1AU3A

Crystal structure of the cysteine protease human cathepsin k in complex with a covalent pyrrolidinone inhibitor
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
215
structure length
215
Chain Sequence
b'APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATHEPSIN K
publication title Conformationally constrained 1,3-diamino ketones: a series of potent inhibitors of the cysteine protease cathepsin K.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 60
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 1997-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1au3A00
3M99A 3U8EA 2G8EA 2IBIA 3P5VA 2P86A 3O0UA 3C9EA 3KSEA 2R9FA 1EWOA 3MHSA 3ZUAA 3TNXA 1MHWA 3KX1A 2VHFA 2ARYA 3NHEA 4CDFB 4FIPA 1EWLA 3MHHA 2CB5A 4KLBA 3F75A 1MS6A 1TL9A 3PDFA 5EGWA 4BPVA 2OZ2A 5CVMA 1XKGA 2DCBA 1F2BA 3IHPA 2R9MA 4N79A 5JA7A 3KFQA 4YYSA 2F1GA 4P6GA 1NPZA 4FJCA 1O0EA 4BQVA 3I06A 2F7DA 1Y4HA 3IEJA 3KWBX 2CIOA 1MDWA 2YJ8A 1NL6A 1QOLA 3E1ZB 4DMYA 1PADA 1NLJA 4PP1A 3H6SA 1AYVA 1CJLA 2C0YA 1BQIA 2YJCA 1KXRA 2O6XA 4G54A 4I04A 2BDZA 1AYUA 1MIRA 3OISA 1PPNA 1NQCA 2AYOA 2E03A 3H8CA 2E02A 2HXZA 4Q8GA 1Y08A 4I05A 1CPJA 2AVWA 1A6RA 1CTEA 3PBHA 3IMAA 3OF9A 1U9VA 2PNSA 1ZCMA 2DCCA 3KWZA 3K8UA 5CHVA 2Y6EA 2FUDA 4HWYA 1GMYA 3IV2A 3IUTA 2JQGR 2DC7A 3WXEA 3N4CA 1GLOA 4X6IA 2AU1A 3B79A 3RVWA 2FTDA 4PI3A 1QMYA 1AECA 1STFE 1NB3A 2DCAA 3CH3X 1GECE 1U9XA 1BY8A 1PPOA 1PXVA 2Y5BA 4P6EA 3DF0A 1IWDA 2E01A 1JQPA 3H8BA 5EF4A 1F2AA 2ATOA 2AUZA 3LFYA 4CDDB 3HD3A 4N8WA 2YJBA 4W5CA 1EF7A 2DJGB 2B1MA 2G7YA 3ERVA 5CVNB 4ZUXU 1CSBB 4RY2A 2XU5A 3HWNA 1MEGA 1S4VA 2G6DA 2YJ9A 1U9QX 4MSXA 3LXSA 2VHSA 2R9OA 3BOWA 4CZWA 4I07A 1THEA 4X6HA 1ME3A 1EWMA 2NQDB 5A24A 3S3RA 3KW9A 3S3QA 1MEMA 3K9MA 4FK5A 1PCIA 2YJ2A 2G8JA 8PCHA 1YALA 3OF8A 1NB5A 1Q6KA 3RVXA 3MORA 3N3KA 1KHPA 2R9NA 7PCKA 2NQGA 1PBHA 2AIMA 4MZOA 2XU3A 2DZYA 1KFXL 1KFUL 2FT2A 2XU4A 2FRAA 3BPMA 4BSQA 3AI8A 1KHQA 1CVZA 3BWKA 3HHAA 3QT4A 4AXMA 4QRXA 3CBKA 2FO5A 4YYVA 2DC6A 2WBFX 3F5VA 2IPPB 3HHIA 4QH6A 1F29A 2AUXA 4XUIA 1M6DA 1TLOA 1YK8A 2JQFR 1DEUA 4YYUA 3O1GA 3P5WA 4CDEB 1GCBA 1SNKA 3QJ3A 3BC3A 4CDCB 3V6EA 1ICFA 4W4UA 2R6NA 4MZSA 4W5BA 3H7DA 2DJFB 2PBHA 5CHTA 4PP2E 2FRQA 2R9CA 1TU6A 2HH5A 3OVZA 1AYWA 1YVBA 1ATKA 4QRVA 1SP4B 1U9WA 2DCDA 3QSDA 3WXGA 4XR7A 2E00A 4QBBA 1AU0A 1VJVA 2HHNA 2B1NA 9PAPA 1VSNA 1AU4A 1PPDA 3H89A 1CV8A 2BDLA 4YYQA 3BCNA 4N4ZA 4QRGA 1EWPA 2P7UA 1DF0A 1QXPA 1BGOA 3V6CA 1AU3A 2P0RA 2OULA 4YVAA 2AS8A 3P5UA 1X9YA 2DC8A 5K16A 2PREA 2H7JA 