2VFB A;  5F02 A;  1DEU A;  3H89 A;  2HXZ A;  2DCB A;  4X6H A;  3V6C A;  2F1G A;  2JQF R;  4PAD A;  3F5V A;  4CZW A;  2C0Y A;  3HWN A;  1EWL A;  1EWP A;  4BS6 A;  1KHP A;  4N8W A;  1AU3 A;  1PIP A;  3LTW A;  4X6J A;  4X6I A;  1NL6 A;  2CB5 A;  2ACT A;  2PAD A;  1F29 A;  2OP3 A;  3D9W A;  4PP1 A;  1BGO A;  5JH3 A;  2DJG B;  1CS8 A;  4BPV A;  3ERV A;  4PP2 E;  2DCD A;  3RVX A;  1AIM A;  1PBH A;  2E00 A;  2E03 A;  7PCK A;  2BDZ A;  1YT7 A;  4I04 A;  3KWB X;  3BPF A;  4YYR A;  1KFU L;  4W5B A;  2AUZ A;  1S4V A;  4WA6 A;  5CHT A;  4CDE B;  1BY8 A;  3OVZ A;  1PCI A;  3P5X A;  3KWZ A;  4G54 A;  3S3R A;  1BP4 A;  3E1Z B;  2HHN A;  1CJL A;  3PW3 A;  4N4Z A;  1TL9 A;  2G8J A;  2O6X A;  1YK7 A;  3WXG A;  4CDF B;  3IEJ A;  3RVV A;  4BS5 A;  4QRV A;  1ATK A;  1MIR A;  4NV7 A;  4QRG A;  1E2T A;  4YYW A;  3KX1 A;  1CV8 A;  4BGF A;  2XU1 A;  4HWY A;  4I07 A;  1W4T A;  2AYN A;  1QOL A;  1QMY A;  1CPJ A;  1THE A;  3I3T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...