3TNXA

Structure of the precursor of a thermostable variant of papain at 2.6 angstroem resolution
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
310
structure length
310
Chain Sequence
NDLTSTERLIQLFESWMLKHNKIYKNIDEKIYRFEIFKDNLKYIDETNKKNNSYWLGLNVFADMSNDEFKEKYTGSIAGNYTTTELSYEEVLNDGDVNIPEYVDWRQKGAVTPVKNQGSCGSAWAFSAVSTIESIIKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIRNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a thermostable mutant of pro-papain reveals its activation mechanism
pubmed doi rcsb
molecule keywords Papain
molecule tags Hydrolase
source organism Carica papaya
total genus 106
structure length 310
sequence length 310
chains with identical sequence C
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 2011-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
A PF08246 Inhibitor_I29 Cathepsin propeptide inhibitor domain (I29)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3tnxA00
3MTNA 1STFE 1U9VA 2VHFA 3RVWA 4QH6A 4QRGA 2P0RA 2R6NA 2NQIA 4YYUA 4W5BA 1HUCB 3RVXA 4MZOA 1MDWA 2P7UA 2G7YA 3MHHA 2HHNA 3C9EA 1KXRA 1PIPA 3BPMA 4X6IA 4YYQA 1PPOA 1U9QX 2JQFR 3N3GA 2FYEA 1PPNA 2AIMA 4N8WA 2AYNA 4YYWA 1F2BA 1AU3A 3F5VA 2G8JA 3OVZA 1QMYA 1BQIA 3PDFA 1U5IA 3V6EA 4CDEB 5EGWA 5JH3A 1THEA 4I04A 5CVNB 1AYWA 1CS8A 4FK5A 4PP2E 4PI3A 2O6XA 4Q8GA 4BS6A 2E00A 3CBKA 1MEGA 1CPJA 2CB5A 2B1NA 1VSNA 3PBHA 2YJ8A 1AECA 1A6RA 3RVVA 1QXPA 3MHSA 1F2AA 5J94A 1GLOA 1YVBA 1GECE 4N4ZA 2ACTA 4OEMA 5K16A 1PADA 2AS8A 4PP1A 5JA7A 5FPWA 3USVA 2NQAA 2R9FA 2IBIA 4ZUXU 2E02A 4BSQA 1TU6A 1AU4A 2F7DA 3K8UA 3WXFA 2DC7A 2DCDA 3E1ZB 1ATKA 1KHQA 1S4VA 1U9WA 1JQPA 4OELA 3DF0A 4X6HA 3O1GA 2OP3A 1CV8A 2IPPB 1F29A 1AYUA 1DF0A 2OULA 4K7CA 2CIOA 2Y5BA 3D6SA 3WXGA 3OF8A 1EF7A 2XU3A 3KKUA 4FIPA 2FTDA 4DMXA 3KX1A 1K3BB 1ME4A 2YJ9A 4N79A 3K9MA 3P5WA 2DCAA 2FQ9A 3IMAA 1POPA 3KW9A 2HH5A 3HD3A 1ITOA 4KLBA 4QRVA 3KFQA 4WA6A 4MSXA 4YYRA 1GCBA 2DJFB 3OF9A 4XUIA 3S3QA 3PW3A 1ME3A 5CHTA 1FH0A 3H8BA 4FJCA 3PNRA 2DJGB 1Y4HA 1QDQA 4XR7A 3M99A 3KSEA 3ZUAA 1NB5A 2NQDB 2R9CA 2NQGA 4P6EA 2HXZA 1ZCMA 4W4UA 3CBJA 5PADA 1DEUA 1IWDA 2P86A 4PADA 1NPZA 2AUXA 2AUZA 3KWBX 1YK8A 4BQVA 4AXLA 3QT4A 1AU2A 1AIMA 2DC6A 1AU0A 1TL9A 1KFUL 4W5CA 1O0EA 4YV8A 1PXVA 2AYOA 2DZYA 3N4CA 2PBHA 2XU4A 4QBBA 1BY8A 3CH2X 4Q8HA 2XU5A 3P5UA 2FRAA 3NHEA 4DMYA 3H89A 3F75A 5EF4A 5F02A 1CJLA 1EWPA 1CTEA 3S3RA 2DZZA 2YJ2A 3P5XA 1KFXL 4AXMA 1CQDA 2BDLA 1AYVA 1NL6A 1EWLA 1PE6A 7PCKA 3MORA 2OZ2A 1EWMA 1TLOA 2FUDA 3TNXA 4I07A 1YK7A 1KHPA 1PBHA 4HWYA 4YVAA 5CVMA 4G54A 2YJCA 