1EWPA

Cruzain bound to mor-leu-hpq
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
215
structure length
215
Chain Sequence
APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQLDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords CRUZAIN
publication title Chapter 3: X-ray Structures of Complexes of Cruzain with Designed Covalent Inhibitors
pubmed rcsb
source organism Trypanosoma cruzi
total genus 67
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.51: Cruzipain.
pdb deposition date 2000-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1ewpA00
1FH0A 4X6IA 3RVWA 4PP2E 1VSNA 1KFUL 2AU1A 1AIMA 2R9NA 6PADA 4AXLA 2DCAA 5EF4A 4N4ZA 1CTEA 1U9WA 3IV2A 1U9XA 3S3QA 3BC3A 3BCNA 3CBJA 1PE6A 2R6NA 4Q8HA 3BOWA 3NHEA 1MEGA 1EWOA 4BSQA 2P86A 3C9EA 3K9MA 3MORA 1PPOA 1THEA 4WA6A 2FUDA 3PBHA 2AUXA 4YVAA 4MZOA 4X6HA 2YJ9A 2XU3A 4QRVA 5CVNB 3O0UA 1STFE 2FTDA 3BPMA 2PNSA 1YVBA 2PREA 3KWZA 2E02A 2ARYA 1PCIA 1JQPA 1GLOA 3MHHA 3OF8A 3CH3X 3USVA 3PNRA 2C0YA 4FIPA 1AU0A 3P5XA 4CZWA 3AI8A 3KKUA 1ICFA 1YALA 3P5WA 4FJCA 1QOLA 3HD3A 1NL6A 4CDDB 1PADA 1AU2A 2YJCA 1Y4HA 5CHVA 4YYRA 1U9VA 4X6JA 2BDZA 1CB5A 1EWMA 2DC9A 3N3KA 4XUIA 2DJGB 2Y6EA 1GMYA 3F5VA 2G6DA 2NQAA 3KW9A 1M6DA 1BY8A 2XU1A 3ERVA 1X9YA 1TL9A 1KXRA 3H6SA 1PPDA 1MEMA 1PXVA 1Y08A 3KWBX 3B79A 3IOQA 2OP3A 2XU4A 4ZUXU 2E00A 4HWYA 3F75A 4K7CA 5A24A 1ITOA 3MHSA 4DMYA 3LXSA 2JQFR 1ME3A 2BDLA 9PAPA 2P0RA 1BP4A 2GFOA 5CVOB 4FK5A 2G8EA 4YYWA 4KLBA 3LFYA 3KFQA 3QJ3A 3HHIA 1AECA 1YK8A 2G7YA 3OVXA 2DZYA 7PCKA 2NQDB 2DC6A 3IUTA 2E01A 2AVWA 2GHUA 3I3TA 2ATOA 2HH5A 3O1GA 1PPPA 2YJBA 1PPNA 3P5VA 4QH6A 2R9CA 3K8UA 1CQDA 1NLJA 2DCDA 3KSEA 2IPPB 3RVVA 2R9OA 2DZZA 2AYNA 4RY2A 5CHTA 4Q8GA 5CVMA 4YYVA 2NQGA 4CDFB 5JA7A 1ME4A 4DMXA 1O0EA 4G54A 4CDCB 3V6CA 2FO5A 2F7DA 2FYEA 1CSBB 5FPWA 5JH3A 1QMYA 4MZSA 3U8EA 3MTNA 4CDEB 1F2AA 1AU3A 3WXEA 3WXGA 3RVXA 1A6RA 2HD5A 1EWLA 1U5IA 2OZ2A 3H8CA 1TLOA 1MIRA 2DCBA 1KHPA 1POPA 4MSXA 3H8BA 4BPVA 1SP4B 4OEMA 1ZIVA 3N4CA 1S4VA 1CS8A 2HXZA 3CBKA 2YJ2A 3PDFA 1MDWA 1QDQA 1F2BA 1KFXL 