3GCBA 2XU1A 3PNRA 3CBJA 2NQAA 2NQIA 2PADA 3WXFA 6PADA 1AU2A 5FPWA 4X6JA 1U5IA 4YV8A 2DC9A 1ZIVA 3BPFA 3PW3A 1CQDA 4OELA 4DMXA 4YYWA 3RVVA 5F02A 4Q8HA 1YT7A 3P5XA 1BP4A 4WA6A 1K3BB 4OEMA 2HD5A 3IOQA 1PPPA 3CH2X 5CVOB 2ACTA 2OP3A 1F2CA 3USVA 1ITOA 4PADA 4K7CA 1ME4A 1FH0A 5PADA 3OVXA 4BS6A 1HUCB 4AXLA 2GFOA 4YYRA 1POPA 4BS5A 3K24A 1PIPA 1AIMA 3N3GA 2FYEA 1PE6A 1CS8A 3I3TA 2AYNA 1YK7A 5JH3A 2FQ9A 2GHUA 3MTNA 3KKUA 3D6SA 5J94A 1CB5A 2DZZA 1QDQA
chains in the Genus database with same CATH superfamily
3M99A 4BOPA 2Z84A 3U8EA 3W31A 2G8EA 2IBIA 3P5VA 2P86A 2UZJA 3O0UA 3C9EA 3KSEA 2R9FA 1EWOA 3MHSA 3ZUAA 3TNXA 1MHWA 3KX1A 3ZNHA 2FE8A 2VHFA 2ARYA 1PVJA 2JTCA 3NHEA 4CDFB 4OW0A 4RF1A 4FIPA 1EWLA 3MHHA 2CB5A 4KLBA 3F75A 1MS6A 1TL9A 3PDFA 2AGAA 5EGWA 4BPVA 2OZ2A 5CVMA 1XKGA 3PSEA 2DCBA 1F2BA 3IHPA 4A5UA 2R9MA 4N79A 4BOZA 5JA7A 3KFQA 4YYSA 3BB7A 2F1GA 3PHUA 4P6GA 1NPZA 4FJCA 1O0EA 4BQVA 3I06A 2F7DA 1Y4HA 3IEJA 3KWBX 2CIOA 1MDWA 2YJ8A 1NL6A 1QOLA 3E1ZB 4DMYA 1PADA 1NLJA 4PP1A 3H6SA 3O65A 1AYVA 1CJLA 2DOSA 2C0YA 1BQIA 2YJCA 1KXRA 2O6XA 4G54A 3MJ5A 4I04A 4BOQA 4ZTBA 2BDZA 1AYUA 1MIRA 3OISA 3PHWA 4D8IA 1PPNA 1NQCA 2JRIA 2AYOA 2E03A 3H8CA 2E02A 2HXZA 4Q8GA 5KO3A 1Y08A 4I05A 1CPJA 3BBAA 4P16A 2AVWA 3TMPA 1A6RA 1CTEA 3PBHA 3IMAA 1DKIA 3OF9A 1U9VA 2PNSA 1ZCMA 2DCCA 3KWZA 3K8UA 5CHVA 2Y6EA 2FUDA 3PRPA 4HWYA 1GMYA 3IV2A 3IUTA 2JQGR 2DC7A 3WXEA 3N4CA 1GLOA 4X6IA 4OVZA 2AU1A 3B79A 4HXDB 3RVWA 2FTDA 4PI3A 1QMYA 1AECA 1STFE 1NB3A 4R3DA 2DCAA 3CH3X 1GECE 1U9XA 1BY8A 1PPOA 1PXVA 2Y5BA 4P6EA 4RNAA 3DF0A 3C0RA 1IWDA 3PHXA 2E01A 1JQPA 3H8BA 5EF4A 1F2AA 2ATOA 2AUZA 3LFYA 4CDDB 3HD3A 4N8WA 4BOUA 2YJBA 4W5CA 1EF7A 2DJGB 2B1MA 2G7YA 2BTWB 3ERVA 5CVNB 4ZUXU 1CSBB 3PRMA 4RY2A 2XU5A 3HWNA 1MEGA 1S4VA 2G6DA 2YJ9A 1U9QX 4MSXA 3LXSA 2VHSA 2R9OA 3BOWA 4CZWA 4I07A 1THEA 4X6HA 1ME3A 1EWMA 2NQDB 5A24A 3E9SA 3S3RA 4D8EA 3KW9A 3S3QA 1MEMA 4WURA 3K9MA 4FK5A 1PCIA 2YJ2A 2G8JA 2J7QC 8PCHA 1YZBA 1YALA 4D8BA 3OF8A 1NB5A 1Q6KA 3RVXA 3MORA 3N3KA 1KHPA 2R9NA 7PCKA 2NQGA 1PBHA 2AIMA 4MZOA 2XU3A 2DZYA 1KFXL 1KFUL 2FT2A 2XU4A 4RF0A 3W30A 2FRAA 3BPMA 4BSQA 3AI8A 1KHQA 3IFUA 1CVZA 3BWKA 4XZXA 3HHAA 3QT4A 5E6JA 5JZEA 4AXMA 4QRXA 3CBKA 2FO5A 4YYVA 2DC6A 2WBFX 3F5VA 2IPPB 3HHIA 4QH6A 1F29A 2AUXA 4XUIA 1M6DA 1TLOA 1YK8A 2JQFR 1DEUA 4REZA 4YYUA 3O1GA 3P5WA 4CDEB 1GCBA 1SNKA 3QJ3A 3BC3A 4CDCB 3V6EA 1ICFA 4W4UA 4IUMA 2R6NA 1UKFA 4MZSA 4W5BA 3H7DA 2DJFB 2PBHA 2J7QA 5CHTA 4PP2E 2FRQA 2R9CA 1TU6A 2HH5A 3OVZA 1AYWA 1YVBA 1ATKA 4QRVA 