1MS6A 1VJVA 2R9MA 1PPDA 2FO5A 3GCBA 3CH3X 4CZWA 3N3KA 1ICFA 1NB3A 4CDFB 1XKGA 2B1MA 4YYSA 2PNSA 1PPPA 1SP4B 4X6JA 1X9YA 3IUTA 2E01A 3OVXA 2FT2A 2FRQA 2VHSA 3BCNA 3H6SA 4P6GA 4YYVA 3V6CA 3IHPA 1CSBB 3HHIA 1YALA 1BP4A 3H8CA 3I3TA 3U8EA 3QJ3A 4I05A 3KWZA 3IV2A 1Q6KA 2JQGR 9PAPA 2ARYA 3O0UA 2PADA 3BWKA 3BOWA 6PADA 3LFYA 1MEMA 2GFOA 5CVOB 1F2CA 2R9OA 3WXEA 3IEJA 2GHUA 2WBFX 1PCIA 1QOLA 1SNKA 3HHAA 3H7DA 4CDDB 1MHWA 1EWOA 8PCHA 2G8EA 2R9NA 4BS5A 3P5VA 5CHVA 3I06A 2PREA 3IOQA 3OISA 3AI8A 4QRXA 1M6DA 2DCCA 1MIRA 3ERVA 3QSDA 1CVZA 3BC3A 4BPVA 2HD5A 1YT7A 2Y6EA 2F1GA 1BGOA 3K24A 2E03A 2G6DA 1NLJA 1CB5A 2XU1A 2ATOA 2C0YA 4CDCB 2DCBA 2DC8A 2AVWA 3HWNA 1Y08A 3B79A 2BDZA 3BPFA 2H7JA 1NQCA 3LXSA 1ZIVA 5A24A 4MZSA 1U9XA 2DC9A 2YJBA 1GMYA 4RY2A 2AU1A
chains in the Genus database with same CATH superfamily
3OQCA 2FE8A 3MTNA 4RF1A 1STFE 1U9VA 2BTWA 3MTVA 2VHFA 3RVWA 4QH6A 4QRGA 2P0RA 2R6NA 2NQIA 4YYUA 4W5BA 1HUCB 3RVXA 4MZOA 1MDWA 2P7UA 2G7YA 3MHHA 2HHNA 3C9EA 1KXRA 2JRIA 1PIPA 3BPMA 4X6IA 4YYQA 1PPOA 1U9QX 2JQFR 3N3GA 2FYEA 1PPNA 2AIMA 3W30A 4N8WA 2AYNA 4YYWA 1F2BA 1AU3A 3F5VA 2G8JA 3OVZA 1QMYA 1BQIA 3PDFA 1U5IA 3V6EA 4CDEB 3BBAA 5EGWA 5JH3A 1THEA 4I04A 4MM3B 5CVNB 1AYWA 1CS8A 4FK5A 4PP2E 4PI3A 2O6XA 4Q8GA 2BTWB 4BS6A 2J7QA 2E00A 3CBKA 5JZEA 3C0RA 1MEGA 1CPJA 2CB5A 4RKXA 2B1NA 1VSNA 3PBHA 2YJ8A 3ZNHA 1AECA 1A6RA 3RVVA 4OW0A 1QXPA 3MHSA 1F2AA 5J94A 1GLOA 1YVBA 1GECE 5EZSA 4N4ZA 2ACTA 4OEMA 5K16A 1PADA 2AS8A 4PP1A 5JA7A 5FPWA 3MP2A 3USVA 2NQAA 2R9FA 2Z84A 2IBIA 4ZUXU 2E02A 4BSQA 1TU6A 1AU4A 2F7DA 3K8UA 3WXFA 2DC7A 2DCDA 3E1ZB 3PRMA 1PVJA 3PSEA 1ATKA 1KHQA 1S4VA 1U9WA 1JQPA 4OELA 3DF0A 4X6HA 3O1GA 2OP3A 1CV8A 2IPPB 1F29A 1AYUA 1DF0A 2OULA 4K7CA 3BB7A 2CIOA 2Y5BA 3D6SA 3WXGA 3OF8A 1EF7A 2XU3A 4BOQA 3KKUA 4FIPA 2FTDA 4DMXA 3KX1A 1K3BB 1ME4A 2YJ9A 4N79A 3K9MA 3P5WA 2DCAA 2FQ9A 3MJ5A 3IMAA 1POPA 3KW9A 2HH5A 3TRKA 3HD3A 1ITOA 4WURA 4KLBA 4QRVA 3W31A 3KFQA 4WA6A 4MSXA 4YYRA 1GCBA 2DJFB 3OF9A 4XUIA 3S3QA 3PW3A 1ME3A 5CHTA 1FH0A 5E6JA 3H8BA 4FJCA 3PNRA 2HWKA 4R3DA 2DJGB 4M0WA 1Y4HA 1QDQA 4XR7A 3PHUA 3M99A 3KSEA 3ZUAA 4D8IA 2BU3A 1NB5A 2NQDB 2R9CA 2NQGA 4P6EA 3IFUA 2HXZA 3PRPA 4BOSA 3PHXA 1ZCMA 4MI7A 4W4UA 3CBJA 5PADA 1DEUA 1IWDA 2P86A 4PADA 1NPZA 2AUXA 2AUZA 3KWBX 1YK8A 4BQVA 4OVZA 4AXLA 3QT4A 1AU2A 1AIMA 2DC6A 1AU0A 1TL9A 1KFUL 4W5CA 1O0EA 4YV8A 1PXVA 2AYOA 2DZYA 5EZQA 3N4CA 2PBHA 2XU4A 4QBBA 3BY4A 1BY8A 3CH2X 4Q8HA 4ZTBA 2XU5A 3P5UA 2FRAA 3NHEA 4BOPA 4DMYA 3H89A 3F75A 5EF4A 5F02A 2J7QC 1CJLA 1EWPA 4GUAA 3TMPA 1CTEA 3S3RA 2DZZA 