1AU3A

Crystal structure of the cysteine protease human cathepsin k in complex with a covalent pyrrolidinone inhibitor
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATHEPSIN K
publication title Conformationally constrained 1,3-diamino ketones: a series of potent inhibitors of the cysteine protease cathepsin K.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 60
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 1997-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1au3A00
1F2CA 1BQIA 3KX1A 4YYWA 2DC6A 9PAPA 2DZYA 1NPZA 2HH5A 5PADA 3H6SA 1U5IA 3BPMA 4PP1A 3IEJA 4X6JA 4CDCB 2PBHA 1AU2A 2AYOA 4YYRA 3HHIA 1TU6A 3BWKA 3IV2A 2DJFB 3RVXA 3PNRA 3BCNA 2FRQA 4Q8HA 1IWDA 3S3QA 2R9CA 3KKUA 2YJ9A 1CS8A 3CH3X 1MS6A 5JH3A 2VHSA 1QMYA 4HWYA 1U9QX 3OVXA 3BOWA 4PP2E 1DEUA 2OP3A 3PDFA 4AXLA 2G6DA 3QSDA 3H7DA 4MZOA 2FO5A 2XU4A 3H8CA 1DF0A 4OEMA 1YALA 3O0UA 2AVWA 2IBIA 3P5VA 4XR7A 3DF0A 6PADA 2HD5A 1CTEA 1EF7A 3CH2X 3V6EA 1NLJA 2AS8A 3IOQA 1AYUA 2BDZA 4QRGA 2HXZA 3MHSA 1EWLA 1PPDA 3C9EA 1X9YA 1NB3A 2FRAA 1U9WA 2DZZA 1FH0A 2B1NA 4P6EA 2R9FA 2E01A 3IUTA 3H8BA 1HUCB 2DCDA 1GCBA 4QRVA 4CDEB 2FT2A 2YJCA 2XU3A 2AIMA 2ACTA 3GCBA 1PPOA 1TLOA 2FUDA 1F2BA 4AXMA 4QH6A 2DJGB 2R9NA 3P5XA 5K16A 2ARYA 3MORA 1AU4A 1EWPA 3USVA 1YK8A 1KXRA 3WXFA 3P5UA 3M99A 1NL6A 1KHPA 2P0RA 1NQCA 5CHVA 1M6DA 4W5BA 2DCAA 1ZCMA 2DC7A 4ZUXU 1MHWA 5CVNB 2DC9A 2AU1A 3QT4A 3V6CA 1PIPA 1PADA 1AU0A 4RY2A 3IMAA 3U8EA 3LFYA 3HD3A 1Y4HA 4DMXA 2O6XA 2NQDB 4I07A 3D6SA 2AYNA 2GHUA 1KHQA 1AECA 4BSQA 4YVAA 3K24A 3IHPA 1EWMA 3WXEA 2Y6EA 2PADA 2G8EA 2FYEA 3N3GA 4Q8GA 3K8UA 4BQVA 1NB5A 3S3RA 2H7JA 4WA6A 4YYUA 2Y5BA 1TL9A 2FTDA 3F75A 3F5VA 4X6IA 3BPFA 1KFXL 2F1GA 2AUZA 1K3BB 2E02A 1U9XA 1ITOA 4N79A 4YYQA 5A24A 3NHEA 1U9VA 2HHNA 2DCBA 1YT7A 1CJLA 2E03A 3O1GA 2CIOA 4CDFB 3P5WA 4N8WA 3QJ3A 1PXVA 1CPJA 1ZIVA 4MSXA 2OULA 2YJ8A 2R9OA 1O0EA 4FJCA 4YV8A 4BS6A 1QXPA 2GFOA 2C0YA 1PBHA 2DC8A 2G8JA 3KW9A 3PBHA 1BY8A 2PNSA 4G54A 3ERVA 1CV8A 1Y08A 2NQGA 5EF4A 1ICFA 2XU1A 1YVBA 2BDLA 5JA7A 2NQIA 3ZUAA 5EGWA 3LXSA 2IPPB 3H89A 4I05A 4X6HA 1QOLA 3MHHA 1GMYA 2G7YA 1PCIA 3K9MA 4DMYA 1CVZA 1SNKA 3MTNA 3OVZA 1STFE 1S4VA 3KSEA 1BP4A 1JQPA 8PCHA 2P86A 1CQDA 2DCCA 1VJVA 4P6GA 1YK7A 5J94A 4BS5A 1MEMA 5CVOB 4N4ZA 1POPA 4CZWA 1THEA 4K7CA 2OZ2A 1F2AA 4FK5A 3KWBX 1MDWA 3PW3A 1ME4A 1AYWA 4QBBA 3HHAA 1Q6KA 3B79A 5FPWA 4YYSA 2YJ2A 2VHFA 4FIPA 4W4UA 4PI3A 1XKGA 3OF8A 1F29A 2NQAA 4YYVA 1GLOA 1BGOA 2PREA 4I04A 2P7UA 4QRXA 2YJBA 1GECE 1SP4B 