2BTWA 1SP4B 1U9WA 2DCDA 3QSDA 3WXGA 4XR7A 2E00A 4QBBA 4GUAA 3B21A 1AU0A 1VJVA 2HHNA 2B1NA 9PAPA 1VSNA 1AU4A 1PPDA 3H89A 1CV8A 2BDLA 4YYQA 3BCNA 4N4ZA 4QRGA 1EWPA 2P7UA 3MP2A 1DF0A 1QXPA 1BGOA 3V6CA 1AU3A 2P0RA 2OULA 4YVAA 2AS8A 4RKXA 3P5UA 1X9YA 2DC8A 5K16A 2PREA 3BY4A 3PT2A 2H7JA 3GCBA 2XU1A 3PNRA 3CBJA 4M0WA 2HWKA 2NQAA 2NQIA 3MTVA 2PADA 3TRKA 3WXFA 6PADA 1AU2A 4IP3A 5FPWA 4X6JA 1U5IA 2BU3A 2DC9A 4YV8A 1ZIVA 5EZQA 3BPFA 3PW3A 1CQDA 4OELA 4DMXA 4YYWA 3RVVA 5F02A 4BOSA 4Q8HA 1YT7A 3P5XA 1BP4A 4WA6A 4MI7A 1K3BB 4OEMA 2HD5A 3IOQA 1PPPA 3CH2X 5CVOB 2ACTA 2OP3A 1F2CA 3USVA 1ITOA 4PADA 4K7CA 4MM3B 1ME4A 1FH0A 5PADA 3OVXA 4BS6A 3RNVA 1HUCB 5EZSA 4AXLA 2GFOA 4YYRA 1POPA 3OQCA 4BS5A 4PT5A 3K24A 1PIPA 1AIMA 3N3GA 2FYEA 1PE6A 1CS8A 3I3TA 2AYNA 1YK7A 5JH3A 2FQ9A 2GHUA 3MTNA 3KKUA 3D6SA 5J94A 4OVZB 1CB5A 2DZZA 1QDQA
chains in the Genus database with same CATH topology
3M99A 3U8EA 2G8EA 2IBIA 3P5VA 2P86A 3O0UA 3C9EA 3KSEA 2R9FA 1EWOA 3MHSA 3ZUAA 4NV7A 3TNXA 1MHWA 3KX1A 2VHFA 2ARYA 3NHEA 4CDFB 4FIPA 1EWLA 3MHHA 2CB5A 4KLBA 3F75A 1MS6A 1TL9A 3PDFA 5EGWA 4BPVA 4BGFA 2OZ2A 5CVMA 1XKGA 2DCBA 1F2BA 3IHPA 2R9MA 4N79A 5JA7A 3KFQA 4YYSA 1E2TA 2F1GA 4P6GA 1NPZA 4FJCA 1O0EA 4BQVA 3I06A 2F7DA 1Y4HA 3IEJA 3KWBX 2CIOA 1MDWA 2YJ8A 1NL6A 1QOLA 3E1ZB 4DMYA 1PADA 1NLJA 4PP1A 3H6SA 1AYVA 4NV8A 1CJLA 2C0YA 1BQIA 2YJCA 1KXRA 2O6XA 4G54A 4I04A 2BDZA 1AYUA 1MIRA 3OISA 1PPNA 1NQCA 2AYOA 2E03A 3H8CA 2E02A 2HXZA 4Q8GA 1Y08A 4I05A 1CPJA 2AVWA 1A6RA 1CTEA 3PBHA 3IMAA 3OF9A 1U9VA 2PNSA 1ZCMA 2DCCA 3KWZA 3K8UA 5CHVA 2VFBA 2FUDA 2Y6EA 4HWYA 3D9WA 1GMYA 3IV2A 3IUTA 2JQGR 2DC7A 3WXEA 3N4CA 1GLOA 4X6IA 2AU1A 3B79A 3RVWA 2FTDA 4PI3A 1QMYA 1AECA 1STFE 1NB3A 2DCAA 3CH3X 1GECE 1U9XA 2VFCA 1BY8A 1PPOA 1PXVA 2Y5BA 4P6EA 3DF0A 4GUZA 1IWDA 2E01A 1JQPA 3H8BA 5EF4A 1F2AA 2ATOA 2AUZA 3LFYA 4CDDB 3HD3A 4N8WA 2YJBA 4W5CA 1EF7A 2DJGB 2B1MA 2G7YA 3LTWA 3ERVA 5CVNB 4ZUXU 1CSBB 4RY2A 2XU5A 3HWNA 1MEGA 1S4VA 2G6DA 2YJ9A 1U9QX 4MSXA 3LXSA 2VHSA 1W6FA 2R9OA 3BOWA 4CZWA 4I07A 1THEA 4X6HA 1ME3A 1EWMA 2NQDB 5A24A 3S3RA 3KW9A 3S3QA 1MEMA 3K9MA 1GX3A 4FK5A 1PCIA 2YJ2A 2G8JA 8PCHA 1YALA 4B55A 3OF8A 1NB5A 1Q6KA 3RVXA 3MORA 3N3KA 1KHPA 2R9NA 7PCKA 2NQGA 1PBHA 2AIMA 4MZOA 2XU3A 2DZYA 1KFXL 1KFUL 2FT2A 2XU4A 2FRAA 3BPMA 4BSQA 3AI8A 1KHQA 1CVZA 3BWKA 3HHAA 3QT4A 4AXMA 4QRXA 3CBKA 2FO5A 1W4TA 4YYVA 2DC6A 2WBFX 3F5VA 2IPPB 3HHIA 4QH6A 1F29A 2AUXA 4XUIA 1M6DA 1TLOA 1YK8A 2JQFR 1DEUA 4YYUA 3O1GA 3P5WA 4CDEB 1GCBA 1SNKA 3QJ3A 3BC3A 4CDCB 3V6EA 