5PADA 4YV8A 1K3BB 2DCCA 4YYSA 3D6SA 2AIMA 1F29A 3OVZA 2OULA 1DF0A 1TU6A 4W5BA 1MHWA 2FRQA 2R9MA 1Q6KA 1XKGA 4P6EA 2F1GA 2NQIA 1NB3A 2VHSA 4I04A 5J94A 3BWKA 4N79A 3KX1A 3I06A 2CB5A 2H7JA 2VHFA 2G8JA 3H7DA 4OELA 2Y5BA 2O6XA 5EGWA 4BQVA 4W5CA 1CVZA 2HHNA 1QXPA 3IEJA 3CH2X 1HUCB 2PADA 4AXMA 1GECE 1NPZA 1YK7A 2DC7A 4I07A 4I05A 3HHAA 2DJFB 1AYVA 1IWDA 1AYWA 3DF0A 3WXFA 3M99A 3P5UA 2FQ9A 4YYUA 1MS6A 1DEUA 1BQIA 2DC8A 3IHPA 4PADA 3QSDA 2JQGR 3E1ZB 4PP1A 2CIOA 5K16A 1NQCA 1AYUA 1KHQA 4N8WA 2B1NA 1VJVA 4XR7A 2FRAA 4QBBA 3ZUAA 2B1MA 1CJLA 4W4UA 3GCBA 1GCBA 4QRXA 3V6EA 1SNKA 3BPFA 1CPJA 1ZCMA 1CV8A 1ATKA 2E03A 3S3RA 2AYOA 1PIPA 2YJ8A 4YYQA 2FT2A 2WBFX 1NB5A 2ACTA 2AS8A 3QT4A 4QRGA 3N3GA 1F2CA 4BS6A 3HWNA 3PW3A 8PCHA 2P7UA 1BGOA 2PBHA 4PI3A 3IMAA 1U9QX 1EF7A 3OF9A 3TNXA 2R9FA 1PBHA 3OISA 3H89A 2AUZA 5F02A 4BS5A 4P6GA 1AU4A 1YT7A 2IBIA 2XU5A 1EWPA 3K24A
chains in the Genus database with same CATH superfamily
1FH0A 4X6IA 3RVWA 4PP2E 5E6JA 1VSNA 4HXDB 1KFUL 3MTVA 2AU1A 1AIMA 2R9NA 6PADA 4AXLA 2DCAA 5EF4A 4N4ZA 1CTEA 1U9WA 3BB7A 3IV2A 1U9XA 3S3QA 2BTWB 3BC3A 3BCNA 3O65A 3CBJA 1PE6A 2R6NA 4Q8HA 3BOWA 3NHEA 1MEGA 1EWOA 4BSQA 2P86A 3C9EA 3K9MA 2J7QA 3MORA 1PPOA 1THEA 4IUMA 4WA6A 2FUDA 3PBHA 2AUXA 4YVAA 4MZOA 4X6HA 2YJ9A 2XU3A 4QRVA 4BOUA 5CVNB 4BOPA 1PVJA 3O0UA 1STFE 2FTDA 3BPMA 2PNSA 1YVBA 2PREA 3KWZA 1YZBA 2E02A 2ARYA 1PCIA 1JQPA 4OVZB 1GLOA 3MHHA 3OF8A 3CH3X 3USVA 3PNRA 2C0YA 5EZQA 4FIPA 1AU0A 3P5XA 3PRPA 3TMPA 4CZWA 3AI8A 3KKUA 1ICFA 4RF1A 1YALA 4XZXA 3P5WA 4FJCA 1QOLA 3HD3A 1NL6A 4CDDB 1PADA 1AU2A 2YJCA 1Y4HA 5CHVA 4YYRA 1U9VA 4X6JA 2BDZA 1CB5A 1EWMA 2DC9A 3N3KA 4XUIA 2DJGB 2Y6EA 1GMYA 3F5VA 2G6DA 2NQAA 3KW9A 4OW0A 1M6DA 4MM3B 1BY8A 2XU1A 3ERVA 1X9YA 1TL9A 1KXRA 3H6SA 3E9SA 1PPDA 1MEMA 4MI7A 1PXVA 1Y08A 3KWBX 3B79A 3IOQA 2OP3A 2XU4A 4ZUXU 2E00A 4HWYA 3F75A 4K7CA 5A24A 1ITOA 3MHSA 4DMYA 3LXSA 2JQFR 3MP2A 1ME3A 2BDLA 9PAPA 2P0RA 1BP4A 2GFOA 5CVOB 4D8BA 4FK5A 3PHXA 2G8EA 4YYWA 4KLBA 3LFYA 3KFQA 3QJ3A 4ZTBA 3HHIA 2Z84A 1AECA 1YK8A 2G7YA 3OVXA 2DZYA 7PCKA 2NQDB 2DC6A 