1MEGA 3CBKA 4XUIA 3RVVA 3I06A 1AU3A 1EWOA 2B1MA 2CB5A 3AI8A 1AIMA 1AYVA 1CB5A 4PADA 2R6NA 1KFUL 2WBFX 3N3KA 2FQ9A 4KLBA 5CVMA 5F02A 3WXGA 3RVWA 1PPNA 2ATOA 3E1ZB 4MZSA 3HWNA 2XU5A 1ATKA 1PE6A 2E00A 2JQFR 1PPPA 1QDQA 3KWZA 2F7DA 1A6RA 3OF9A 4BPVA 1CSBB 4W5CA 1VSNA 5CHTA 3OISA 2R9MA 3I3TA 2AUXA 3TNXA 3BC3A 3KFQA 3CBJA 7PCKA 4CDDB 3N4CA 2JQGR 4OELA 1ME3A 1MIRA
chains in the Genus database with same CATH superfamily
1F2CA 1BQIA 3KX1A 4YYWA 2DC6A 9PAPA 2DZYA 1NPZA 2HH5A 3MTVA 5PADA 3H6SA 4PT5A 4D8EA 4RNAA 1U5IA 3BPMA 4PP1A 3IEJA 4X6JA 4CDCB 4D8BA 2PBHA 1AU2A 2AYOA 4YYRA 3HHIA 1TU6A 4WURA 3BWKA 3IV2A 2DJFB 3RVXA 3PNRA 3BCNA 4RF0A 2FRQA 4Q8HA 1IWDA 3S3QA 2R9CA 3KKUA 2YJ9A 1CS8A 2UZJA 3CH3X 1MS6A 5JH3A 2VHSA 1QMYA 4HWYA 1U9QX 3OVXA 3BOWA 4PP2E 1DEUA 2OP3A 3PDFA 4AXLA 2G6DA 3QSDA 3H7DA 3TMPA 4MZOA 2FO5A 2XU4A 4XZXA 3H8CA 1DF0A 4OEMA 1YALA 3O0UA 2AVWA 2IBIA 4M0WA 3P5VA 4XR7A 3DF0A 6PADA 2HD5A 1CTEA 1EF7A 3CH2X 3V6EA 1NLJA 2AS8A 3IOQA 1AYUA 2BDZA 4QRGA 2HXZA 3MHSA 1EWLA 1PPDA 4OW0A 3C9EA 1X9YA 2JTCA 1NB3A 4OVZB 2FRAA 1U9WA 3C0RA 2DZZA 1FH0A 2B1NA 4P6EA 2R9FA 2E01A 3IUTA 3H8BA 1HUCB 2FE8A 2DCDA 1GCBA 4QRVA 4CDEB 2FT2A 2YJCA 2XU3A 2AIMA 2ACTA 3GCBA 1PPOA 1TLOA 2FUDA 4D8IA 4MM3B 1F2BA 4AXMA 4QH6A 2DJGB 2R9NA 5EZQA 3P5XA 5K16A 2ARYA 3MORA 1AU4A 1EWPA 5E6JA 3USVA 1YK8A 3BY4A 1KXRA 3WXFA 3ZNHA 3P5UA 3M99A 1NL6A 4OVZA 1KHPA 2P0RA 1NQCA 2BTWB 5CHVA 1M6DA 4W5BA 3B21A 2DCAA 1ZCMA 2DC7A 4ZUXU 1MHWA 1UKFA 5CVNB 2DC9A 2AU1A 3BBAA 3QT4A 3V6CA 1PIPA 4IP3A 4A5UA 1PADA 1AU0A 4RY2A 3IMAA 3U8EA 3LFYA 3HD3A 1Y4HA 4DMXA 2O6XA 2NQDB 4I07A 4P16A 3D6SA 5KO3A 2AYNA 2GHUA 1KHQA 1AECA 4BSQA 4YVAA 3K24A 3IHPA 1EWMA 3WXEA 2Y6EA 2PADA 2G8EA 2FYEA 3PT2A 3W31A 4REZA 4IUMA 4BOSA 3N3GA 4RKXA 3W30A 4Q8GA 3K8UA 4BQVA 2HWKA 1NB5A 3TRKA 3S3RA 2H7JA 4WA6A 4YYUA 2Y5BA 1TL9A 2FTDA 3F75A 3F5VA 4X6IA 3BPFA 1KFXL 2F1GA 4GUAA 2AUZA 1K3BB 2E02A 1U9XA 1ITOA 5JZEA 4N79A 4YYQA 3PHWA 5A24A 2Z84A 3NHEA 1DKIA 1U9VA 2HHNA 3IFUA 2DCBA 1YT7A 1CJLA 2E03A 3O1GA 2CIOA 4CDFB 3P5WA 4N8WA 3QJ3A 1PXVA 1CPJA 1ZIVA 3PSEA 4MSXA 2OULA 2BU3A 2YJ8A 2R9OA 1O0EA 4FJCA 4YV8A 4BS6A 1QXPA 2GFOA 2C0YA 4BOZA 1PBHA 2DC8A 4ZTBA 2G8JA 3KW9A 3PBHA 1BY8A 3MP2A 2PNSA 4G54A 3ERVA 1CV8A 1Y08A 2NQGA 5EF4A 1ICFA 2XU1A 1YVBA 2BDLA 3BB7A 5JA7A 2NQIA 3ZUAA 4R3DA 5EGWA 3LXSA 2IPPB 3H89A 3MJ5A 4I05A 4X6HA 1QOLA 1YZBA 3MHHA 1GMYA 3E9SA 2G7YA 1PCIA 3K9MA 4DMYA 1CVZA 1SNKA 3MTNA 3OVZA 1STFE 1S4VA 3KSEA 1BP4A 1JQPA 8PCHA 2P86A 1CQDA 2DCCA 1VJVA 4P6GA 