1ICFA 4W4UA 2R6NA 4MZSA 4W5BA 3H7DA 2DJFB 2PBHA 5CHTA 4PP2E 2FRQA 2R9CA 4C5PA 1TU6A 2HH5A 3OVZA 1AYWA 1YVBA 1ATKA 4QRVA 1SP4B 1U9WA 2DCDA 3QSDA 3WXGA 4XR7A 2E00A 4QBBA 1AU0A 1VJVA 2HHNA 2B1NA 9PAPA 1VSNA 1AU4A 1PPDA 3H89A 1CV8A 2BDLA 4YYQA 3BCNA 4N4ZA 4QRGA 1EWPA 2P7UA 1DF0A 1QXPA 1BGOA 3V6CA 1AU3A 2P0RA 2OULA 4YVAA 2AS8A 3P5UA 1X9YA 2DC8A 5K16A 2PREA 2H7JA 3GCBA 2XU1A 3PNRA 3CBJA 2NQAA 2NQIA 1W5RA 2PADA 3WXFA 6PADA 1AU2A 5FPWA 4X6JA 1U5IA 4YV8A 2DC9A 1ZIVA 3BPFA 3PW3A 1CQDA 4OELA 4DMXA 4YYWA 3RVVA 5F02A 4Q8HA 1YT7A 3P5XA 1BP4A 4WA6A 1K3BB 4OEMA 2HD5A 3IOQA 1PPPA 3CH2X 5CVOB 2ACTA 2OP3A 1F2CA 3USVA 1ITOA 4PADA 4K7CA 1ME4A 1FH0A 5PADA 3OVXA 4BS6A 1HUCB 4AXLA 2GFOA 4YYRA 1POPA 4BS5A 3K24A 1PIPA 1AIMA 3N3GA 2FYEA 1PE6A 1CS8A 2BSZA 3I3TA 2AYNA 1YK7A 5JH3A 2FQ9A 2GHUA 3MTNA 3KKUA 3D6SA 5J94A 1CB5A 2DZZA 1QDQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M99 A;  3U8E A;  2G8E A;  2IBI A;  3P5V A;  2P86 A;  3O0U A;  3C9E A;  3KSE A;  2R9F A;  1EWO A;  3MHS A;  3ZUA A;  3TNX A;  1MHW A;  3KX1 A;  2VHF A;  2ARY A;  3NHE A;  4CDF B;  4FIP A;  1EWL A;  3MHH A;  2CB5 A;  4KLB A;  3F75 A;  1MS6 A;  1TL9 A;  3PDF A;  5EGW A;  4BPV A;  2OZ2 A;  5CVM A;  1XKG A;  2DCB A;  1F2B A;  3IHP A;  2R9M A;  4N79 A;  5JA7 A;  3KFQ A;  4YYS A;  2F1G A;  4P6G A;  1NPZ A;  4FJC A;  1O0E A;  4BQV A;  3I06 A;  2F7D A;  1Y4H A;  3IEJ A;  3KWB X;  2CIO A;  1MDW A;  2YJ8 A;  1NL6 A;  1QOL A;  3E1Z B;  4DMY A;  1PAD A;  1NLJ A;  4PP1 A;  3H6S A;  1AYV A;  1CJL A;  2C0Y A;  1BQI A;  2YJC A;  1KXR A;  2O6X A;  4G54 A;  4I04 A;  2BDZ A;  1AYU A;  1MIR A;  3OIS A;  1PPN A;  1NQC A;  2AYO A;  2E03 A;  3H8C A;  2E02 A;  2HXZ A;  4Q8G A;  1Y08 A;  4I05 A;  1CPJ A;  2AVW A;  1A6R A;  1CTE A;  3PBH A;  3IMA A;  3OF9 A;  1U9V A;  2PNS A;  1ZCM A;  2DCC A;  3KWZ A;  3K8U A;  5CHV A;  2Y6E A;  2FUD A;  4HWY A;  1GMY A;  3IV2 A;  3IUT A;  2JQG R;  2DC7 A;  3WXE A;  3N4C A;  1GLO A;  4X6I A;  2AU1 A;  3B79 A;  3RVW A;  2FTD A;  4PI3 A;  1QMY A;  1AEC A;  1STF E;  1NB3 A;  2DCA A;  3CH3 X;  1GEC E;  1U9X A;  1BY8 A;  1PPO A;  1PXV A;  2Y5B A;  4P6E A;  3DF0 A;  1IWD A;  2E01 A;  1JQP A;  3H8B A;  5EF4 A;  1F2A A;  2ATO A;  2AUZ A;  3LFY A;  4CDD B;  3HD3 A;  4N8W A;  2YJB A;  4W5C A;  1EF7 A;  2DJG B;  2B1M A;  2G7Y A;  3ERV A;  5CVN B;  4ZUX U;  1CSB B;  4RY2 A;  2XU5 A;  3HWN A;  1MEG A;  1S4V A;  2G6D A;  2YJ9 A;  1U9Q X;  4MSX A;  3LXS A;  2VHS A;  2R9O A;  3BOW A;  4CZW A;  4I07 A;  1THE A;  4X6H