2YJ2A 3P5XA 3O65A 1KFXL 4AXMA 1CQDA 2BDLA 1AYVA 1NL6A 1EWLA 1PE6A 7PCKA 3MORA 2OZ2A 1EWMA 1TLOA 2FUDA 3TNXA 4OVZB 4I07A 1YK7A 1KHPA 1PBHA 4HWYA 4YVAA 5CVMA 4G54A 2YJCA 1MS6A 1VJVA 2R9MA 1PPDA 2FO5A 3GCBA 3CH3X 4CZWA 3N3KA 1ICFA 1NB3A 4CDFB 1XKGA 2B1MA 4YYSA 3B21A 2PNSA 1PPPA 4REZA 1SP4B 4X6JA 1X9YA 3IUTA 4BOUA 2E01A 3OVXA 2FT2A 2FRQA 2VHSA 3BCNA 3H6SA 4P6GA 4YYVA 3PT2A 1DKIA 3V6CA 3IHPA 1CSBB 2JTCA 1UKFA 3HHIA 1YALA 1BP4A 3H8CA 3I3TA 3U8EA 3QJ3A 4I05A 2AGAA 3KWZA 3IV2A 3RNVA 1Q6KA 2JQGR 9PAPA 2ARYA 3O0UA 2PADA 5KO3A 3BWKA 3BOWA 3E9SA 6PADA 3LFYA 1MEMA 2GFOA 5CVOB 1F2CA 2R9OA 2UZJA 3WXEA 3IEJA 4IUMA 2GHUA 2WBFX 1PCIA 1QOLA 1SNKA 3HHAA 3H7DA 4CDDB 4A5UA 1MHWA 1EWOA 3PHWA 8PCHA 2G8EA 2R9NA 4BS5A 3P5VA 1YZBA 5CHVA 3I06A 2PREA 3IOQA 3OISA 3AI8A 4QRXA 1M6DA 2DCCA 1MIRA 3ERVA 4RNAA 4P16A 3QSDA 1CVZA 3BC3A 4BPVA 4D8BA 4D8EA 2HD5A 1YT7A 4HXDB 2Y6EA 2F1GA 1BGOA 3K24A 2E03A 2G6DA 1NLJA 1CB5A 2XU1A 2ATOA 2C0YA 4CDCB 2DCBA 2DC8A 2AVWA 3HWNA 1Y08A 3B79A 4RF0A 2BDZA 3BPFA 2H7JA 1NQCA 3LXSA 4BOZA 1ZIVA 5A24A 4PT5A 2DOSA 4MZSA 1U9XA 2DC9A 2YJBA 1GMYA 4XZXA 4RY2A 4IP3A 2AU1A
chains in the Genus database with same CATH topology
3MTNA 1STFE 1U9VA 2VHFA 3RVWA 4QH6A 4QRGA 2P0RA 2R6NA 2NQIA 4YYUA 4W5BA 1HUCB 3RVXA 4MZOA 1MDWA 2P7UA 2G7YA 4NV8A 3MHHA 2HHNA 3C9EA 4B55A 1KXRA 1PIPA 3BPMA 4X6IA 4YYQA 1PPOA 1U9QX 2JQFR 3N3GA 2FYEA 1PPNA 2AIMA 4N8WA 2AYNA 3LTWA 4YYWA 1F2BA 1AU3A 3F5VA 2G8JA 3OVZA 1QMYA 1BQIA 3PDFA 1U5IA 1W4TA 3V6EA 4CDEB 5EGWA 5JH3A 1THEA 4I04A 5CVNB 1AYWA 1CS8A 4FK5A 4PP2E 4PI3A 2O6XA 4Q8GA 4BS6A 2E00A 3CBKA 1MEGA 1CPJA 2CB5A 2B1NA 1VSNA 3PBHA 2YJ8A 1AECA 1A6RA 3RVVA 1QXPA 3MHSA 1F2AA 5J94A 1GLOA 1YVBA 1GECE 4N4ZA 2ACTA 4OEMA 5K16A 1PADA 2AS8A 4PP1A 5JA7A 5FPWA 3USVA 2NQAA 2R9FA 2IBIA 4ZUXU 2E02A 4BSQA 1TU6A 1AU4A 2F7DA 3K8UA 3WXFA 2DC7A 2DCDA 3E1ZB 1ATKA 1KHQA 1S4VA 1U9WA 1JQPA 4OELA 3DF0A 4X6HA 3O1GA 2OP3A 1CV8A 2IPPB 1F29A 1AYUA 1DF0A 2OULA 4K7CA 4GUZA 4NV7A 2CIOA 2Y5BA 3D6SA 3WXGA 3OF8A 1EF7A 2XU3A 3KKUA 4FIPA 2FTDA 4DMXA 3KX1A 1K3BB 1ME4A 2YJ9A 4N79A 3K9MA 3P5WA 2DCAA 2FQ9A 3IMAA 1POPA 3KW9A 2HH5A 3HD3A 1ITOA 4KLBA 4QRVA 3KFQA 4WA6A 4MSXA 4YYRA 1GCBA 2DJFB 3OF9A 4XUIA 3S3QA 3PW3A 1ME3A 5CHTA 1FH0A 3H8BA 4FJCA 3PNRA 2DJGB 1Y4HA 1QDQA 4XR7A 3M99A 3KSEA 3ZUAA 1NB5A 2NQDB 2R9CA 2NQGA 4P6EA 2HXZA 1ZCMA 4W4UA 3CBJA 5PADA 1DEUA 1IWDA 2P86A 4PADA 1NPZA 2AUXA 2AUZA 3KWBX 1YK8A 4BQVA 3D9WA 4AXLA 3QT4A 1AU2A 1AIMA 2DC6A 1AU0A 1TL9A 1KFUL 4W5CA 1O0EA 4YV8A 1PXVA 2AYOA 2DZYA 3N4CA 2PBHA 2XU4A 4QBBA 1BY8A 3CH2X 4Q8HA 2XU5A 