1YK7A 3PHXA 2BTWA 5J94A 4BS5A 1MEMA 5CVOB 4N4ZA 1POPA 4CZWA 1THEA 4K7CA 2OZ2A 1F2AA 4FK5A 3KWBX 1MDWA 3PW3A 1ME4A 1AYWA 2AGAA 4QBBA 3HHAA 1Q6KA 3B79A 5FPWA 3PRPA 4YYSA 2YJ2A 2VHFA 2JRIA 4FIPA 3O65A 4W4UA 4PI3A 1XKGA 3OF8A 2J7QA 1F29A 4RF1A 2NQAA 4YYVA 1GLOA 4HXDB 2J7QC 1BGOA 2PREA 4I04A 2P7UA 4QRXA 2YJBA 1GECE 1SP4B 1MEGA 3CBKA 4XUIA 3RVVA 3I06A 1AU3A 4BOQA 1EWOA 2B1MA 2CB5A 3AI8A 1AIMA 1AYVA 1CB5A 4PADA 2R6NA 4MI7A 1KFUL 2DOSA 5EZSA 3RNVA 2WBFX 3N3KA 2FQ9A 4KLBA 5CVMA 5F02A 3WXGA 3RVWA 1PPNA 2ATOA 3E1ZB 4MZSA 3HWNA 2XU5A 1ATKA 1PE6A 2E00A 2JQFR 3OQCA 1PPPA 1QDQA 3KWZA 2F7DA 1A6RA 4BOPA 3OF9A 4BPVA 1CSBB 1PVJA 1VSNA 4W5CA 5CHTA 3OISA 2R9MA 3PRMA 3I3TA 2AUXA 3TNXA 3BC3A 3KFQA 3CBJA 7PCKA 4CDDB 3N4CA 2JQGR 4OELA 4BOUA 1ME3A 1MIRA 3PHUA
chains in the Genus database with same CATH topology
1F2CA 1BQIA 3KX1A 4YYWA 2DC6A 9PAPA 2DZYA 1NPZA 2HH5A 5PADA 3H6SA 1U5IA 3BPMA 4PP1A 3IEJA 4X6JA 1GX3A 4CDCB 2PBHA 1AU2A 2AYOA 4YYRA 3HHIA 1TU6A 3BWKA 3IV2A 2DJFB 3RVXA 3PNRA 3BCNA 2FRQA 4Q8HA 1IWDA 3S3QA 2R9CA 3KKUA 2YJ9A 1CS8A 3CH3X 1MS6A 5JH3A 2VHSA 1QMYA 4HWYA 3LTWA 1U9QX 3OVXA 3BOWA 4PP2E 1DEUA 2OP3A 3PDFA 4AXLA 2G6DA 3QSDA 3H7DA 4MZOA 2FO5A 1W5RA 2XU4A 3H8CA 1DF0A 4OEMA 1YALA 3O0UA 2AVWA 2IBIA 3P5VA 4XR7A 3DF0A 6PADA 2HD5A 1CTEA 1EF7A 3CH2X 3V6EA 1NLJA 2AS8A 3IOQA 1AYUA 2BDZA 4QRGA 2HXZA 3MHSA 1EWLA 1W4TA 1PPDA 3C9EA 1X9YA 1NB3A 2FRAA 1U9WA 2DZZA 1FH0A 2B1NA 4P6EA 2R9FA 2E01A 3IUTA 3H8BA 1HUCB 2DCDA 1GCBA 4QRVA 4CDEB 2FT2A 4BGFA 2YJCA 2XU3A 2AIMA 2ACTA 3GCBA 1PPOA 1TLOA 2FUDA 1F2BA 4AXMA 4QH6A 2DJGB 2R9NA 3P5XA 5K16A 2ARYA 3MORA 1AU4A 1EWPA 3USVA 1YK8A 1KXRA 3WXFA 1E2TA 3P5UA 3M99A 1NL6A 1KHPA 2P0RA 1NQCA 5CHVA 1M6DA 4W5BA 2DCAA 1ZCMA 2DC7A 4ZUXU 1MHWA 5CVNB 2DC9A 2AU1A 3QT4A 3V6CA 1PIPA 1PADA 1AU0A 4RY2A 3IMAA 3U8EA 3LFYA 3HD3A 1Y4HA 4DMXA 2O6XA 2NQDB 4I07A 3D6SA 2AYNA 2GHUA 1KHQA 1AECA 4BSQA 4YVAA 3K24A 3IHPA 1EWMA 3WXEA 2Y6EA 2PADA 2G8EA 2FYEA 3N3GA 4Q8GA 3K8UA 4BQVA 1NB5A 3S3RA 2H7JA 4WA6A 2VFBA 4YYUA 2Y5BA 1TL9A 2FTDA 3F75A 4B55A 3F5VA 4NV8A 4X6IA 3BPFA 1KFXL 2F1GA 2AUZA 1K3BB 2E02A 1U9XA 1ITOA 4N79A 4YYQA 5A24A 3NHEA 4GUZA 1U9VA 2HHNA 2DCBA 1YT7A 1CJLA 2E03A 3O1GA 4NV7A 2CIOA 4CDFB 3P5WA 4N8WA 3QJ3A 1PXVA 1CPJA 1ZIVA 1W6FA 4MSXA 2OULA 2YJ8A 2R9OA 1O0EA 4FJCA 4YV8A 4BS6A 1QXPA 2GFOA 2C0YA 1PBHA 2DC8A 2G8JA 3KW9A 3PBHA 1BY8A 2PNSA 4G54A 3ERVA 1CV8A 1Y08A 2NQGA 5EF4A 2BSZA 1ICFA 2XU1A 1YVBA 2BDLA 5JA7A 2NQIA 3ZUAA 5EGWA 3LXSA 2IPPB 3H89A 4I05A 4X6HA 1QOLA 3MHHA 