1EWPA

Cruzain bound to mor-leu-hpq
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
215
structure length
215
Chain Sequence
APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQLDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CRUZAIN
publication title Chapter 3: X-ray Structures of Complexes of Cruzain with Designed Covalent Inhibitors
pubmed rcsb
source organism Trypanosoma cruzi
molecule tags Hydrolase/hydrolase inhibitor
total genus 67
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.51: Cruzipain.
pdb deposition date 2000-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1ewpA00
1QMYA 4X6HA 2BDZA 2B1NA 2DZZA 1NLJA 4AXMA 2DCBA 3OISA 1QXPA 1EWOA 2F7DA 4MZOA 4DMXA 3QT4A 3NHEA 1VJVA 1YVBA 4BS5A 1AYUA 1NPZA 4DMYA 1K3BB 2DC6A 3RVWA 2DC8A 3OVZA 2FO5A 2OZ2A 3F5VA 4BQVA 4MZSA 1KXRA 3E1ZB 4YYUA 4OELA 5PADA 4N8WA 3S3QA 9PAPA 2IPPB 1THEA 2HXZA 2NQIA 4MSXA 3QJ3A 2R9CA 1U9WA 3S3RA 3PNRA 1YALA 3KX1A 4FJCA 3HHAA 3LXSA 2FTDA 2IBIA 2R9FA 5CHVA 2VHFA 1POPA 1MEGA 3P5VA 3BWKA 3I06A 1QOLA 2P86A 3P5XA 1ZCMA 2B1MA 5JH3A 2E02A 2FUDA 1CSBB 4QRXA 1EWMA 1GECE 1F2CA 1NB3A 2WBFX 1Q6KA 3PBHA 1BP4A 2DZYA 1TLOA 2OP3A 2XU3A 2AU1A 2FQ9A 4BS6A 3O1GA 3M99A 4CDEB 2FYEA 1PPDA 4QH6A 3MTNA 1AU2A 1CB5A 2P0RA 1NB5A 4CDFB 2DJGB 3HHIA 3WXEA 2VHSA 3USVA 3H89A 5J94A 1DF0A 4XUIA 3O0UA 1PPPA 3BC3A 2E01A 1PBHA 3QSDA 3D6SA 4BSQA 3U8EA 3ZUAA 1TL9A 3C9EA 2JQFR 3F75A 3BOWA 3KSEA 2HH5A 1PIPA 1QDQA 1CQDA 3ERVA 3DF0A 2NQDB 5FPWA 2JQGR 3CBJA 4PP2E 5EGWA 2DCDA 2AUXA 1Y08A 1U9XA 2DJFB 1M6DA 6PADA 1SNKA 3BPMA 2R9MA 3N4CA 4BPVA 2NQGA 3PDFA 3MHHA 3N3KA 1EF7A 1HUCB 2FRQA 4YV8A 4YVAA 2PREA 4I05A 3H6SA 2R9OA 3OF8A 2Y5BA 1U9QX 1F29A 3KWBX 4P6GA 3KFQA 3IV2A 1PADA 1U5IA 2GFOA 1FH0A 1PXVA 1DEUA 2FT2A 1KFUL 4CDDB 3IEJA 1AIMA 1NQCA 3CBKA 2DCCA 3RVXA 3MORA 1S4VA 1IWDA 3KWZA 3IOQA 4RY2A 3B79A 2ARYA 4PI3A 3LFYA 1MHWA 1NL6A 4N79A 1AYVA 3WXGA 4YYQA 1CVZA 3TNXA 1CTEA 2DCAA 4YYRA 2FRAA 4X6JA 1CPJA 1TU6A 1AU3A 2BDLA 4ZUXU 1AU0A 2P7UA 4FK5A 2F1GA 1MEMA 4X6IA 4N4ZA 1ME3A 2YJ8A 4QRVA 2PBHA 1GCBA 3IMAA 2YJ9A 3V6CA 3BCNA 2PNSA 1U9VA 5EF4A 1JQPA 4I04A 1O0EA 3CH3X 3MHSA 4YYWA 1PPNA 3K8UA 1CJLA 2PADA 2XU4A 2HD5A 2Y6EA 1YK8A 5CVNB 3PW3A 4WA6A 1EWPA 2CB5A 2G8EA 4G54A 3KW9A 1STFE 3P5WA 1PCIA 4QRGA 5F02A 3GCBA 4I07A 1XKGA 2AYOA 3HD3A 1MS6A 3H8BA 4PP1A 1CS8A 3H8CA 1F2BA 1A6RA 2ACTA 2OULA 1AYWA 3K9MA 1VSNA 1ITOA 1SP4B 3OF9A 3IUTA 1AU4A 4FIPA 3KKUA 2XU5A 4Q8GA 3AI8A 1ZIVA 4YYVA 5A24A 2E00A 2O6XA 2C0YA 1GLOA 2DC7A 2NQAA 3H7DA 1PE6A 