3IUTA 2E01A 3BBAA 2AVWA 2DOSA 2GHUA 3I3TA 2ATOA 2HH5A 3O1GA 4REZA 1PPPA 2YJBA 1PPNA 3P5VA 4QH6A 2R9CA 3K8UA 1CQDA 1NLJA 2DCDA 3KSEA 2IBIA 4RKXA 2IPPB 2BTWA 3RVVA 2R9OA 2DZZA 2AYNA 4R3DA 4RY2A 5CHTA 3RNVA 4Q8GA 5CVMA 3PHWA 4YYVA 2NQGA 4CDFB 5JA7A 1ME4A 4DMXA 1O0EA 4G54A 4CDCB 3V6CA 2FO5A 3OQCA 2F7DA 2FYEA 1CSBB 5FPWA 4BOSA 5JH3A 1QMYA 4MZSA 3W31A 3U8EA 3MTNA 4CDEB 1F2AA 1AU3A 3MJ5A 3WXEA 3IFUA 3WXGA 3RVXA 1A6RA 2HD5A 1EWLA 1U5IA 2OZ2A 3H8CA 1TLOA 1MIRA 2DCBA 4OVZA 2HWKA 1UKFA 1KHPA 1POPA 4MSXA 3H8BA 4BPVA 1SP4B 5EZSA 4OEMA 1ZIVA 3N4CA 1S4VA 1CS8A 2HXZA 3CBKA 2YJ2A 4A5UA 3PDFA 1MDWA 1QDQA 1F2BA 1KFXL 5PADA 4YV8A 1K3BB 3BY4A 2DCCA 4YYSA 3PSEA 3D6SA 2AIMA 3B21A 3ZNHA 1F29A 4PT5A 3OVZA 2OULA 1DF0A 1TU6A 3PRMA 4W5BA 1MHWA 4WURA 2FRQA 2R9MA 1Q6KA 1XKGA 4P6EA 2F1GA 2NQIA 1NB3A 2VHSA 4I04A 5J94A 4RF0A 3BWKA 4N79A 3KX1A 4P16A 3I06A 2CB5A 2H7JA 2VHFA 2G8JA 3H7DA 4OELA 2Y5BA 2O6XA 5EGWA 4BQVA 4W5CA 1CVZA 2HHNA 1QXPA 3TRKA 3IEJA 3CH2X 2JTCA 1HUCB 2PADA 4AXMA 1GECE 1NPZA 1YK7A 2DC7A 4I07A 4I05A 2FE8A 3HHAA 2DJFB 3PT2A 1AYVA 1IWDA 1AYWA 1DKIA 3DF0A 3WXFA 3M99A 3P5UA 2FQ9A 4YYUA 1MS6A 1DEUA 2AGAA 4D8IA 1BQIA 2DC8A 3IHPA 4PADA 3QSDA 2JQGR 3E1ZB 4PP1A 4IP3A 2CIOA 5K16A 1NQCA 2UZJA 1AYUA 1KHQA 4N8WA 2B1NA 1VJVA 4XR7A 2FRAA 2J7QC 4QBBA 3ZUAA 2B1MA 1CJLA 2BU3A 4BOZA 4W4UA 5JZEA 3GCBA 4GUAA 1GCBA 4QRXA 3V6EA 1SNKA 3BPFA 1CPJA 1ZCMA 4RNAA 1CV8A 1ATKA 2E03A 3S3RA 2AYOA 1PIPA 2YJ8A 4YYQA 4D8EA 2FT2A 2WBFX 1NB5A 2ACTA 2AS8A 3QT4A 4QRGA 4M0WA 3N3GA 1F2CA 4BS6A 3HWNA 3PW3A 8PCHA 2P7UA 1BGOA 2PBHA 4PI3A 3IMAA 1U9QX 1EF7A 3OF9A 3TNXA 2R9FA 1PBHA 3OISA 4BOQA 3PHUA 3W30A 5KO3A 3H89A 2AUZA 5F02A 2JRIA 4BS5A 4P6GA 1AU4A 1YT7A 3C0RA 2XU5A 1EWPA 3K24A
chains in the Genus database with same CATH topology