1GMYA 2G7YA 1PCIA 3K9MA 4DMYA 1CVZA 1SNKA 3MTNA 3OVZA 1STFE 1S4VA 3KSEA 1BP4A 1JQPA 8PCHA 2P86A 1CQDA 2DCCA 1VJVA 4P6GA 1YK7A 5J94A 4BS5A 1MEMA 5CVOB 4N4ZA 1POPA 4CZWA 1THEA 4K7CA 2OZ2A 1F2AA 4FK5A 3KWBX 1MDWA 3PW3A 1ME4A 1AYWA 4QBBA 3HHAA 1Q6KA 3B79A 5FPWA 4YYSA 2YJ2A 2VFCA 2VHFA 4FIPA 4W4UA 4PI3A 1XKGA 3OF8A 1F29A 2NQAA 4YYVA 1GLOA 1BGOA 2PREA 4I04A 2P7UA 4QRXA 2YJBA 1GECE 1SP4B 1MEGA 3CBKA 4XUIA 3RVVA 3I06A 1AU3A 1EWOA 2B1MA 2CB5A 3AI8A 1AIMA 1AYVA 1CB5A 4PADA 2R6NA 1KFUL 2WBFX 3N3KA 2FQ9A 4KLBA 5CVMA 5F02A 3WXGA 3RVWA 1PPNA 2ATOA 3E1ZB 4MZSA 3HWNA 2XU5A 1ATKA 1PE6A 2E00A 2JQFR 1PPPA 1QDQA 3KWZA 2F7DA 1A6RA 3OF9A 4BPVA 3D9WA 1CSBB 4W5CA 1VSNA 5CHTA 3OISA 2R9MA 3I3TA 2AUXA 3TNXA 3BC3A 3KFQA 3CBJA 7PCKA 4CDDB 3N4CA 2JQGR 4OELA 1ME3A 1MIRA 4C5PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F2C A;  1BQI A;  3KX1 A;  4YYW A;  2DC6 A;  9PAP A;  2DZY A;  1NPZ A;  2HH5 A;  5PAD A;  3H6S A;  1U5I A;  3BPM A;  4PP1 A;  3IEJ A;  4X6J A;  4CDC B;  2PBH A;  1AU2 A;  2AYO A;  4YYR A;  3HHI A;  1TU6 A;  3BWK A;  3IV2 A;  2DJF B;  3RVX A;  3PNR A;  3BCN A;  2FRQ A;  4Q8H A;  1IWD A;  3S3Q A;  2R9C A;  3KKU A;  2YJ9 A;  1CS8 A;  3CH3 X;  1MS6 A;  5JH3 A;  2VHS A;  1QMY A;  4HWY A;  1U9Q X;  3OVX A;  3BOW A;  4PP2 E;  1DEU A;  2OP3 A;  3PDF A;  4AXL A;  2G6D A;  3QSD A;  3H7D A;  4MZO A;  2FO5 A;  2XU4 A;  3H8C A;  1DF0 A;  4OEM A;  1YAL A;  3O0U A;  2AVW A;  2IBI A;  3P5V A;  4XR7 A;  3DF0 A;  6PAD A;  2HD5 A;  1CTE A;  1EF7 A;  3CH2 X;  3V6E A;  1NLJ A;  2AS8 A;  3IOQ A;  1AYU A;  2BDZ A;  4QRG A;  2HXZ A;  3MHS A;  1EWL A;  1PPD A;  3C9E A;  1X9Y A;  1NB3 A;  2FRA A;  1U9W A;  2DZZ A;  1FH0 A;  2B1N A;  4P6E A;  2R9F A;  2E01 A;  3IUT A;  3H8B A;  1HUC B;  2DCD A;  1GCB A;  4QRV A;  4CDE B;  2FT2 A;  2YJC A;  2XU3 A;  2AIM A;  2ACT A;  3GCB A;  1PPO A;  1TLO A;  2FUD A;  1F2B A;  4AXM A;  4QH6 A;  2DJG B;  2R9N A;  3P5X A;  5K16 A;  2ARY A;  3MOR A;  1AU4 A;  1EWP A;  3USV A;  1YK8 A;  1KXR A;  3WXF A;  3P5U A;  3M99 A;  1NL6 A;  1KHP A;  2P0R A;  1NQC A;  5CHV A;  1M6D A;  4W5B A;  2DCA A;  1ZCM A;  2DC7 A;  4ZUX U;  1MHW A;  5CVN B;  2DC9 A;  2AU1 A;  3QT4 A;  3V6C A;  1PIP A;  1PAD A;  1AU0 A;  4RY2 A;  3IMA A;  3U8E A;  3LFY A;  3HD3 A;  1Y4H A;  4DMX A;  2O6X A;  2NQD B;  4I07 A;  3D6S A;  2AYN A;  2GHU A;  1KHQ A;  1AEC A;  4BSQ A;  4YVA A;  3K24 A;  3IHP A;  1EWM A;  3WXE A;  2Y6E A;  2PAD A;  2G8E A;  2FYE A;  3N3G A;  4Q8G A;  3K8U A;  4BQV A;  