3P5UA 1E2TA 2FRAA 1W5RA 3NHEA 4DMYA 3H89A 3F75A 5EF4A 5F02A 1CJLA 1EWPA 1CTEA 3S3RA 2DZZA 2YJ2A 3P5XA 1KFXL 4AXMA 1CQDA 2BDLA 1AYVA 1NL6A 1EWLA 1PE6A 7PCKA 2VFBA 3MORA 4BGFA 2OZ2A 1EWMA 1TLOA 2FUDA 3TNXA 4I07A 1YK7A 1KHPA 1PBHA 4HWYA 4YVAA 5CVMA 4G54A 2BSZA 2YJCA 1MS6A 1VJVA 2R9MA 1PPDA 2FO5A 3GCBA 3CH3X 4CZWA 3N3KA 1ICFA 1NB3A 4CDFB 1XKGA 2B1MA 4YYSA 2PNSA 1PPPA 1SP4B 4X6JA 1X9YA 3IUTA 2E01A 3OVXA 2FT2A 2FRQA 2VHSA 3BCNA 3H6SA 4P6GA 4YYVA 3V6CA 3IHPA 1CSBB 3HHIA 1YALA 1BP4A 3H8CA 3I3TA 3U8EA 3QJ3A 4I05A 3KWZA 3IV2A 1Q6KA 2JQGR 9PAPA 2ARYA 3O0UA 2PADA 3BWKA 3BOWA 6PADA 3LFYA 1MEMA 2GFOA 5CVOB 1F2CA 2R9OA 3WXEA 3IEJA 2GHUA 2WBFX 1PCIA 1QOLA 1GX3A 1SNKA 3HHAA 3H7DA 4CDDB 1MHWA 1EWOA 4C5PA 8PCHA 2G8EA 2R9NA 4BS5A 3P5VA 5CHVA 3I06A 2PREA 3IOQA 3OISA 3AI8A 4QRXA 1M6DA 2DCCA 1MIRA 1W6FA 3ERVA 3QSDA 1CVZA 3BC3A 4BPVA 2HD5A 1YT7A 2Y6EA 2F1GA 1BGOA 3K24A 2E03A 2G6DA 1NLJA 1CB5A 2XU1A 2ATOA 2C0YA 4CDCB 2DCBA 2DC8A 2AVWA 3HWNA 1Y08A 3B79A 2VFCA 2BDZA 3BPFA 2H7JA 1NQCA 3LXSA 1ZIVA 5A24A 4MZSA 1U9XA 2DC9A 2YJBA 1GMYA 4RY2A 2AU1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MTN A;  1STF E;  1U9V A;  2VHF A;  3RVW A;  4QH6 A;  4QRG A;  2P0R A;  2R6N A;  2NQI A;  4YYU A;  4W5B A;  1HUC B;  3RVX A;  4MZO A;  1MDW A;  2P7U A;  2G7Y A;  3MHH A;  2HHN A;  3C9E A;  1KXR A;  1PIP A;  3BPM A;  4X6I A;  4YYQ A;  1PPO A;  1U9Q X;  2JQF R;  3N3G A;  2FYE A;  1PPN A;  2AIM A;  4N8W A;  2AYN A;  4YYW A;  1F2B A;  1AU3 A;  3F5V A;  2G8J A;  3OVZ A;  1QMY A;  1BQI A;  3PDF A;  1U5I A;  3V6E A;  4CDE B;  5EGW A;  5JH3 A;  1THE A;  4I04 A;  5CVN B;  1AYW A;  1CS8 A;  4FK5 A;  4PP2 E;  4PI3 A;  2O6X A;  4Q8G A;  4BS6 A;  2E00 A;  3CBK A;  1MEG A;  1CPJ A;  2CB5 A;  2B1N A;  1VSN A;  3PBH A;  2YJ8 A;  1AEC A;  1A6R A;  3RVV A;  1QXP A;  3MHS A;  1F2A A;  5J94 A;  1GLO A;  1YVB A;  1GEC E;  4N4Z A;  2ACT A;  4OEM A;  5K16 A;  1PAD A;  2AS8 A;  4PP1 A;  5JA7 A;  5FPW A;  3USV A;  2NQA A;  2R9F A;  2IBI A;  4ZUX U;  2E02 A;  4BSQ A;  1TU6 A;  1AU4 A;  2F7D A;  3K8U A;  3WXF A;  2DC7 A;  2DCD A;  3E1Z B;  1ATK A;  1KHQ A;  1S4V A;  1U9W A;  1JQP A;  4OEL A;  3DF0 A;  4X6H A;  3O1G A;  2OP3 A;  1CV8 A;  2IPP B;  1F29 A;  1AYU A;  1DF0 A;  2OUL A;  4K7C A;  2CIO A;  2Y5B A;  3D6S A;  3WXG A;  3OF8 A;  1EF7 A;  2XU3 A;  3KKU A;  4FIP A;  2FTD A;  4DMX A;  3KX1 A;  1K3B B;  1ME4 A;  2YJ9 A;  4N79 A;  3K9M A;  3P5W A;  2DCA A;  2FQ9 A;  3IMA A;  1POP A;  3KW9 A;  2HH5 A;  3HD3 A;  1ITO A;  4KLB A;  4QRV A;  3KFQ A;  4WA6 A;  4MSX A;  4YYR