1FH0A 4X6IA 3RVWA 4PP2E 1VSNA 1KFUL 2AU1A 1AIMA 2R9NA 6PADA 4AXLA 2DCAA 5EF4A 4N4ZA 1CTEA 1U9WA 3IV2A 1U9XA 3S3QA 3BC3A 3BCNA 3CBJA 1PE6A 2R6NA 4Q8HA 3BOWA 3NHEA 1MEGA 1EWOA 4BSQA 2P86A 3C9EA 3K9MA 3MORA 1PPOA 1THEA 1GX3A 4WA6A 2FUDA 3PBHA 2AUXA 4YVAA 4MZOA 4X6HA 2YJ9A 2XU3A 4QRVA 1W6FA 5CVNB 3O0UA 1STFE 2FTDA 4C5PA 3BPMA 2PNSA 1YVBA 2PREA 3KWZA 2E02A 2ARYA 1PCIA 1JQPA 1GLOA 3MHHA 3OF8A 3CH3X 1W4TA 3USVA 3PNRA 2C0YA 4FIPA 1AU0A 3P5XA 4CZWA 3AI8A 3KKUA 1ICFA 1YALA 3P5WA 4FJCA 1QOLA 3LTWA 3HD3A 1NL6A 4CDDB 1PADA 1AU2A 2YJCA 1Y4HA 5CHVA 4YYRA 1U9VA 4X6JA 2BDZA 1CB5A 1EWMA 2DC9A 3N3KA 4XUIA 2DJGB 2Y6EA 1GMYA 3F5VA 2G6DA 2NQAA 3KW9A 1M6DA 1BY8A 4NV7A 2XU1A 3ERVA 1X9YA 1TL9A 1KXRA 3H6SA 2VFBA 1PPDA 1MEMA 1PXVA 1Y08A 3KWBX 3B79A 3IOQA 2OP3A 2XU4A 4ZUXU 2E00A 4HWYA 3F75A 4K7CA 5A24A 1ITOA 3MHSA 4DMYA 3LXSA 2JQFR 1ME3A 2BDLA 9PAPA 2P0RA 1BP4A 2GFOA 5CVOB 4FK5A 2G8EA 4YYWA 4KLBA 3LFYA 3KFQA 3QJ3A 3HHIA 4NV8A 1AECA 1YK8A 2G7YA 3OVXA 2DZYA 7PCKA 2NQDB 2DC6A 3IUTA 2E01A 2AVWA 2GHUA 3I3TA 2ATOA 2HH5A 3O1GA 1PPPA 2YJBA 2BSZA 1PPNA 3P5VA 4GUZA 4QH6A 2R9CA 3K8UA 1CQDA 1NLJA 2DCDA 3KSEA 2IPPB 3RVVA 2R9OA 2DZZA 2AYNA 4RY2A 5CHTA 4Q8GA 5CVMA 4YYVA 2NQGA 4CDFB 5JA7A 1ME4A 4DMXA 1O0EA 4G54A 4CDCB 3V6CA 2FO5A 2F7DA 2FYEA 1CSBB 5FPWA 5JH3A 1QMYA 4MZSA 3U8EA 3MTNA 4CDEB 1F2AA 1AU3A 3WXEA 3WXGA 3RVXA 1A6RA 2HD5A 1EWLA 1U5IA 2OZ2A 3H8CA 1TLOA 1MIRA 2DCBA 1KHPA 1POPA 4MSXA 3H8BA 4BPVA 1SP4B 4OEMA 1ZIVA 3N4CA 1S4VA 1CS8A 2HXZA 3CBKA 2YJ2A 3PDFA 1MDWA 1QDQA 1F2BA 1KFXL 5PADA 4YV8A 1K3BB 2DCCA 4YYSA 3D6SA 2AIMA 1F29A 3OVZA 2OULA 1DF0A 1TU6A 4W5BA 1MHWA 2FRQA 2R9MA 2VFCA 1Q6KA 1XKGA 4P6EA 2F1GA 2NQIA 1NB3A 2VHSA 4I04A 5J94A 3BWKA 4N79A 3KX1A 3I06A 2CB5A 2H7JA 2VHFA 2G8JA 3H7DA 4OELA 2Y5BA 2O6XA 5EGWA 4BQVA 4W5CA 1CVZA 2HHNA 1QXPA 3IEJA 3CH2X 1HUCB 2PADA 4AXMA 1GECE 1NPZA 1YK7A 2DC7A 4I07A 4I05A 3HHAA 2DJFB 1AYVA 1IWDA 1AYWA 3DF0A 3WXFA 3M99A 3P5UA 2FQ9A 4YYUA 1MS6A 1DEUA 1BQIA 2DC8A 3IHPA 4PADA 3QSDA 2JQGR 3E1ZB 4PP1A 2CIOA 5K16A 1E2TA 1NQCA 1AYUA 1KHQA 4N8WA 2B1NA 4B55A 1VJVA 4XR7A 2FRAA 4QBBA 3ZUAA 2B1MA 1CJLA 4W4UA 3D9WA 3GCBA 1GCBA 4QRXA 3V6EA 1SNKA 3BPFA 1CPJA 1ZCMA 1CV8A 1ATKA 2E03A 3S3RA 2AYOA 1PIPA 2YJ8A 4YYQA 2FT2A 2WBFX 1NB5A 2ACTA 2AS8A 3QT4A 4QRGA 3N3GA 1F2CA 4BS6A 3HWNA 3PW3A 1W5RA 8PCHA 2P7UA 1BGOA 2PBHA 4PI3A 4BGFA 3IMAA 1U9QX 1EF7A 3OF9A 