1NB5 A;  3S3R A;  2H7J A;  4WA6 A;  4YYU A;  2Y5B A;  1TL9 A;  2FTD A;  3F75 A;  3F5V A;  4X6I A;  3BPF A;  1KFX L;  2F1G A;  2AUZ A;  1K3B B;  2E02 A;  1U9X A;  1ITO A;  4N79 A;  4YYQ A;  5A24 A;  3NHE A;  1U9V A;  2HHN A;  2DCB A;  1YT7 A;  1CJL A;  2E03 A;  3O1G A;  2CIO A;  4CDF B;  3P5W A;  4N8W A;  3QJ3 A;  1PXV A;  1CPJ A;  1ZIV A;  4MSX A;  2OUL A;  2YJ8 A;  2R9O A;  1O0E A;  4FJC A;  4YV8 A;  4BS6 A;  1QXP A;  2GFO A;  2C0Y A;  1PBH A;  2DC8 A;  2G8J A;  3KW9 A;  3PBH A;  1BY8 A;  2PNS A;  4G54 A;  3ERV A;  1CV8 A;  1Y08 A;  2NQG A;  5EF4 A;  1ICF A;  2XU1 A;  1YVB A;  2BDL A;  5JA7 A;  2NQI A;  3ZUA A;  5EGW A;  3LXS A;  2IPP B;  3H89 A;  4I05 A;  4X6H A;  1QOL A;  3MHH A;  1GMY A;  2G7Y A;  1PCI A;  3K9M A;  4DMY A;  1CVZ A;  1SNK A;  3MTN A;  3OVZ A;  1STF E;  1S4V A;  3KSE A;  1BP4 A;  1JQP A;  8PCH A;  2P86 A;  1CQD A;  2DCC A;  1VJV A;  4P6G A;  1YK7 A;  5J94 A;  4BS5 A;  1MEM A;  5CVO B;  4N4Z A;  1POP A;  4CZW A;  1THE A;  4K7C A;  2OZ2 A;  1F2A A;  4FK5 A;  3KWB X;  1MDW A;  3PW3 A;  1ME4 A;  1AYW A;  4QBB A;  3HHA A;  1Q6K A;  3B79 A;  5FPW A;  4YYS A;  2YJ2 A;  2VHF A;  4FIP A;  4W4U A;  4PI3 A;  1XKG A;  3OF8 A;  1F29 A;  2NQA A;  4YYV A;  1GLO A;  1BGO A;  2PRE A;  4I04 A;  2P7U A;  4QRX A;  2YJB A;  1GEC E;  1SP4 B;  1MEG A;  3CBK A;  4XUI A;  3RVV A;  3I06 A;  1AU3 A;  1EWO A;  2B1M A;  2CB5 A;  3AI8 A;  1AIM A;  1AYV A;  1CB5 A;  4PAD A;  2R6N A;  1KFU L;  2WBF X;  3N3K A;  2FQ9 A;  4KLB A;  5CVM A;  5F02 A;  3WXG A;  3RVW A;  1PPN A;  2ATO A;  3E1Z B;  4MZS A;  3HWN A;  2XU5 A;  1ATK A;  1PE6 A;  2E00 A;  2JQF R;  1PPP A;  1QDQ A;  3KWZ A;  2F7D A;  1A6R A;  3OF9 A;  4BPV A;  1CSB B;  4W5C A;  1VSN A;  5CHT A;  3OIS A;  2R9M A;  3I3T A;  2AUX A;  3TNX A;  3BC3 A;  3KFQ A;  3CBJ A;  7PCK A;  4CDD B;  3N4C A;  2JQG R;  4OEL A;  1ME3 A;  1MIR A; 
#chains in the Genus database with same CATH topology
 1F2C A;  1BQI A;  3KX1 A;  4YYW A;  2DC6 A;  9PAP A;  2DZY A;  1NPZ A;  2HH5 A;  3MTV A;  5PAD A;  3H6S A;  4PT5 A;  4D8E A;  4RNA A;  1U5I A;  3BPM A;  4PP1 A;  3IEJ A;  4X6J A;  4CDC B;  4D8B A;  2PBH A;  1AU2 A;  2AYO A;  4YYR A;  3HHI A;  1TU6 A;  4WUR A;  3BWK A;  3IV2 A;  2DJF B;  3RVX A;  3PNR A;  3BCN A;  4RF0 A;  2FRQ A;  4Q8H A;  1IWD A;  3S3Q A;  2R9C A;  3KKU A;  2YJ9 A;  1CS8 A;  2UZJ A;  3CH3 X;  1MS6 A;  5JH3 A;  2VHS A;  1QMY A;  4HWY A;  1U9Q X;  3OVX A;  3BOW A;  4PP2 E;  1DEU A;  2OP3 A;  3PDF A;  4AXL A;  2G6D