A;  1GCB A;  2DJF B;  3OF9 A;  4XUI A;  3S3Q A;  3PW3 A;  1ME3 A;  5CHT A;  1FH0 A;  3H8B A;  4FJC A;  3PNR A;  2DJG B;  1Y4H A;  1QDQ A;  4XR7 A;  3M99 A;  3KSE A;  3ZUA A;  1NB5 A;  2NQD B;  2R9C A;  2NQG A;  4P6E A;  2HXZ A;  1ZCM A;  4W4U A;  3CBJ A;  5PAD A;  1DEU A;  1IWD A;  2P86 A;  4PAD A;  1NPZ A;  2AUX A;  2AUZ A;  3KWB X;  1YK8 A;  4BQV A;  4AXL A;  3QT4 A;  1AU2 A;  1AIM A;  2DC6 A;  1AU0 A;  1TL9 A;  1KFU L;  4W5C A;  1O0E A;  4YV8 A;  1PXV A;  2AYO A;  2DZY A;  3N4C A;  2PBH A;  2XU4 A;  4QBB A;  1BY8 A;  3CH2 X;  4Q8H A;  2XU5 A;  3P5U A;  2FRA A;  3NHE A;  4DMY A;  3H89 A;  3F75 A;  5EF4 A;  5F02 A;  1CJL A;  1EWP A;  1CTE A;  3S3R A;  2DZZ A;  2YJ2 A;  3P5X A;  1KFX L;  4AXM A;  1CQD A;  2BDL A;  1AYV A;  1NL6 A;  1EWL A;  1PE6 A;  7PCK A;  3MOR A;  2OZ2 A;  1EWM A;  1TLO A;  2FUD A;  3TNX A;  4I07 A;  1YK7 A;  1KHP A;  1PBH A;  4HWY A;  4YVA A;  5CVM A;  4G54 A;  2YJC A;  1MS6 A;  1VJV A;  2R9M A;  1PPD A;  2FO5 A;  3GCB A;  3CH3 X;  4CZW A;  3N3K A;  1ICF A;  1NB3 A;  4CDF B;  1XKG A;  2B1M A;  4YYS A;  2PNS A;  1PPP A;  1SP4 B;  4X6J A;  1X9Y A;  3IUT A;  2E01 A;  3OVX A;  2FT2 A;  2FRQ A;  2VHS A;  3BCN A;  3H6S A;  4P6G A;  4YYV A;  3V6C A;  3IHP A;  1CSB B;  3HHI A;  1YAL A;  1BP4 A;  3H8C A;  3I3T A;  3U8E A;  3QJ3 A;  4I05 A;  3KWZ A;  3IV2 A;  1Q6K A;  2JQG R;  9PAP A;  2ARY A;  3O0U A;  2PAD A;  3BWK A;  3BOW A;  6PAD A;  3LFY A;  1MEM A;  2GFO A;  5CVO B;  1F2C A;  2R9O A;  3WXE A;  3IEJ A;  2GHU A;  2WBF X;  1PCI A;  1QOL A;  1SNK A;  3HHA A;  3H7D A;  4CDD B;  1MHW A;  1EWO A;  8PCH A;  2G8E A;  2R9N A;  4BS5 A;  3P5V A;  5CHV A;  3I06 A;  2PRE A;  3IOQ A;  3OIS A;  3AI8 A;  4QRX A;  1M6D A;  2DCC A;  1MIR A;  3ERV A;  3QSD A;  1CVZ A;  3BC3 A;  4BPV A;  2HD5 A;  1YT7 A;  2Y6E A;  2F1G A;  1BGO A;  3K24 A;  2E03 A;  2G6D A;  1NLJ A;  1CB5 A;  2XU1 A;  2ATO A;  2C0Y A;  4CDC B;  2DCB A;  2DC8 A;  2AVW A;  3HWN A;  1Y08 A;  3B79 A;  2BDZ A;  3BPF A;  2H7J A;  1NQC A;  3LXS A;  1ZIV A;  5A24 A;  4MZS A;  1U9X A;  2DC9 A;  2YJB A;  1GMY A;  4RY2 A;  2AU1 A; 
#chains in the Genus database with same CATH topology
 3OQC A;  2FE8 A;  3MTN A;  4RF1 A;  1STF E;  1U9V A;  2BTW A;  3MTV A;  2VHF A;  3RVW A;  4QH6 A;  4QRG A;  2P0R A;  2R6N A;  2NQI A;  4YYU A;  4W5B A;  1HUC B;  3RVX A;  4MZO A;  1MDW A;  2P7U A;  2G7Y A;  3MHH A;  2HHN A;  3C9E A;  1KXR A;  2JRI A;  1PIP A;  3BPM A;  4X6I A;  4YYQ A;  1PPO A;  1U9Q X;  2JQF R;  3N3G A;  2FYE A;  1PPN A;  2AIM A;  3W30 A;  4N8W A;  2AYN