2HHNA 4XR7A 2G6DA 2YJ2A 1KHPA 1KFXL 1MDWA 1ICFA 5CVMA 5JA7A 2E03A 3RVVA 2R6NA 1YK7A 2YJCA 4QBBA 1Y4HA 4Q8HA 2AIMA 2G7YA 2CIOA 1GMYA 4KLBA 3WXFA 4AXLA 2ATOA 2AUZA 5CVOB 4YYSA 5CHTA 3OVXA 3N3GA 1YT7A 7PCKA 3CH2X 1F2AA 2G8JA 2H7JA 1X9YA 1CV8A 4W4UA 2YJBA 2AS8A 2DC9A 8PCHA 1BGOA 4W5CA 1BY8A 1PPOA 3BPFA 1ME4A 3IHPA 4W5BA 4HWYA 3P5UA 3K24A 2GHUA 4K7CA 1MIRA 1ATKA 5K16A 3V6EA 4P6EA 2XU1A 4CZWA 1BQIA 1EWLA 3HWNA 2AYNA 4OEMA 4PADA 3I3TA 2R9NA 2AVWA 1AECA 1KHQA 4CDCB
chains in the Genus database with same CATH superfamily
1QMYA 4X6HA 2BDZA 3PT2A 4HXDB 2B1NA 2DZZA 1NLJA 4REZA 4AXMA 2DCBA 2AGAA 3OISA 1QXPA 1EWOA 2F7DA 4MZOA 4DMXA 3QT4A 3NHEA 1VJVA 1YVBA 4BS5A 1AYUA 1NPZA 4DMYA 1DKIA 1K3BB 2DC6A 2BTWB 2JRIA 3RVWA 2DC8A 3OVZA 2FO5A 2OZ2A 3F5VA 4BQVA 4MZSA 4WURA 1KXRA 3E1ZB 4YYUA 4OELA 5PADA 4N8WA 3S3QA 9PAPA 2IPPB 1THEA 2HXZA 2NQIA 4MSXA 3QJ3A 2R9CA 1U9WA 3S3RA 3PNRA 1YALA 2UZJA 3MP2A 3KX1A 4FJCA 3HHAA 3LXSA 2FTDA 3C0RA 2IBIA 2R9FA 4RF1A 5CHVA 2VHFA 1POPA 1MEGA 3P5VA 3BWKA 3I06A 1QOLA 2P86A 3P5XA 1ZCMA 2B1MA 2DOSA 5JH3A 2E02A 2FUDA 1CSBB 3BB7A 4QRXA 1EWMA 2J7QC 1GECE 1F2CA 1NB3A 2WBFX 1Q6KA 3PBHA 1BP4A 2DZYA 1TLOA 2OP3A 2XU3A 2AU1A 3PHWA 2FQ9A 3PHXA 4BS6A 3O1GA 3M99A 4CDEB 4OW0A 2FYEA 1PPDA 4QH6A 3MTNA 1AU2A 1CB5A 2P0RA 1NB5A 4CDFB 2DJGB 3HHIA 3WXEA 2VHSA 3USVA 3H89A 4IP3A 5J94A 1DF0A 4XUIA 4MI7A 3O0UA 4BOSA 1PPPA 3BC3A 2E01A 1PBHA 3QSDA 3D6SA 4BSQA 3U8EA 3ZUAA 2HWKA 1TL9A 3C9EA 3PRMA 4XZXA 2JQFR 3F75A 3BOWA 3KSEA 2HH5A 1PIPA 1QDQA 1CQDA 3ERVA 3DF0A 2NQDB 2BU3A 5FPWA 2JQGR 3CBJA 4PP2E 5EGWA 2DCDA 2AUXA 1Y08A 1U9XA 4IUMA 4RF0A 2DJFB 1M6DA 6PADA 1SNKA 3BPMA 2R9MA 3N4CA 4BPVA 2NQGA 3E9SA 3PDFA 3MHHA 3N3KA 1EF7A 1HUCB 2FRQA 4YV8A 4YVAA 2PREA 4I05A 3H6SA 4OVZA 2R9OA 3OF8A 2Y5BA 1U9QX 1F29A 3KWBX 4P6GA 3MTVA 5JZEA 3KFQA 3IV2A 1PADA 1U5IA 2GFOA 4R3DA 1FH0A 1PXVA 1DEUA 1YZBA 2FT2A 1KFUL 4CDDB 3IEJA 1AIMA 1NQCA 3CBKA 2DCCA 3RVXA 3MORA 1S4VA 1IWDA 3KWZA 3IOQA 4BOPA 5KO3A 4RY2A 3B79A 2J7QA 2ARYA 4PI3A 3PRPA 3PHUA 3LFYA 1MHWA 1NL6A 4N79A 3W30A 1AYVA 3WXGA 3W31A 4YYQA 1CVZA 3TNXA 1CTEA 2DCAA 4YYRA 2FRAA 4X6JA 1CPJA 1TU6A 1AU3A 2BDLA 4D8BA 4ZUXU 1AU0A 2P7UA 4FK5A 2F1GA 1MEMA 4X6IA 4N4ZA 3ZNHA 1ME3A 2YJ8A 4QRVA 2PBHA 1GCBA 3IMAA 2YJ9A 3V6CA 3BCNA 2PNSA 1U9VA 5EF4A 1JQPA 4I04A 1O0EA 3CH3X 4ZTBA 3MHSA 4D8IA 4YYWA 1PPNA 3K8UA 1CJLA 2PADA 2XU4A 2HD5A 2Y6EA 1YK8A 5CVNB 4BOQA 3PW3A 4WA6A 1EWPA 2CB5A 2G8EA 4G54A 3KW9A 2BTWA 1STFE 3P5WA 1PCIA 3MJ5A 5E6JA 4QRGA 4MM3B 5F02A 3GCBA 4I07A 1XKGA 2AYOA 