A;  3QSD A;  3H7D A;  3TMP A;  4MZO A;  2FO5 A;  2XU4 A;  4XZX A;  3H8C A;  1DF0 A;  4OEM A;  1YAL A;  3O0U A;  2AVW A;  2IBI A;  4M0W A;  3P5V A;  4XR7 A;  3DF0 A;  6PAD A;  2HD5 A;  1CTE A;  1EF7 A;  3CH2 X;  3V6E A;  1NLJ A;  2AS8 A;  3IOQ A;  1AYU A;  2BDZ A;  4QRG A;  2HXZ A;  3MHS A;  1EWL A;  1PPD A;  4OW0 A;  3C9E A;  1X9Y A;  2JTC A;  1NB3 A;  4OVZ B;  2FRA A;  1U9W A;  3C0R A;  2DZZ A;  1FH0 A;  2B1N A;  4P6E A;  2R9F A;  2E01 A;  3IUT A;  3H8B A;  1HUC B;  2FE8 A;  2DCD A;  1GCB A;  4QRV A;  4CDE B;  2FT2 A;  2YJC A;  2XU3 A;  2AIM A;  2ACT A;  3GCB A;  1PPO A;  1TLO A;  2FUD A;  4D8I A;  4MM3 B;  1F2B A;  4AXM A;  4QH6 A;  2DJG B;  2R9N A;  5EZQ A;  3P5X A;  5K16 A;  2ARY A;  3MOR A;  1AU4 A;  1EWP A;  5E6J A;  3USV A;  1YK8 A;  3BY4 A;  1KXR A;  3WXF A;  3ZNH A;  3P5U A;  3M99 A;  1NL6 A;  4OVZ A;  1KHP A;  2P0R A;  1NQC A;  2BTW B;  5CHV A;  1M6D A;  4W5B A;  3B21 A;  2DCA A;  1ZCM A;  2DC7 A;  4ZUX U;  1MHW A;  1UKF A;  5CVN B;  2DC9 A;  2AU1 A;  3BBA A;  3QT4 A;  3V6C A;  1PIP A;  4IP3 A;  4A5U A;  1PAD A;  1AU0 A;  4RY2 A;  3IMA A;  3U8E A;  3LFY A;  3HD3 A;  1Y4H A;  4DMX A;  2O6X A;  2NQD B;  4I07 A;  4P16 A;  3D6S A;  5KO3 A;  2AYN A;  2GHU A;  1KHQ A;  1AEC A;  4BSQ A;  4YVA A;  3K24 A;  3IHP A;  1EWM A;  3WXE A;  2Y6E A;  2PAD A;  2G8E A;  2FYE A;  3PT2 A;  3W31 A;  4REZ A;  4IUM A;  4BOS A;  3N3G A;  4RKX A;  3W30 A;  4Q8G A;  3K8U A;  4BQV A;  2HWK A;  1NB5 A;  3TRK A;  3S3R A;  2H7J A;  4WA6 A;  4YYU A;  2Y5B A;  1TL9 A;  2FTD A;  3F75 A;  3F5V A;  4X6I A;  3BPF A;  1KFX L;  2F1G A;  4GUA A;  2AUZ A;  1K3B B;  2E02 A;  1U9X A;  1ITO A;  5JZE A;  4N79 A;  4YYQ A;  3PHW A;  5A24 A;  2Z84 A;  3NHE A;  1DKI A;  1U9V A;  2HHN A;  3IFU A;  2DCB A;  1YT7 A;  1CJL A;  2E03 A;  3O1G A;  2CIO A;  4CDF B;  3P5W A;  4N8W A;  3QJ3 A;  1PXV A;  1CPJ A;  1ZIV A;  3PSE A;  4MSX A;  2OUL A;  2BU3 A;  2YJ8 A;  2R9O A;  1O0E A;  4FJC A;  4YV8 A;  4BS6 A;  1QXP A;  2GFO A;  2C0Y A;  4BOZ A;  1PBH A;  2DC8 A;  4ZTB A;  2G8J A;  3KW9 A;  3PBH A;  1BY8 A;  3MP2 A;  2PNS A;  4G54 A;  3ERV A;  1CV8 A;  1Y08 A;  2NQG A;  5EF4 A;  1ICF A;  2XU1 A;  1YVB A;  2BDL A;  3BB7 A;  5JA7 A;  2NQI A;  3ZUA A;  4R3D A;  5EGW A;  3LXS A;  2IPP B;  3H89 A;  3MJ5 A;  4I05 A;  4X6H A;  1QOL A;  1YZB A;  3MHH A;  1GMY A;  3E9S A;  2G7Y A;  1PCI A;  3K9M A;  4DMY A;  1CVZ A;  1SNK A;  3MTN A;  3OVZ A;  1STF E;  1S4V A;  3KSE A;  1BP4 A;  1JQP A;  8PCH A;  2P86 A;  1CQD