A;  1ME3 A;  1EWM A;  2NQD B;  5A24 A;  3S3R A;  3KW9 A;  3S3Q A;  1MEM A;  3K9M A;  4FK5 A;  1PCI A;  2YJ2 A;  2G8J A;  8PCH A;  1YAL A;  3OF8 A;  1NB5 A;  1Q6K A;  3RVX A;  3MOR A;  3N3K A;  1KHP A;  2R9N A;  7PCK A;  2NQG A;  1PBH A;  2AIM A;  4MZO A;  2XU3 A;  2DZY A;  1KFX L;  1KFU L;  2FT2 A;  2XU4 A;  2FRA A;  3BPM A;  4BSQ A;  3AI8 A;  1KHQ A;  1CVZ A;  3BWK A;  3HHA A;  3QT4 A;  4AXM A;  4QRX A;  3CBK A;  2FO5 A;  4YYV A;  2DC6 A;  2WBF X;  3F5V A;  2IPP B;  3HHI A;  4QH6 A;  1F29 A;  2AUX A;  4XUI A;  1M6D A;  1TLO A;  1YK8 A;  2JQF R;  1DEU A;  4YYU A;  3O1G A;  3P5W A;  4CDE B;  1GCB A;  1SNK A;  3QJ3 A;  3BC3 A;  4CDC B;  3V6E A;  1ICF A;  4W4U A;  2R6N A;  4MZS A;  4W5B A;  3H7D A;  2DJF B;  2PBH A;  5CHT A;  4PP2 E;  2FRQ A;  2R9C A;  1TU6 A;  2HH5 A;  3OVZ A;  1AYW A;  1YVB A;  1ATK A;  4QRV A;  1SP4 B;  1U9W A;  2DCD A;  3QSD A;  3WXG A;  4XR7 A;  2E00 A;  4QBB A;  1AU0 A;  1VJV A;  2HHN A;  2B1N A;  9PAP A;  1VSN A;  1AU4 A;  1PPD A;  3H89 A;  1CV8 A;  2BDL A;  4YYQ A;  3BCN A;  4N4Z A;  4QRG A;  1EWP A;  2P7U A;  1DF0 A;  1QXP A;  1BGO A;  3V6C A;  1AU3 A;  2P0R A;  2OUL A;  4YVA A;  2AS8 A;  3P5U A;  1X9Y A;  2DC8 A;  5K16 A;  2PRE A;  2H7J A;  3GCB A;  2XU1 A;  3PNR A;  3CBJ A;  2NQA A;  2NQI A;  2PAD A;  3WXF A;  6PAD A;  1AU2 A;  5FPW A;  4X6J A;  1U5I A;  4YV8 A;  2DC9 A;  1ZIV A;  3BPF A;  3PW3 A;  1CQD A;  4OEL A;  4DMX A;  4YYW A;  3RVV A;  5F02 A;  4Q8H A;  1YT7 A;  3P5X A;  1BP4 A;  4WA6 A;  1K3B B;  4OEM A;  2HD5 A;  3IOQ A;  1PPP A;  3CH2 X;  5CVO B;  2ACT A;  2OP3 A;  1F2C A;  3USV A;  1ITO A;  4PAD A;  4K7C A;  1ME4 A;  1FH0 A;  5PAD A;  3OVX A;  4BS6 A;  1HUC B;  4AXL A;  2GFO A;  4YYR A;  1POP A;  4BS5 A;  3K24 A;  1PIP A;  1AIM A;  3N3G A;  2FYE A;  1PE6 A;  1CS8 A;  3I3T A;  2AYN A;  1YK7 A;  5JH3 A;  2FQ9 A;  2GHU A;  3MTN A;  3KKU A;  3D6S A;  5J94 A;  1CB5 A;  2DZZ A;  1QDQ A; 
#chains in the Genus database with same CATH topology
 3M99 A;  4BOP A;  2Z84 A;  3U8E A;  3W31 A;  2G8E A;  2IBI A;  3P5V A;  2P86 A;  2UZJ A;  3O0U A;  3C9E A;  3KSE A;  2R9F A;  1EWO A;  3MHS A;  3ZUA A;  3TNX A;  1MHW A;  3KX1 A;  3ZNH A;  2FE8 A;  2VHF A;  2ARY A;  1PVJ A;  2JTC A;  3NHE A;  4CDF B;  4OW0 A;  4RF1 A;  4FIP A;  1EWL A;  3MHH A;  2CB5 A;  4KLB A;  3F75 A;  1MS6 A;  1TL9 A;  3PDF A;  2AGA A;  5EGW A;  4BPV A;  2OZ2 A;  5CVM A;  1XKG A;  3PSE A;  2DCB A;  1F2B A;  3IHP A;  4A5U A;  2R9M A;  4N79 A;  4BOZ A;  5JA7 A;  3KFQ A;  4YYS