3HD3A 1MS6A 3PSEA 3H8BA 4PP1A 1CS8A 3TRKA 3H8CA 1F2BA 1A6RA 2ACTA 2OULA 1AYWA 5EZQA 3K9MA 1VSNA 1ITOA 4PT5A 1SP4B 4P16A 3OF9A 3IUTA 1AU4A 4FIPA 4OVZB 3KKUA 3IFUA 3TMPA 2XU5A 4Q8GA 3AI8A 1ZIVA 4YYVA 5A24A 3RNVA 2JTCA 4GUAA 2E00A 2O6XA 2C0YA 1GLOA 2DC7A 3OQCA 2NQAA 3H7DA 1PVJA 1PE6A 2HHNA 4XR7A 2G6DA 4RNAA 2YJ2A 1KHPA 1KFXL 1MDWA 5EZSA 1ICFA 3O65A 5CVMA 5JA7A 2E03A 3RVVA 2R6NA 4D8EA 1YK7A 3BBAA 4BOZA 2YJCA 3B21A 2Z84A 1UKFA 4QBBA 1Y4HA 4Q8HA 2AIMA 2G7YA 2CIOA 1GMYA 4KLBA 3WXFA 4AXLA 2ATOA 2AUZA 5CVOB 4YYSA 5CHTA 3OVXA 3N3GA 1YT7A 7PCKA 3CH2X 4RKXA 1F2AA 3BY4A 2G8JA 2H7JA 1X9YA 1CV8A 4W4UA 2YJBA 2AS8A 2DC9A 8PCHA 1BGOA 4W5CA 1BY8A 1PPOA 3BPFA 1ME4A 3IHPA 4W5BA 4HWYA 3P5UA 4BOUA 3K24A 2GHUA 4K7CA 1MIRA 1ATKA 5K16A 3V6EA 4P6EA 2XU1A 4CZWA 1BQIA 1EWLA 3HWNA 4A5UA 2AYNA 4OEMA 4PADA 2FE8A 3I3TA 2R9NA 2AVWA 4M0WA 1AECA 1KHQA 4CDCB
chains in the Genus database with same CATH topology
1QMYA 4X6HA 2BDZA 2B1NA 2DZZA 1NLJA 4AXMA 2DCBA 3OISA 1QXPA 1EWOA 2F7DA 4MZOA 4DMXA 3QT4A 3NHEA 1VJVA 1W5RA 1YVBA 4BS5A 1AYUA 1NPZA 4DMYA 1K3BB 2DC6A 3RVWA 2DC8A 3OVZA 2FO5A 2OZ2A 3F5VA 4BQVA 4MZSA 1KXRA 3E1ZB 4YYUA 4OELA 5PADA 4N8WA 3S3QA 9PAPA 2IPPB 1THEA 2HXZA 2NQIA 4MSXA 3QJ3A 2R9CA 1U9WA 3S3RA 3PNRA 1YALA 1E2TA 3KX1A 4FJCA 3HHAA 3LXSA 2FTDA 2IBIA 2R9FA 5CHVA 2VHFA 1POPA 1MEGA 3P5VA 3BWKA 3I06A 1QOLA 2P86A 3P5XA 1ZCMA 2B1MA 5JH3A 2E02A 2FUDA 1CSBB 4QRXA 1EWMA 1GECE 1F2CA 1NB3A 2WBFX 1Q6KA 3PBHA 1BP4A 2DZYA 1TLOA 2OP3A 2XU3A 4NV7A 2AU1A 2FQ9A 4BS6A 3O1GA 3M99A 4CDEB 2FYEA 1PPDA 4QH6A 2BSZA 3MTNA 1AU2A 1CB5A 2P0RA 1NB5A 4CDFB 1GX3A 2DJGB 3HHIA 3WXEA 2VHSA 3USVA 3H89A 5J94A 1DF0A 4XUIA 3O0UA 1PPPA 3BC3A 2E01A 1PBHA 3QSDA 3D6SA 4BSQA 3U8EA 3ZUAA 1TL9A 3C9EA 2VFBA 2JQFR 3F75A 3BOWA 3KSEA 3LTWA 2HH5A 1PIPA 1QDQA 1CQDA 3ERVA 3DF0A 1W4TA 2NQDB 5FPWA 2JQGR 3CBJA 4PP2E 5EGWA 2DCDA 2AUXA 1Y08A 1U9XA 3D9WA 2DJFB 1M6DA 6PADA 1SNKA 3BPMA 2R9MA 3N4CA 4BPVA 2NQGA 3PDFA 3MHHA 3N3KA 1EF7A 1HUCB 2FRQA 4YV8A 4YVAA 2PREA 4I05A 3H6SA 2R9OA 3OF8A 2Y5BA 1U9QX 1F29A 2VFCA 3KWBX 4P6GA 3KFQA 3IV2A 1PADA 1U5IA 2GFOA 1FH0A 1PXVA 1DEUA 2FT2A 1KFUL 4CDDB 3IEJA 1AIMA 1NQCA 3CBKA 2DCCA 3RVXA 3MORA 1S4VA 1IWDA 3KWZA 3IOQA 4BGFA 4RY2A 3B79A 2ARYA 4PI3A 3LFYA 1MHWA 1NL6A 4N79A 1AYVA 3WXGA 4YYQA 1CVZA 3TNXA 1CTEA 4B55A 2DCAA 4YYRA 2FRAA 4X6JA 1CPJA 1TU6A 1AU3A 2BDLA 4ZUXU 1AU0A 2P7UA 4FK5A 2F1GA 1MEMA 4X6IA 4N4ZA 1ME3A 2YJ8A 4QRVA 2PBHA 1GCBA 3IMAA 2YJ9A 1W6FA 3V6CA 3BCNA 2PNSA 1U9VA 5EF4A 1JQPA 4I04A 1O0EA 3CH3X 3MHSA 4YYWA 1PPNA 