A;  2DCC A;  1VJV A;  4P6G A;  1YK7 A;  3PHX A;  2BTW A;  5J94 A;  4BS5 A;  1MEM A;  5CVO B;  4N4Z A;  1POP A;  4CZW A;  1THE A;  4K7C A;  2OZ2 A;  1F2A A;  4FK5 A;  3KWB X;  1MDW A;  3PW3 A;  1ME4 A;  1AYW A;  2AGA A;  4QBB A;  3HHA A;  1Q6K A;  3B79 A;  5FPW A;  3PRP A;  4YYS A;  2YJ2 A;  2VHF A;  2JRI A;  4FIP A;  3O65 A;  4W4U A;  4PI3 A;  1XKG A;  3OF8 A;  2J7Q A;  1F29 A;  4RF1 A;  2NQA A;  4YYV A;  1GLO A;  4HXD B;  2J7Q C;  1BGO A;  2PRE A;  4I04 A;  2P7U A;  4QRX A;  2YJB A;  1GEC E;  1SP4 B;  1MEG A;  3CBK A;  4XUI A;  3RVV A;  3I06 A;  1AU3 A;  4BOQ A;  1EWO A;  2B1M A;  2CB5 A;  3AI8 A;  1AIM A;  1AYV A;  1CB5 A;  4PAD A;  2R6N A;  4MI7 A;  1KFU L;  2DOS A;  5EZS A;  3RNV A;  2WBF X;  3N3K A;  2FQ9 A;  4KLB A;  5CVM A;  5F02 A;  3WXG A;  3RVW A;  1PPN A;  2ATO A;  3E1Z B;  4MZS A;  3HWN A;  2XU5 A;  1ATK A;  1PE6 A;  2E00 A;  2JQF R;  3OQC A;  1PPP A;  1QDQ A;  3KWZ A;  2F7D A;  1A6R A;  4BOP A;  3OF9 A;  4BPV A;  1CSB B;  1PVJ A;  1VSN A;  4W5C A;  5CHT A;  3OIS A;  2R9M A;  3PRM A;  3I3T A;  2AUX A;  3TNX A;  3BC3 A;  3KFQ A;  3CBJ A;  7PCK A;  4CDD B;  3N4C A;  2JQG R;  4OEL A;  4BOU A;  1ME3 A;  1MIR A;  3PHU A; 
#chains in the Genus database with same CATH homology
 1F2C A;  1BQI A;  3KX1 A;  4YYW A;  2DC6 A;  9PAP A;  2DZY A;  1NPZ A;  2HH5 A;  5PAD A;  3H6S A;  1U5I A;  3BPM A;  4PP1 A;  3IEJ A;  4X6J A;  1GX3 A;  4CDC B;  2PBH A;  1AU2 A;  2AYO A;  4YYR A;  3HHI A;  1TU6 A;  3BWK A;  3IV2 A;  2DJF B;  3RVX A;  3PNR A;  3BCN A;  2FRQ A;  4Q8H A;  1IWD A;  3S3Q A;  2R9C A;  3KKU A;  2YJ9 A;  1CS8 A;  3CH3 X;  1MS6 A;  5JH3 A;  2VHS A;  1QMY A;  4HWY A;  3LTW A;  1U9Q X;  3OVX A;  3BOW A;  4PP2 E;  1DEU A;  2OP3 A;  3PDF A;  4AXL A;  2G6D A;  3QSD A;  3H7D A;  4MZO A;  2FO5 A;  1W5R A;  2XU4 A;  3H8C A;  1DF0 A;  4OEM A;  1YAL A;  3O0U A;  2AVW A;  2IBI A;  3P5V A;  4XR7 A;  3DF0 A;  6PAD A;  2HD5 A;  1CTE A;  1EF7 A;  3CH2 X;  3V6E A;  1NLJ A;  2AS8 A;  3IOQ A;  1AYU A;  2BDZ A;  4QRG A;  2HXZ A;  3MHS A;  1EWL A;  1W4T A;  1PPD A;  3C9E A;  1X9Y A;  1NB3 A;  2FRA A;  1U9W A;  2DZZ A;  1FH0 A;  2B1N A;  4P6E A;  2R9F A;  2E01 A;  3IUT A;  3H8B A;  1HUC B;  2DCD A;  1GCB A;  4QRV A;  4CDE B;  2FT2 A;  4BGF A;  2YJC A;  2XU3 A;  2AIM A;  2ACT A;  3GCB A;  1PPO A;  1TLO A;  2FUD A;  1F2B A;  4AXM A;  4QH6 A;  2DJG B;  2R9N A;  3P5X A;  5K16 A;  2ARY A;  3MOR A;  1AU4 A;  1EWP A;  3USV A;  1YK8 A;  1KXR A;  3WXF A;  1E2T A;  3P5U A;  