A;  3BB7 A;  2F1G A;  3PHU A;  4P6G A;  1NPZ A;  4FJC A;  1O0E A;  4BQV A;  3I06 A;  2F7D A;  1Y4H A;  3IEJ A;  3KWB X;  2CIO A;  1MDW A;  2YJ8 A;  1NL6 A;  1QOL A;  3E1Z B;  4DMY A;  1PAD A;  1NLJ A;  4PP1 A;  3H6S A;  3O65 A;  1AYV A;  1CJL A;  2DOS A;  2C0Y A;  1BQI A;  2YJC A;  1KXR A;  2O6X A;  4G54 A;  3MJ5 A;  4I04 A;  4BOQ A;  4ZTB A;  2BDZ A;  1AYU A;  1MIR A;  3OIS A;  3PHW A;  4D8I A;  1PPN A;  1NQC A;  2JRI A;  2AYO A;  2E03 A;  3H8C A;  2E02 A;  2HXZ A;  4Q8G A;  5KO3 A;  1Y08 A;  4I05 A;  1CPJ A;  3BBA A;  4P16 A;  2AVW A;  3TMP A;  1A6R A;  1CTE A;  3PBH A;  3IMA A;  1DKI A;  3OF9 A;  1U9V A;  2PNS A;  1ZCM A;  2DCC A;  3KWZ A;  3K8U A;  5CHV A;  2Y6E A;  2FUD A;  3PRP A;  4HWY A;  1GMY A;  3IV2 A;  3IUT A;  2JQG R;  2DC7 A;  3WXE A;  3N4C A;  1GLO A;  4X6I A;  4OVZ A;  2AU1 A;  3B79 A;  4HXD B;  3RVW A;  2FTD A;  4PI3 A;  1QMY A;  1AEC A;  1STF E;  1NB3 A;  4R3D A;  2DCA A;  3CH3 X;  1GEC E;  1U9X A;  1BY8 A;  1PPO A;  1PXV A;  2Y5B A;  4P6E A;  4RNA A;  3DF0 A;  3C0R A;  1IWD A;  3PHX A;  2E01 A;  1JQP A;  3H8B A;  5EF4 A;  1F2A A;  2ATO A;  2AUZ A;  3LFY A;  4CDD B;  3HD3 A;  4N8W A;  4BOU A;  2YJB A;  4W5C A;  1EF7 A;  2DJG B;  2B1M A;  2G7Y A;  2BTW B;  3ERV A;  5CVN B;  4ZUX U;  1CSB B;  3PRM A;  4RY2 A;  2XU5 A;  3HWN A;  1MEG A;  1S4V A;  2G6D A;  2YJ9 A;  1U9Q X;  4MSX A;  3LXS A;  2VHS A;  2R9O A;  3BOW A;  4CZW A;  4I07 A;  1THE A;  4X6H A;  1ME3 A;  1EWM A;  2NQD B;  5A24 A;  3E9S A;  3S3R A;  4D8E A;  3KW9 A;  3S3Q A;  1MEM A;  4WUR A;  3K9M A;  4FK5 A;  1PCI A;  2YJ2 A;  2G8J A;  2J7Q C;  8PCH A;  1YZB A;  1YAL A;  4D8B A;  3OF8 A;  1NB5 A;  1Q6K A;  3RVX A;  3MOR A;  3N3K A;  1KHP A;  2R9N A;  7PCK A;  2NQG A;  1PBH A;  2AIM A;  4MZO A;  2XU3 A;  2DZY A;  1KFX L;  1KFU L;  2FT2 A;  2XU4 A;  4RF0 A;  3W30 A;  2FRA A;  3BPM A;  4BSQ A;  3AI8 A;  1KHQ A;  3IFU A;  1CVZ A;  3BWK A;  4XZX A;  3HHA A;  3QT4 A;  5E6J A;  5JZE A;  4AXM A;  4QRX A;  3CBK A;  2FO5 A;  4YYV A;  2DC6 A;  2WBF X;  3F5V A;  2IPP B;  3HHI A;  4QH6 A;  1F29 A;  2AUX A;  4XUI A;  1M6D A;  1TLO A;  1YK8 A;  2JQF R;  1DEU A;  4REZ A;  4YYU A;  3O1G A;  3P5W A;  4CDE B;  1GCB A;  1SNK A;  3QJ3 A;  3BC3 A;  4CDC B;  3V6E A;  1ICF A;  4W4U A;  4IUM A;  2R6N A;  1UKF A;  4MZS A;  4W5B A;  3H7D A;  2DJF B;  2PBH A;  2J7Q A;  5CHT A;  4PP2 E;  2FRQ A;  2R9C A;  1TU6 A;  2HH5 A;  3OVZ A;  1AYW A;  1YVB A;  1ATK A;  4QRV A;  2BTW A;  1SP4 B;  1U9W A;  2DCD A;  3QSD A;  3WXG