3TNXA 2R9FA 1PBHA 3OISA 3H89A 2AUZA 5F02A 4BS5A 4P6GA 1AU4A 1YT7A 2IBIA 2XU5A 1EWPA 3K24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FH0 A;  4X6I A;  3RVW A;  4PP2 E;  1VSN A;  1KFU L;  2AU1 A;  1AIM A;  2R9N A;  6PAD A;  4AXL A;  2DCA A;  5EF4 A;  4N4Z A;  1CTE A;  1U9W A;  3IV2 A;  1U9X A;  3S3Q A;  3BC3 A;  3BCN A;  3CBJ A;  1PE6 A;  2R6N A;  4Q8H A;  3BOW A;  3NHE A;  1MEG A;  1EWO A;  4BSQ A;  2P86 A;  3C9E A;  3K9M A;  3MOR A;  1PPO A;  1THE A;  4WA6 A;  2FUD A;  3PBH A;  2AUX A;  4YVA A;  4MZO A;  4X6H A;  2YJ9 A;  2XU3 A;  4QRV A;  5CVN B;  3O0U A;  1STF E;  2FTD A;  3BPM A;  2PNS A;  1YVB A;  2PRE A;  3KWZ A;  2E02 A;  2ARY A;  1PCI A;  1JQP A;  1GLO A;  3MHH A;  3OF8 A;  3CH3 X;  3USV A;  3PNR A;  2C0Y A;  4FIP A;  1AU0 A;  3P5X A;  4CZW A;  3AI8 A;  3KKU A;  1ICF A;  1YAL A;  3P5W A;  4FJC A;  1QOL A;  3HD3 A;  1NL6 A;  4CDD B;  1PAD A;  1AU2 A;  2YJC A;  1Y4H A;  5CHV A;  4YYR A;  1U9V A;  4X6J A;  2BDZ A;  1CB5 A;  1EWM A;  2DC9 A;  3N3K A;  4XUI A;  2DJG B;  2Y6E A;  1GMY A;  3F5V A;  2G6D A;  2NQA A;  3KW9 A;  1M6D A;  1BY8 A;  2XU1 A;  3ERV A;  1X9Y A;  1TL9 A;  1KXR A;  3H6S A;  1PPD A;  1MEM A;  1PXV A;  1Y08 A;  3KWB X;  3B79 A;  3IOQ A;  2OP3 A;  2XU4 A;  4ZUX U;  2E00 A;  4HWY A;  3F75 A;  4K7C A;  5A24 A;  1ITO A;  3MHS A;  4DMY A;  3LXS A;  2JQF R;  1ME3 A;  2BDL A;  9PAP A;  2P0R A;  1BP4 A;  2GFO A;  5CVO B;  4FK5 A;  2G8E A;  4YYW A;  4KLB A;  3LFY A;  3KFQ A;  3QJ3 A;  3HHI A;  1AEC A;  1YK8 A;  2G7Y A;  3OVX A;  2DZY A;  7PCK A;  2NQD B;  2DC6 A;  3IUT A;  2E01 A;  2AVW A;  2GHU A;  3I3T A;  2ATO A;  2HH5 A;  3O1G A;  1PPP A;  2YJB A;  1PPN A;  3P5V A;  4QH6 A;  2R9C A;  3K8U A;  1CQD A;  1NLJ A;  2DCD A;  3KSE A;  2IPP B;  3RVV A;  2R9O A;  2DZZ A;  2AYN A;  4RY2 A;  5CHT A;  4Q8G A;  5CVM A;  4YYV A;  2NQG A;  4CDF B;  5JA7 A;  1ME4 A;  4DMX A;  1O0E A;  4G54 A;  4CDC B;  3V6C A;  2FO5 A;  2F7D A;  2FYE A;  1CSB B;  5FPW A;  5JH3 A;  1QMY A;  4MZS A;  3U8E A;  3MTN A;  4CDE B;  1F2A A;  1AU3 A;  3WXE A;  3WXG