3M99 A;  1NL6 A;  1KHP A;  2P0R A;  1NQC A;  5CHV A;  1M6D A;  4W5B A;  2DCA A;  1ZCM A;  2DC7 A;  4ZUX U;  1MHW A;  5CVN B;  2DC9 A;  2AU1 A;  3QT4 A;  3V6C A;  1PIP A;  1PAD A;  1AU0 A;  4RY2 A;  3IMA A;  3U8E A;  3LFY A;  3HD3 A;  1Y4H A;  4DMX A;  2O6X A;  2NQD B;  4I07 A;  3D6S A;  2AYN A;  2GHU A;  1KHQ A;  1AEC A;  4BSQ A;  4YVA A;  3K24 A;  3IHP A;  1EWM A;  3WXE A;  2Y6E A;  2PAD A;  2G8E A;  2FYE A;  3N3G A;  4Q8G A;  3K8U A;  4BQV A;  1NB5 A;  3S3R A;  2H7J A;  4WA6 A;  2VFB A;  4YYU A;  2Y5B A;  1TL9 A;  2FTD A;  3F75 A;  4B55 A;  3F5V A;  4NV8 A;  4X6I A;  3BPF A;  1KFX L;  2F1G A;  2AUZ A;  1K3B B;  2E02 A;  1U9X A;  1ITO A;  4N79 A;  4YYQ A;  5A24 A;  3NHE A;  4GUZ A;  1U9V A;  2HHN A;  2DCB A;  1YT7 A;  1CJL A;  2E03 A;  3O1G A;  4NV7 A;  2CIO A;  4CDF B;  3P5W A;  4N8W A;  3QJ3 A;  1PXV A;  1CPJ A;  1ZIV A;  1W6F A;  4MSX A;  2OUL A;  2YJ8 A;  2R9O A;  1O0E A;  4FJC A;  4YV8 A;  4BS6 A;  1QXP A;  2GFO A;  2C0Y A;  1PBH A;  2DC8 A;  2G8J A;  3KW9 A;  3PBH A;  1BY8 A;  2PNS A;  4G54 A;  3ERV A;  1CV8 A;  1Y08 A;  2NQG A;  5EF4 A;  2BSZ A;  1ICF A;  2XU1 A;  1YVB A;  2BDL A;  5JA7 A;  2NQI A;  3ZUA A;  5EGW A;  3LXS A;  2IPP B;  3H89 A;  4I05 A;  4X6H A;  1QOL A;  3MHH A;  1GMY A;  2G7Y A;  1PCI A;  3K9M A;  4DMY A;  1CVZ A;  1SNK A;  3MTN A;  3OVZ A;  1STF E;  1S4V A;  3KSE A;  1BP4 A;  1JQP A;  8PCH A;  2P86 A;  1CQD A;  2DCC A;  1VJV A;  4P6G A;  1YK7 A;  5J94 A;  4BS5 A;  1MEM A;  5CVO B;  4N4Z A;  1POP A;  4CZW A;  1THE A;  4K7C A;  2OZ2 A;  1F2A A;  4FK5 A;  3KWB X;  1MDW A;  3PW3 A;  1ME4 A;  1AYW A;  4QBB A;  3HHA A;  1Q6K A;  3B79 A;  5FPW A;  4YYS A;  2YJ2 A;  2VFC A;  2VHF A;  4FIP A;  4W4U A;  4PI3 A;  1XKG A;  3OF8 A;  1F29 A;  2NQA A;  4YYV A;  1GLO A;  1BGO A;  2PRE A;  4I04 A;  2P7U A;  4QRX A;  2YJB A;  1GEC E;  1SP4 B;  1MEG A;  3CBK A;  4XUI A;  3RVV A;  3I06 A;  1AU3 A;  1EWO A;  2B1M A;  2CB5 A;  3AI8 A;  1AIM A;  1AYV A;  1CB5 A;  4PAD A;  2R6N A;  1KFU L;  2WBF X;  3N3K A;  2FQ9 A;  4KLB A;  5CVM A;  5F02 A;  3WXG A;  3RVW A;  1PPN A;  2ATO A;  3E1Z B;  4MZS A;  3HWN A;  2XU5 A;  1ATK A;  1PE6 A;  2E00 A;  2JQF R;  1PPP A;  1QDQ A;  3KWZ A;  2F7D A;  1A6R A;  3OF9 A;  4BPV A;  3D9W A;  1CSB B;  4W5C A;  1VSN A;  5CHT A;  3OIS A;  2R9M A;  3I3T A;  2AUX A;  3TNX A;  3BC3 A;  3KFQ A;  3CBJ A;  7PCK A;  4CDD B;  3N4C A;  2JQG R;  4OEL A;  1ME3 A;  1MIR A;  4C5P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...