A;  4XR7 A;  2E00 A;  4QBB A;  4GUA A;  3B21 A;  1AU0 A;  1VJV A;  2HHN A;  2B1N A;  9PAP A;  1VSN A;  1AU4 A;  1PPD A;  3H89 A;  1CV8 A;  2BDL A;  4YYQ A;  3BCN A;  4N4Z A;  4QRG A;  1EWP A;  2P7U A;  3MP2 A;  1DF0 A;  1QXP A;  1BGO A;  3V6C A;  1AU3 A;  2P0R A;  2OUL A;  4YVA A;  2AS8 A;  4RKX A;  3P5U A;  1X9Y A;  2DC8 A;  5K16 A;  2PRE A;  3BY4 A;  3PT2 A;  2H7J A;  3GCB A;  2XU1 A;  3PNR A;  3CBJ A;  4M0W A;  2HWK A;  2NQA A;  2NQI A;  3MTV A;  2PAD A;  3TRK A;  3WXF A;  6PAD A;  1AU2 A;  4IP3 A;  5FPW A;  4X6J A;  1U5I A;  2BU3 A;  2DC9 A;  4YV8 A;  1ZIV A;  5EZQ A;  3BPF A;  3PW3 A;  1CQD A;  4OEL A;  4DMX A;  4YYW A;  3RVV A;  5F02 A;  4BOS A;  4Q8H A;  1YT7 A;  3P5X A;  1BP4 A;  4WA6 A;  4MI7 A;  1K3B B;  4OEM A;  2HD5 A;  3IOQ A;  1PPP A;  3CH2 X;  5CVO B;  2ACT A;  2OP3 A;  1F2C A;  3USV A;  1ITO A;  4PAD A;  4K7C A;  4MM3 B;  1ME4 A;  1FH0 A;  5PAD A;  3OVX A;  4BS6 A;  3RNV A;  1HUC B;  5EZS A;  4AXL A;  2GFO A;  4YYR A;  1POP A;  3OQC A;  4BS5 A;  4PT5 A;  3K24 A;  1PIP A;  1AIM A;  3N3G A;  2FYE A;  1PE6 A;  1CS8 A;  3I3T A;  2AYN A;  1YK7 A;  5JH3 A;  2FQ9 A;  2GHU A;  3MTN A;  3KKU A;  3D6S A;  5J94 A;  4OVZ B;  1CB5 A;  2DZZ A;  1QDQ A; 
#chains in the Genus database with same CATH homology
 3M99 A;  3U8E A;  2G8E A;  2IBI A;  3P5V A;  2P86 A;  3O0U A;  3C9E A;  3KSE A;  2R9F A;  1EWO A;  3MHS A;  3ZUA A;  4NV7 A;  3TNX A;  1MHW A;  3KX1 A;  2VHF A;  2ARY A;  3NHE A;  4CDF B;  4FIP A;  1EWL A;  3MHH A;  2CB5 A;  4KLB A;  3F75 A;  1MS6 A;  1TL9 A;  3PDF A;  5EGW A;  4BPV A;  4BGF A;  2OZ2 A;  5CVM A;  1XKG A;  2DCB A;  1F2B A;  3IHP A;  2R9M A;  4N79 A;  5JA7 A;  3KFQ A;  4YYS A;  1E2T A;  2F1G A;  4P6G A;  1NPZ A;  4FJC A;  1O0E A;  4BQV A;  3I06 A;  2F7D A;  1Y4H A;  3IEJ A;  3KWB X;  2CIO A;  1MDW A;  2YJ8 A;  1NL6 A;  1QOL A;  3E1Z B;  4DMY A;  1PAD A;  1NLJ A;  4PP1 A;  3H6S A;  1AYV A;  4NV8 A;  1CJL A;  2C0Y A;  1BQI A;  2YJC A;  1KXR A;  2O6X A;  4G54 A;  4I04 A;  2BDZ A;  1AYU A;  1MIR A;  3OIS A;  1PPN A;  1NQC A;  2AYO A;  2E03 A;  3H8C A;  2E02 A;  2HXZ A;  4Q8G A;  1Y08 A;  4I05 A;  1CPJ A;  2AVW A;  1A6R A;  1CTE A;  3PBH A;  3IMA A;  3OF9 A;  1U9V A;  2PNS A;  1ZCM A;  2DCC A;  3KWZ A;  3K8U A;  5CHV A;  2VFB A;  2FUD A;  2Y6E A;  4HWY A;  3D9W A;  1GMY A;  3IV2 A;  3IUT A;  2JQG R;  2DC7 A;  3WXE A;  3N4C A;  1GLO A;  4X6I A;  2AU1 A;  3B79 A;  3RVW A;  2FTD A;  4PI3 A;  1QMY A;  1AEC A;  1STF E;  1NB3 A;  2DCA A;  3CH3 X;  1GEC