A;  4YYW A;  1F2B A;  1AU3 A;  3F5V A;  2G8J A;  3OVZ A;  1QMY A;  1BQI A;  3PDF A;  1U5I A;  3V6E A;  4CDE B;  3BBA A;  5EGW A;  5JH3 A;  1THE A;  4I04 A;  4MM3 B;  5CVN B;  1AYW A;  1CS8 A;  4FK5 A;  4PP2 E;  4PI3 A;  2O6X A;  4Q8G A;  2BTW B;  4BS6 A;  2J7Q A;  2E00 A;  3CBK A;  5JZE A;  3C0R A;  1MEG A;  1CPJ A;  2CB5 A;  4RKX A;  2B1N A;  1VSN A;  3PBH A;  2YJ8 A;  3ZNH A;  1AEC A;  1A6R A;  3RVV A;  4OW0 A;  1QXP A;  3MHS A;  1F2A A;  5J94 A;  1GLO A;  1YVB A;  1GEC E;  5EZS A;  4N4Z A;  2ACT A;  4OEM A;  5K16 A;  1PAD A;  2AS8 A;  4PP1 A;  5JA7 A;  5FPW A;  3MP2 A;  3USV A;  2NQA A;  2R9F A;  2Z84 A;  2IBI A;  4ZUX U;  2E02 A;  4BSQ A;  1TU6 A;  1AU4 A;  2F7D A;  3K8U A;  3WXF A;  2DC7 A;  2DCD A;  3E1Z B;  3PRM A;  1PVJ A;  3PSE A;  1ATK A;  1KHQ A;  1S4V A;  1U9W A;  1JQP A;  4OEL A;  3DF0 A;  4X6H A;  3O1G A;  2OP3 A;  1CV8 A;  2IPP B;  1F29 A;  1AYU A;  1DF0 A;  2OUL A;  4K7C A;  3BB7 A;  2CIO A;  2Y5B A;  3D6S A;  3WXG A;  3OF8 A;  1EF7 A;  2XU3 A;  4BOQ A;  3KKU A;  4FIP A;  2FTD A;  4DMX A;  3KX1 A;  1K3B B;  1ME4 A;  2YJ9 A;  4N79 A;  3K9M A;  3P5W A;  2DCA A;  2FQ9 A;  3MJ5 A;  3IMA A;  1POP A;  3KW9 A;  2HH5 A;  3TRK A;  3HD3 A;  1ITO A;  4WUR A;  4KLB A;  4QRV A;  3W31 A;  3KFQ A;  4WA6 A;  4MSX A;  4YYR A;  1GCB A;  2DJF B;  3OF9 A;  4XUI A;  3S3Q A;  3PW3 A;  1ME3 A;  5CHT A;  1FH0 A;  5E6J A;  3H8B A;  4FJC A;  3PNR A;  2HWK A;  4R3D A;  2DJG B;  4M0W A;  1Y4H A;  1QDQ A;  4XR7 A;  3PHU A;  3M99 A;  3KSE A;  3ZUA A;  4D8I A;  2BU3 A;  1NB5 A;  2NQD B;  2R9C A;  2NQG A;  4P6E A;  3IFU A;  2HXZ A;  3PRP A;  4BOS A;  3PHX A;  1ZCM A;  4MI7 A;  4W4U A;  3CBJ A;  5PAD A;  1DEU A;  1IWD A;  2P86 A;  4PAD A;  1NPZ A;  2AUX A;  2AUZ A;  3KWB X;  1YK8 A;  4BQV A;  4OVZ A;  4AXL A;  3QT4 A;  1AU2 A;  1AIM A;  2DC6 A;  1AU0 A;  1TL9 A;  1KFU L;  4W5C A;  1O0E A;  4YV8 A;  1PXV A;  2AYO A;  2DZY A;  5EZQ A;  3N4C A;  2PBH A;  2XU4 A;  4QBB A;  3BY4 A;  1BY8 A;  3CH2 X;  4Q8H A;  4ZTB A;  2XU5 A;  3P5U A;  2FRA A;  3NHE A;  4BOP A;  4DMY A;  3H89 A;  3F75 A;  5EF4 A;  5F02 A;  2J7Q C;  1CJL A;  1EWP A;  4GUA A;  3TMP A;  1CTE A;  3S3R A;  2DZZ A;  2YJ2 A;  3P5X A;  3O65 A;  1KFX L;  4AXM A;  1CQD A;  2BDL A;  1AYV A;  1NL6 A;  1EWL A;  1PE6 A;  7PCK A;  3MOR A;  2OZ2 A;  1EWM A;  1TLO A;  2FUD A;  3TNX A;  4OVZ B;  4I07 A;  1YK7 A;  1KHP A;  1PBH A;  4HWY A;  4YVA A;  5CVM A;  4G54 A;  2YJC A;  1MS6 A;  1VJV A;  2R9M A;  1PPD A;  2FO5 A;  3GCB A;  3CH3 X;  4CZW A;  3N3K A;  1ICF A;  1NB3 A;  