3K8UA 1CJLA 2PADA 2XU4A 2HD5A 2Y6EA 1YK8A 5CVNB 3PW3A 4WA6A 1EWPA 2CB5A 2G8EA 4G54A 3KW9A 4GUZA 1STFE 3P5WA 1PCIA 4QRGA 5F02A 3GCBA 4I07A 1XKGA 2AYOA 3HD3A 4C5PA 1MS6A 3H8BA 4PP1A 1CS8A 3H8CA 1F2BA 1A6RA 2ACTA 2OULA 1AYWA 3K9MA 1VSNA 1ITOA 1SP4B 3OF9A 3IUTA 1AU4A 4FIPA 3KKUA 2XU5A 4Q8GA 3AI8A 1ZIVA 4YYVA 5A24A 2E00A 2O6XA 2C0YA 1GLOA 2DC7A 2NQAA 3H7DA 1PE6A 2HHNA 4XR7A 2G6DA 2YJ2A 1KHPA 1KFXL 1MDWA 1ICFA 5CVMA 5JA7A 2E03A 3RVVA 2R6NA 1YK7A 2YJCA 4QBBA 1Y4HA 4Q8HA 2AIMA 2G7YA 2CIOA 1GMYA 4KLBA 3WXFA 4AXLA 2ATOA 2AUZA 5CVOB 4YYSA 5CHTA 3OVXA 3N3GA 1YT7A 7PCKA 3CH2X 1F2AA 2G8JA 2H7JA 1X9YA 1CV8A 4W4UA 2YJBA 2AS8A 2DC9A 8PCHA 1BGOA 4W5CA 4NV8A 1BY8A 1PPOA 3BPFA 1ME4A 3IHPA 4W5BA 4HWYA 3P5UA 3K24A 2GHUA 4K7CA 1MIRA 1ATKA 5K16A 3V6EA 4P6EA 2XU1A 4CZWA 1BQIA 1EWLA 3HWNA 2AYNA 4OEMA 4PADA 3I3TA 2R9NA 2AVWA 1AECA 1KHQA 4CDCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QMY A;  4X6H A;  2BDZ A;  2B1N A;  2DZZ A;  1NLJ A;  4AXM A;  2DCB A;  3OIS A;  1QXP A;  1EWO A;  2F7D A;  4MZO A;  4DMX A;  3QT4 A;  3NHE A;  1VJV A;  1YVB A;  4BS5 A;  1AYU A;  1NPZ A;  4DMY A;  1K3B B;  2DC6 A;  3RVW A;  2DC8 A;  3OVZ A;  2FO5 A;  2OZ2 A;  3F5V A;  4BQV A;  4MZS A;  1KXR A;  3E1Z B;  4YYU A;  4OEL A;  5PAD A;  4N8W A;  3S3Q A;  9PAP A;  2IPP B;  1THE A;  2HXZ A;  2NQI A;  4MSX A;  3QJ3 A;  2R9C A;  1U9W A;  3S3R A;  3PNR A;  1YAL A;  3KX1 A;  4FJC A;  3HHA A;  3LXS A;  2FTD A;  2IBI A;  2R9F A;  5CHV A;  2VHF A;  1POP A;  1MEG A;  3P5V A;  3BWK A;  3I06 A;  1QOL A;  2P86 A;  3P5X A;  1ZCM A;  2B1M A;  5JH3 A;  2E02 A;  2FUD A;  1CSB B;  4QRX A;  1EWM A;  1GEC E;  1F2C A;  1NB3 A;  2WBF X;  1Q6K A;  3PBH A;  1BP4 A;  2DZY A;  1TLO A;  2OP3 A;  2XU3 A;  2AU1 A;  2FQ9 A;  4BS6 A;  3O1G A;  3M99 A;  4CDE B;  2FYE A;  1PPD A;  4QH6 A;  3MTN A;  1AU2 A;  1CB5 A;  2P0R A;  1NB5 A;  4CDF B;  2DJG B;  3HHI A;  3WXE A;  2VHS A;  3USV A;  3H89 A;  5J94 A;  1DF0 A;  4XUI A;  3O0U A;  1PPP A;  3BC3 A;  2E01 A;  1PBH A;  3QSD A;  3D6S A;  4BSQ A;  3U8E A;  3ZUA A;  1TL9 A;  3C9E A;  2JQF R;  3F75 A;  3BOW A;  3KSE A;  2HH5 A;  1PIP A;  1QDQ A;  1CQD A;  3ERV A;  3DF0 A;  2NQD B;  5FPW A;  2JQG R;  3CBJ A;  4PP2 E;  5EGW A;  2DCD A;  2AUX A;  1Y08 A;  1U9X A;  2DJF B;  1M6D A;  6PAD A;  1SNK A;  3BPM A;  2R9M A;  3N4C A;  4BPV A;  2NQG A;  3PDF A;  3MHH A;  3N3K A;  1EF7 A;  1HUC B;  2FRQ A;  4YV8 A;  4YVA A;  2PRE A;  4I05 A;  3H6S A;  2R9O A;  3OF8 A;  2Y5B A;  1U9Q X;  1F29 A;  3KWB X;  4P6G