E;  1U9X A;  2VFC A;  1BY8 A;  1PPO A;  1PXV A;  2Y5B A;  4P6E A;  3DF0 A;  4GUZ A;  1IWD A;  2E01 A;  1JQP A;  3H8B A;  5EF4 A;  1F2A A;  2ATO A;  2AUZ A;  3LFY A;  4CDD B;  3HD3 A;  4N8W A;  2YJB A;  4W5C A;  1EF7 A;  2DJG B;  2B1M A;  2G7Y A;  3LTW A;  3ERV A;  5CVN B;  4ZUX U;  1CSB B;  4RY2 A;  2XU5 A;  3HWN A;  1MEG A;  1S4V A;  2G6D A;  2YJ9 A;  1U9Q X;  4MSX A;  3LXS A;  2VHS A;  1W6F A;  2R9O A;  3BOW A;  4CZW A;  4I07 A;  1THE A;  4X6H A;  1ME3 A;  1EWM A;  2NQD B;  5A24 A;  3S3R A;  3KW9 A;  3S3Q A;  1MEM A;  3K9M A;  1GX3 A;  4FK5 A;  1PCI A;  2YJ2 A;  2G8J A;  8PCH A;  1YAL A;  4B55 A;  3OF8 A;  1NB5 A;  1Q6K A;  3RVX A;  3MOR A;  3N3K A;  1KHP A;  2R9N A;  7PCK A;  2NQG A;  1PBH A;  2AIM A;  4MZO A;  2XU3 A;  2DZY A;  1KFX L;  1KFU L;  2FT2 A;  2XU4 A;  2FRA A;  3BPM A;  4BSQ A;  3AI8 A;  1KHQ A;  1CVZ A;  3BWK A;  3HHA A;  3QT4 A;  4AXM A;  4QRX A;  3CBK A;  2FO5 A;  1W4T A;  4YYV A;  2DC6 A;  2WBF X;  3F5V A;  2IPP B;  3HHI A;  4QH6 A;  1F29 A;  2AUX A;  4XUI A;  1M6D A;  1TLO A;  1YK8 A;  2JQF R;  1DEU A;  4YYU A;  3O1G A;  3P5W A;  4CDE B;  1GCB A;  1SNK A;  3QJ3 A;  3BC3 A;  4CDC B;  3V6E A;  1ICF A;  4W4U A;  2R6N A;  4MZS A;  4W5B A;  3H7D A;  2DJF B;  2PBH A;  5CHT A;  4PP2 E;  2FRQ A;  2R9C A;  4C5P A;  1TU6 A;  2HH5 A;  3OVZ A;  1AYW A;  1YVB A;  1ATK A;  4QRV A;  1SP4 B;  1U9W A;  2DCD A;  3QSD A;  3WXG A;  4XR7 A;  2E00 A;  4QBB A;  1AU0 A;  1VJV A;  2HHN A;  2B1N A;  9PAP A;  1VSN A;  1AU4 A;  1PPD A;  3H89 A;  1CV8 A;  2BDL A;  4YYQ A;  3BCN A;  4N4Z A;  4QRG A;  1EWP A;  2P7U A;  1DF0 A;  1QXP A;  1BGO A;  3V6C A;  1AU3 A;  2P0R A;  2OUL A;  4YVA A;  2AS8 A;  3P5U A;  1X9Y A;  2DC8 A;  5K16 A;  2PRE A;  2H7J A;  3GCB A;  2XU1 A;  3PNR A;  3CBJ A;  2NQA A;  2NQI A;  1W5R A;  2PAD A;  3WXF A;  6PAD A;  1AU2 A;  5FPW A;  4X6J A;  1U5I A;  4YV8 A;  2DC9 A;  1ZIV A;  3BPF A;  3PW3 A;  1CQD A;  4OEL A;  4DMX A;  4YYW A;  3RVV A;  5F02 A;  4Q8H A;  1YT7 A;  3P5X A;  1BP4 A;  4WA6 A;  1K3B B;  4OEM A;  2HD5 A;  3IOQ A;  1PPP A;  3CH2 X;  5CVO B;  2ACT A;  2OP3 A;  1F2C A;  3USV A;  1ITO A;  4PAD A;  4K7C A;  1ME4 A;  1FH0 A;  5PAD A;  3OVX A;  4BS6 A;  1HUC B;  4AXL A;  2GFO A;  4YYR A;  1POP A;  4BS5 A;  3K24 A;  1PIP A;  1AIM A;  3N3G A;  2FYE A;  1PE6 A;  1CS8 A;  2BSZ A;  3I3T A;  2AYN A;  1YK7 A;  5JH3 A;  2FQ9 A;  2GHU A;  3MTN A;  3KKU A;  3D6S A;  5J94 A;  1CB5 A;  2DZZ A;  1QDQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...