4CDF B;  1XKG A;  2B1M A;  4YYS A;  3B21 A;  2PNS A;  1PPP A;  4REZ A;  1SP4 B;  4X6J A;  1X9Y A;  3IUT A;  4BOU A;  2E01 A;  3OVX A;  2FT2 A;  2FRQ A;  2VHS A;  3BCN A;  3H6S A;  4P6G A;  4YYV A;  3PT2 A;  1DKI A;  3V6C A;  3IHP A;  1CSB B;  2JTC A;  1UKF A;  3HHI A;  1YAL A;  1BP4 A;  3H8C A;  3I3T A;  3U8E A;  3QJ3 A;  4I05 A;  2AGA A;  3KWZ A;  3IV2 A;  3RNV A;  1Q6K A;  2JQG R;  9PAP A;  2ARY A;  3O0U A;  2PAD A;  5KO3 A;  3BWK A;  3BOW A;  3E9S A;  6PAD A;  3LFY A;  1MEM A;  2GFO A;  5CVO B;  1F2C A;  2R9O A;  2UZJ A;  3WXE A;  3IEJ A;  4IUM A;  2GHU A;  2WBF X;  1PCI A;  1QOL A;  1SNK A;  3HHA A;  3H7D A;  4CDD B;  4A5U A;  1MHW A;  1EWO A;  3PHW A;  8PCH A;  2G8E A;  2R9N A;  4BS5 A;  3P5V A;  1YZB A;  5CHV A;  3I06 A;  2PRE A;  3IOQ A;  3OIS A;  3AI8 A;  4QRX A;  1M6D A;  2DCC A;  1MIR A;  3ERV A;  4RNA A;  4P16 A;  3QSD A;  1CVZ A;  3BC3 A;  4BPV A;  4D8B A;  4D8E A;  2HD5 A;  1YT7 A;  4HXD B;  2Y6E A;  2F1G A;  1BGO A;  3K24 A;  2E03 A;  2G6D A;  1NLJ A;  1CB5 A;  2XU1 A;  2ATO A;  2C0Y A;  4CDC B;  2DCB A;  2DC8 A;  2AVW A;  3HWN A;  1Y08 A;  3B79 A;  4RF0 A;  2BDZ A;  3BPF A;  2H7J A;  1NQC A;  3LXS A;  4BOZ A;  1ZIV A;  5A24 A;  4PT5 A;  2DOS A;  4MZS A;  1U9X A;  2DC9 A;  2YJB A;  1GMY A;  4XZX A;  4RY2 A;  4IP3 A;  2AU1 A; 
#chains in the Genus database with same CATH homology
 3MTN A;  1STF E;  1U9V A;  2VHF A;  3RVW A;  4QH6 A;  4QRG A;  2P0R A;  2R6N A;  2NQI A;  4YYU A;  4W5B A;  1HUC B;  3RVX A;  4MZO A;  1MDW A;  2P7U A;  2G7Y A;  4NV8 A;  3MHH A;  2HHN A;  3C9E A;  4B55 A;  1KXR A;  1PIP A;  3BPM A;  4X6I A;  4YYQ A;  1PPO A;  1U9Q X;  2JQF R;  3N3G A;  2FYE A;  1PPN A;  2AIM A;  4N8W A;  2AYN A;  3LTW A;  4YYW A;  1F2B A;  1AU3 A;  3F5V A;  2G8J A;  3OVZ A;  1QMY A;  1BQI A;  3PDF A;  1U5I A;  1W4T A;  3V6E A;  4CDE B;  5EGW A;  5JH3 A;  1THE A;  4I04 A;  5CVN B;  1AYW A;  1CS8 A;  4FK5 A;  4PP2 E;  4PI3 A;  2O6X A;  4Q8G A;  4BS6 A;  2E00 A;  3CBK A;  1MEG A;  1CPJ A;  2CB5 A;  2B1N A;  1VSN A;  3PBH A;  2YJ8 A;  1AEC A;  1A6R A;  3RVV A;  1QXP A;  3MHS A;  1F2A A;  5J94 A;  1GLO A;  1YVB A;  1GEC E;  4N4Z A;  2ACT A;  4OEM A;  5K16 A;  1PAD A;  2AS8 A;  4PP1 A;  5JA7 A;  5FPW A;  3USV A;  2NQA A;  2R9F A;  2IBI A;  4ZUX U;  2E02 A;  4BSQ A;  1TU6 A;  1AU4 A;  2F7D A;  3K8U A;  3WXF A;  2DC7 A;  2DCD A;  3E1Z B;  1ATK A;  1KHQ A;  1S4V A;  1U9W A;  1JQP A;  4OEL A;  3DF0 A;  4X6H A;  3O1G A;  2OP3 A;  1CV8 A;  2IPP B;  1F29 A;  1AYU A;  1DF0 A;  2OUL A;  4K7C A;  4GUZ A;  4NV7 A;  