A;  3KFQ A;  3IV2 A;  1PAD A;  1U5I A;  2GFO A;  1FH0 A;  1PXV A;  1DEU A;  2FT2 A;  1KFU L;  4CDD B;  3IEJ A;  1AIM A;  1NQC A;  3CBK A;  2DCC A;  3RVX A;  3MOR A;  1S4V A;  1IWD A;  3KWZ A;  3IOQ A;  4RY2 A;  3B79 A;  2ARY A;  4PI3 A;  3LFY A;  1MHW A;  1NL6 A;  4N79 A;  1AYV A;  3WXG A;  4YYQ A;  1CVZ A;  3TNX A;  1CTE A;  2DCA A;  4YYR A;  2FRA A;  4X6J A;  1CPJ A;  1TU6 A;  1AU3 A;  2BDL A;  4ZUX U;  1AU0 A;  2P7U A;  4FK5 A;  2F1G A;  1MEM A;  4X6I A;  4N4Z A;  1ME3 A;  2YJ8 A;  4QRV A;  2PBH A;  1GCB A;  3IMA A;  2YJ9 A;  3V6C A;  3BCN A;  2PNS A;  1U9V A;  5EF4 A;  1JQP A;  4I04 A;  1O0E A;  3CH3 X;  3MHS A;  4YYW A;  1PPN A;  3K8U A;  1CJL A;  2PAD A;  2XU4 A;  2HD5 A;  2Y6E A;  1YK8 A;  5CVN B;  3PW3 A;  4WA6 A;  1EWP A;  2CB5 A;  2G8E A;  4G54 A;  3KW9 A;  1STF E;  3P5W A;  1PCI A;  4QRG A;  5F02 A;  3GCB A;  4I07 A;  1XKG A;  2AYO A;  3HD3 A;  1MS6 A;  3H8B A;  4PP1 A;  1CS8 A;  3H8C A;  1F2B A;  1A6R A;  2ACT A;  2OUL A;  1AYW A;  3K9M A;  1VSN A;  1ITO A;  1SP4 B;  3OF9 A;  3IUT A;  1AU4 A;  4FIP A;  3KKU A;  2XU5 A;  4Q8G A;  3AI8 A;  1ZIV A;  4YYV A;  5A24 A;  2E00 A;  2O6X A;  2C0Y A;  1GLO A;  2DC7 A;  2NQA A;  3H7D A;  1PE6 A;  2HHN A;  4XR7 A;  2G6D A;  2YJ2 A;  1KHP A;  1KFX L;  1MDW A;  1ICF A;  5CVM A;  5JA7 A;  2E03 A;  3RVV A;  2R6N A;  1YK7 A;  2YJC A;  4QBB A;  1Y4H A;  4Q8H A;  2AIM A;  2G7Y A;  2CIO A;  1GMY A;  4KLB A;  3WXF A;  4AXL A;  2ATO A;  2AUZ A;  5CVO B;  4YYS A;  5CHT A;  3OVX A;  3N3G A;  1YT7 A;  7PCK A;  3CH2 X;  1F2A A;  2G8J A;  2H7J A;  1X9Y A;  1CV8 A;  4W4U A;  2YJB A;  2AS8 A;  2DC9 A;  8PCH A;  1BGO A;  4W5C A;  1BY8 A;  1PPO A;  3BPF A;  1ME4 A;  3IHP A;  4W5B A;  4HWY A;  3P5U A;  3K24 A;  2GHU A;  4K7C A;  1MIR A;  1ATK A;  5K16 A;  3V6E A;  4P6E A;  2XU1 A;  4CZW A;  1BQI A;  1EWL A;  3HWN A;  2AYN A;  4OEM A;  4PAD A;  3I3T A;  2R9N A;  2AVW A;  1AEC A;  1KHQ A;  4CDC B; 
#chains in the Genus database with same CATH topology
 1QMY A;  4X6H A;  2BDZ A;  3PT2 A;  4HXD B;  2B1N A;  2DZZ A;  1NLJ A;  4REZ A;  4AXM A;  2DCB A;  2AGA A;  3OIS A;  1QXP A;  1EWO A;  2F7D A;  4MZO A;  4DMX A;  3QT4 A;  3NHE A;  1VJV A;  1YVB A;  4BS5 A;  1AYU A;  1NPZ A;  4DMY A;  1DKI A;  1K3B B;  2DC6 A;  2BTW B;  2JRI A;  3RVW A;  2DC8 A;  3OVZ A;  2FO5 A;  2OZ2 A;  3F5V A;  4BQV A;  4MZS A;  4WUR A;  1KXR A;  3E1Z B;  4YYU A;  4OEL A;  5PAD A;  4N8W A;  3S3Q A;  9PAP A;  2IPP B;  1THE A;  2HXZ A;  2NQI A;  4MSX A;  3QJ3 A;  2R9C A;  1U9W A;  3S3R A;  3PNR A;  1YAL A;  2UZJ A;  3MP2 A;  3KX1 A;  4FJC A;  3HHA A;  3LXS A;  2FTD A;  3C0R A;  2IBI A;  2R9F A;  4RF1 A;  5CHV A;  2VHF A;  1POP A;  1MEG A;  3P5V A;  3BWK A;  3I06 A;  1QOL A;  2P86 A;  3P5X A;  1ZCM A;  2B1M A;  2DOS A;  5JH3 A;  2E02 A;  2FUD A;  1CSB B;  3BB7 A;  4QRX A;  1EWM A;  2J7Q C;  1GEC E;  1F2C A;  1NB3 A;  2WBF X;  1Q6K A;  3PBH A;  1BP4 A;  2DZY A;  1TLO A;  2OP3 A;  2XU3 A;  2AU1 A;  3PHW A;  2FQ9 A;  3PHX A;  4BS6 A;  3O1G A;  3M99 A;  4CDE B;  4OW0 A;  2FYE A;  1PPD A;  4QH6 A;  3MTN A;  1AU2 A;  1CB5 A;  2P0R A;  1NB5 A;  4CDF B;  2DJG B;  3HHI A;  3WXE A;  2VHS A;  3USV A;  3H89 A;  4IP3 A;  5J94 A;  1DF0 A;  4XUI A;  4MI7 A;  3O0U A;  4BOS A;  1PPP A;  3BC3 A;  2E01 A;  1PBH A;  3QSD A;  3D6S A;  4BSQ A;  3U8E A;  3ZUA A;  2HWK A;  1TL9 A;  3C9E A;  3PRM A;  4XZX A;  2JQF R;  3F75 A;  3BOW A;  3KSE A;  2HH5 A;  1PIP A;  1QDQ A;  1CQD A;  3ERV A;  3DF0 A;  2NQD B;  2BU3 A;  5FPW A;  2JQG R;  3CBJ A;  4PP2 E;  5EGW A;  2DCD A;  2AUX A;  1Y08 A;  1U9X A;  4IUM A;  4RF0 A;  2DJF B;  1M6D A;  6PAD A;  1SNK A;  3BPM A;  2R9M A;  3N4C A;  4BPV A;  2NQG A;  3E9S A;  3PDF A;  3MHH A;  3N3K A;  1EF7 A;  1HUC B;  2FRQ A;  4YV8 A;  4YVA A;  2PRE A;  4I05 A;  3H6S A;  4OVZ A;  2R9O A;  3OF8 A;  2Y5B A;  1U9Q X;  1F29 A;  3KWB X;  4P6G A;  3MTV A;  5JZE A;  3KFQ A;  3IV2 A;  1PAD A;  1U5I A;  2GFO A;  4R3D A;  1FH0 A;  1PXV A;  1DEU A;  1YZB A;  2FT2 A;  1KFU L;  4CDD B;  3IEJ A;  1AIM A;  1NQC A;  3CBK A;  2DCC A;  3RVX A;  3MOR A;  1S4V A;  1IWD A;  3KWZ A;  3IOQ A;  4BOP A;  5KO3 A;  4RY2 A;  3B79 A;  2J7Q A;  2ARY A;  4PI3 A;  3PRP A;  3PHU A;  3LFY A;  1MHW A;  1NL6 A;  4N79 A;  3W30 A;  1AYV A;  3WXG A;  3W31 A;  4YYQ A;  1CVZ A;  3TNX A;  1CTE A;  2DCA A;  4YYR A;  2FRA A;  4X6J A;  1CPJ A;  1TU6 A;  1AU3 A;  2BDL A;  4D8B A;  4ZUX U;  1AU0 A;  2P7U A;  4FK5 A;  2F1G A;  1MEM A;  4X6I A;  4N4Z A;  3ZNH A;  1ME3 A;  2YJ8 A;  4QRV A;  2PBH A;  1GCB A;  3IMA A;  2YJ9 A;  3V6C A;  3BCN A;  2PNS A;  1U9V A;  5EF4 A;  1JQP A;  4I04 A;  1O0E A;  3CH3 X;  4ZTB A;  3MHS A;  4D8I A;  4YYW A;  1PPN A;  3K8U A;  1CJL A;  2PAD A;  2XU4 A;  2HD5 A;  2Y6E A;  1YK8 A;  5CVN B;  4BOQ A;  3PW3 A;  4WA6 A;  1EWP A;  2CB5 A;  2G8E A;  4G54 A;  3KW9 A;  2BTW A;  1STF E;  3P5W A;  1PCI A;  3MJ5 A;  5E6J A;  4QRG A;  4MM3 B;  5F02 A;  3GCB A;  4I07 A;  1XKG A;  2AYO A;  3HD3 A;  1MS6 A;  3PSE A;  3H8B A;  4PP1 A;  1CS8 A;  3TRK A;  3H8C A;  