2CIO A;  2Y5B A;  3D6S A;  3WXG A;  3OF8 A;  1EF7 A;  2XU3 A;  3KKU A;  4FIP A;  2FTD A;  4DMX A;  3KX1 A;  1K3B B;  1ME4 A;  2YJ9 A;  4N79 A;  3K9M A;  3P5W A;  2DCA A;  2FQ9 A;  3IMA A;  1POP A;  3KW9 A;  2HH5 A;  3HD3 A;  1ITO A;  4KLB A;  4QRV A;  3KFQ A;  4WA6 A;  4MSX A;  4YYR A;  1GCB A;  2DJF B;  3OF9 A;  4XUI A;  3S3Q A;  3PW3 A;  1ME3 A;  5CHT A;  1FH0 A;  3H8B A;  4FJC A;  3PNR A;  2DJG B;  1Y4H A;  1QDQ A;  4XR7 A;  3M99 A;  3KSE A;  3ZUA A;  1NB5 A;  2NQD B;  2R9C A;  2NQG A;  4P6E A;  2HXZ A;  1ZCM A;  4W4U A;  3CBJ A;  5PAD A;  1DEU A;  1IWD A;  2P86 A;  4PAD A;  1NPZ A;  2AUX A;  2AUZ A;  3KWB X;  1YK8 A;  4BQV A;  3D9W A;  4AXL A;  3QT4 A;  1AU2 A;  1AIM A;  2DC6 A;  1AU0 A;  1TL9 A;  1KFU L;  4W5C A;  1O0E A;  4YV8 A;  1PXV A;  2AYO A;  2DZY A;  3N4C A;  2PBH A;  2XU4 A;  4QBB A;  1BY8 A;  3CH2 X;  4Q8H A;  2XU5 A;  3P5U A;  1E2T A;  2FRA A;  1W5R A;  3NHE A;  4DMY A;  3H89 A;  3F75 A;  5EF4 A;  5F02 A;  1CJL A;  1EWP A;  1CTE A;  3S3R A;  2DZZ A;  2YJ2 A;  3P5X A;  1KFX L;  4AXM A;  1CQD A;  2BDL A;  1AYV A;  1NL6 A;  1EWL A;  1PE6 A;  7PCK A;  2VFB A;  3MOR A;  4BGF A;  2OZ2 A;  1EWM A;  1TLO A;  2FUD A;  3TNX A;  4I07 A;  1YK7 A;  1KHP A;  1PBH A;  4HWY A;  4YVA A;  5CVM A;  4G54 A;  2BSZ A;  2YJC A;  1MS6 A;  1VJV A;  2R9M A;  1PPD A;  2FO5 A;  3GCB A;  3CH3 X;  4CZW A;  3N3K A;  1ICF A;  1NB3 A;  4CDF B;  1XKG A;  2B1M A;  4YYS A;  2PNS A;  1PPP A;  1SP4 B;  4X6J A;  1X9Y A;  3IUT A;  2E01 A;  3OVX A;  2FT2 A;  2FRQ A;  2VHS A;  3BCN A;  3H6S A;  4P6G A;  4YYV A;  3V6C A;  3IHP A;  1CSB B;  3HHI A;  1YAL A;  1BP4 A;  3H8C A;  3I3T A;  3U8E A;  3QJ3 A;  4I05 A;  3KWZ A;  3IV2 A;  1Q6K A;  2JQG R;  9PAP A;  2ARY A;  3O0U A;  2PAD A;  3BWK A;  3BOW A;  6PAD A;  3LFY A;  1MEM A;  2GFO A;  5CVO B;  1F2C A;  2R9O A;  3WXE A;  3IEJ A;  2GHU A;  2WBF X;  1PCI A;  1QOL A;  1GX3 A;  1SNK A;  3HHA A;  3H7D A;  4CDD B;  1MHW A;  1EWO A;  4C5P A;  8PCH A;  2G8E A;  2R9N A;  4BS5 A;  3P5V A;  5CHV A;  3I06 A;  2PRE A;  3IOQ A;  3OIS A;  3AI8 A;  4QRX A;  1M6D A;  2DCC A;  1MIR A;  1W6F A;  3ERV A;  3QSD A;  1CVZ A;  3BC3 A;  4BPV A;  2HD5 A;  1YT7 A;  2Y6E A;  2F1G A;  1BGO A;  3K24 A;  2E03 A;  2G6D A;  1NLJ A;  1CB5 A;  2XU1 A;  2ATO A;  2C0Y A;  4CDC B;  2DCB A;  2DC8 A;  2AVW A;  3HWN A;  1Y08 A;  3B79 A;  2VFC A;  2BDZ A;  3BPF A;  2H7J A;  1NQC A;  3LXS A;  1ZIV A;  5A24 A;  4MZS A;  1U9X A;  2DC9 A;  2YJB A;  1GMY A;  4RY2 A;  2AU1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...