1F2B A;  1A6R A;  2ACT A;  2OUL A;  1AYW A;  5EZQ A;  3K9M A;  1VSN A;  1ITO A;  4PT5 A;  1SP4 B;  4P16 A;  3OF9 A;  3IUT A;  1AU4 A;  4FIP A;  4OVZ B;  3KKU A;  3IFU A;  3TMP A;  2XU5 A;  4Q8G A;  3AI8 A;  1ZIV A;  4YYV A;  5A24 A;  3RNV A;  2JTC A;  4GUA A;  2E00 A;  2O6X A;  2C0Y A;  1GLO A;  2DC7 A;  3OQC A;  2NQA A;  3H7D A;  1PVJ A;  1PE6 A;  2HHN A;  4XR7 A;  2G6D A;  4RNA A;  2YJ2 A;  1KHP A;  1KFX L;  1MDW A;  5EZS A;  1ICF A;  3O65 A;  5CVM A;  5JA7 A;  2E03 A;  3RVV A;  2R6N A;  4D8E A;  1YK7 A;  3BBA A;  4BOZ A;  2YJC A;  3B21 A;  2Z84 A;  1UKF A;  4QBB A;  1Y4H A;  4Q8H A;  2AIM A;  2G7Y A;  2CIO A;  1GMY A;  4KLB A;  3WXF A;  4AXL A;  2ATO A;  2AUZ A;  5CVO B;  4YYS A;  5CHT A;  3OVX A;  3N3G A;  1YT7 A;  7PCK A;  3CH2 X;  4RKX A;  1F2A A;  3BY4 A;  2G8J A;  2H7J A;  1X9Y A;  1CV8 A;  4W4U A;  2YJB A;  2AS8 A;  2DC9 A;  8PCH A;  1BGO A;  4W5C A;  1BY8 A;  1PPO A;  3BPF A;  1ME4 A;  3IHP A;  4W5B A;  4HWY A;  3P5U A;  4BOU A;  3K24 A;  2GHU A;  4K7C A;  1MIR A;  1ATK A;  5K16 A;  3V6E A;  4P6E A;  2XU1 A;  4CZW A;  1BQI A;  1EWL A;  3HWN A;  4A5U A;  2AYN A;  4OEM A;  4PAD A;  2FE8 A;  3I3T A;  2R9N A;  2AVW A;  4M0W A;  1AEC A;  1KHQ A;  4CDC B; 
#chains in the Genus database with same CATH homology
 1QMY A;  4X6H A;  2BDZ A;  2B1N A;  2DZZ A;  1NLJ A;  4AXM A;  2DCB A;  3OIS A;  1QXP A;  1EWO A;  2F7D A;  4MZO A;  4DMX A;  3QT4 A;  3NHE A;  1VJV A;  1W5R A;  1YVB A;  4BS5 A;  1AYU A;  1NPZ A;  4DMY A;  1K3B B;  2DC6 A;  3RVW A;  2DC8 A;  3OVZ A;  2FO5 A;  2OZ2 A;  3F5V A;  4BQV A;  4MZS A;  1KXR A;  3E1Z B;  4YYU A;  4OEL A;  5PAD A;  4N8W A;  3S3Q A;  9PAP A;  2IPP B;  1THE A;  2HXZ A;  2NQI A;  4MSX A;  3QJ3 A;  2R9C A;  1U9W A;  3S3R A;  3PNR A;  1YAL A;  1E2T A;  3KX1 A;  4FJC A;  3HHA A;  3LXS A;  2FTD A;  2IBI A;  2R9F A;  5CHV A;  2VHF A;  1POP A;  1MEG A;  3P5V A;  3BWK A;  3I06 A;  1QOL A;  2P86 A;  3P5X A;  1ZCM A;  2B1M A;  5JH3 A;  2E02 A;  2FUD A;  1CSB B;  4QRX A;  1EWM A;  1GEC E;  1F2C A;  1NB3 A;  2WBF X;  1Q6K A;  3PBH A;  1BP4 A;  2DZY A;  1TLO A;  2OP3 A;  2XU3 A;  4NV7 A;  2AU1 A;  2FQ9 A;  4BS6 A;  3O1G A;  3M99 A;  4CDE B;  2FYE A;  1PPD A;  4QH6 A;  2BSZ A;  3MTN A;  1AU2 A;  1CB5 A;  2P0R A;  1NB5 A;  4CDF B;  1GX3 A;  2DJG B;  3HHI A;  3WXE A;  2VHS A;  3USV A;  3H89 A;  5J94 A;  1DF0 A;  4XUI A;  3O0U A;  1PPP A;  3BC3 A;  2E01 A;  1PBH A;  3QSD A;  3D6S A;  4BSQ A;  3U8E A;  3ZUA A;  1TL9 A;  3C9E A;  2VFB A;  2JQF R;  3F75 A;  3BOW A;  3KSE A;  3LTW A;  2HH5 A;  1PIP A;  1QDQ A;  1CQD A;  3ERV A;  3DF0 A;  1W4T A;  2NQD B;  5FPW A;  2JQG R;  3CBJ A;  4PP2 E;  5EGW A;  2DCD A;  2AUX A;  1Y08 A;  1U9X A;  3D9W A;  2DJF B;  1M6D A;  6PAD A;  1SNK A;  3BPM A;  2R9M A;  3N4C A;  4BPV A;  2NQG A;  3PDF A;  3MHH A;  3N3K A;  1EF7 A;  1HUC B;  2FRQ A;  4YV8 A;  4YVA A;  2PRE A;  4I05 A;  3H6S A;  2R9O A;  3OF8 A;  2Y5B A;  1U9Q X;  1F29 A;  2VFC A;  3KWB X;  4P6G A;  3KFQ A;  3IV2 A;  1PAD A;  1U5I A;  2GFO A;  1FH0 A;  1PXV A;  1DEU A;  2FT2 A;  1KFU L;  4CDD B;  3IEJ A;  1AIM A;  1NQC A;  3CBK A;  2DCC A;  3RVX A;  3MOR A;  1S4V A;  1IWD A;  3KWZ A;  3IOQ A;  4BGF A;  4RY2 A;  3B79 A;  2ARY A;  4PI3 A;  3LFY A;  1MHW A;  1NL6 A;  4N79 A;  1AYV A;  3WXG A;  4YYQ A;  1CVZ A;  3TNX A;  1CTE A;  4B55 A;  2DCA A;  4YYR A;  2FRA A;  4X6J A;  1CPJ A;  1TU6 A;  1AU3 A;  2BDL A;  4ZUX U;  1AU0 A;  2P7U A;  4FK5 A;  2F1G A;  1MEM A;  4X6I A;  4N4Z A;  1ME3 A;  2YJ8 A;  4QRV A;  2PBH A;  1GCB A;  3IMA A;  2YJ9 A;  1W6F A;  3V6C A;  3BCN A;  2PNS A;  1U9V A;  5EF4 A;  1JQP A;  4I04 A;  1O0E A;  3CH3 X;  3MHS A;  4YYW A;  1PPN A;  3K8U A;  1CJL A;  2PAD A;  2XU4 A;  2HD5 A;  2Y6E A;  1YK8 A;  5CVN B;  3PW3 A;  4WA6 A;  1EWP A;  2CB5 A;  2G8E A;  4G54 A;  3KW9 A;  4GUZ A;  1STF E;  3P5W A;  1PCI A;  4QRG A;  5F02 A;  3GCB A;  4I07 A;  1XKG A;  2AYO A;  3HD3 A;  4C5P A;  1MS6 A;  3H8B A;  4PP1 A;  1CS8 A;  3H8C A;  1F2B A;  1A6R A;  2ACT A;  2OUL A;  1AYW A;  3K9M A;  1VSN A;  1ITO A;  1SP4 B;  3OF9 A;  3IUT A;  1AU4 A;  4FIP A;  3KKU A;  2XU5 A;  4Q8G A;  3AI8 A;  1ZIV A;  4YYV A;  5A24 A;  2E00 A;  2O6X A;  2C0Y A;  1GLO A;  2DC7 A;  2NQA A;  3H7D A;  1PE6 A;  2HHN A;  4XR7 A;  2G6D A;  2YJ2 A;  1KHP A;  1KFX L;  1MDW A;  1ICF A;  5CVM A;  5JA7 A;  2E03 A;  3RVV A;  2R6N A;  1YK7 A;  2YJC A;  4QBB A;  1Y4H A;  4Q8H A;  2AIM A;  2G7Y A;  2CIO A;  1GMY A;  4KLB A;  3WXF A;  4AXL A;  2ATO A;  2AUZ A;  5CVO B;  4YYS A;  5CHT A;  3OVX A;  3N3G A;  1YT7 A;  7PCK A;  3CH2 X;  1F2A A;  2G8J A;  2H7J A;  1X9Y A;  1CV8 A;  4W4U A;  2YJB A;  2AS8 A;  2DC9 A;  8PCH A;  1BGO A;  4W5C A;  4NV8 A;  1BY8 A;  1PPO A;  3BPF A;  1ME4 A;  3IHP A;  4W5B A;  4HWY A;  3P5U A;  3K24 A;  2GHU A;  4K7C A;  1MIR A;  1ATK A;  5K16 A;  3V6E A;  4P6E A;  2XU1 A;  4CZW A;  1BQI A;  1EWL A;  3HWN A;  2AYN A;  4OEM A;  4PAD A;  3I3T A;  2R9N A;  2AVW A;  1AEC A;  1KHQ A;  4CDC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...