A;  3RVX A;  1A6R A;  2HD5 A;  1EWL A;  1U5I A;  2OZ2 A;  3H8C A;  1TLO A;  1MIR A;  2DCB A;  1KHP A;  1POP A;  4MSX A;  3H8B A;  4BPV A;  1SP4 B;  4OEM A;  1ZIV A;  3N4C A;  1S4V A;  1CS8 A;  2HXZ A;  3CBK A;  2YJ2 A;  3PDF A;  1MDW A;  1QDQ A;  1F2B A;  1KFX L;  5PAD A;  4YV8 A;  1K3B B;  2DCC A;  4YYS A;  3D6S A;  2AIM A;  1F29 A;  3OVZ A;  2OUL A;  1DF0 A;  1TU6 A;  4W5B A;  1MHW A;  2FRQ A;  2R9M A;  1Q6K A;  1XKG A;  4P6E A;  2F1G A;  2NQI A;  1NB3 A;  2VHS A;  4I04 A;  5J94 A;  3BWK A;  4N79 A;  3KX1 A;  3I06 A;  2CB5 A;  2H7J A;  2VHF A;  2G8J A;  3H7D A;  4OEL A;  2Y5B A;  2O6X A;  5EGW A;  4BQV A;  4W5C A;  1CVZ A;  2HHN A;  1QXP A;  3IEJ A;  3CH2 X;  1HUC B;  2PAD A;  4AXM A;  1GEC E;  1NPZ A;  1YK7 A;  2DC7 A;  4I07 A;  4I05 A;  3HHA A;  2DJF B;  1AYV A;  1IWD A;  1AYW A;  3DF0 A;  3WXF A;  3M99 A;  3P5U A;  2FQ9 A;  4YYU A;  1MS6 A;  1DEU A;  1BQI A;  2DC8 A;  3IHP A;  4PAD A;  3QSD A;  2JQG R;  3E1Z B;  4PP1 A;  2CIO A;  5K16 A;  1NQC A;  1AYU A;  1KHQ A;  4N8W A;  2B1N A;  1VJV A;  4XR7 A;  2FRA A;  4QBB A;  3ZUA A;  2B1M A;  1CJL A;  4W4U A;  3GCB A;  1GCB A;  4QRX A;  3V6E A;  1SNK A;  3BPF A;  1CPJ A;  1ZCM A;  1CV8 A;  1ATK A;  2E03 A;  3S3R A;  2AYO A;  1PIP A;  2YJ8 A;  4YYQ A;  2FT2 A;  2WBF X;  1NB5 A;  2ACT A;  2AS8 A;  3QT4 A;  4QRG A;  3N3G A;  1F2C A;  4BS6 A;  3HWN A;  3PW3 A;  8PCH A;  2P7U A;  1BGO A;  2PBH A;  4PI3 A;  3IMA A;  1U9Q X;  1EF7 A;  3OF9 A;  3TNX A;  2R9F A;  1PBH A;  3OIS A;  3H89 A;  2AUZ A;  5F02 A;  4BS5 A;  4P6G A;  1AU4 A;  1YT7 A;  2IBI A;  2XU5 A;  1EWP A;  3K24 A; 
#chains in the Genus database with same CATH topology
 1FH0 A;  4X6I A;  3RVW A;  4PP2 E;  5E6J A;  1VSN A;  4HXD B;  1KFU L;  3MTV A;  2AU1 A;  1AIM A;  2R9N A;  6PAD A;  4AXL A;  2DCA A;  5EF4 A;  4N4Z A;  1CTE A;  1U9W A;  3BB7 A;  3IV2 A;  1U9X A;  3S3Q A;  2BTW B;  3BC3 A;  3BCN A;  3O65 A;  3CBJ A;  1PE6 A;  2R6N A;  4Q8H A;  3BOW A;  3NHE A;  1MEG A;  1EWO A;  4BSQ A;  2P86 A;  3C9E A;  3K9M A;  2J7Q A;  3MOR A;  1PPO A;  1THE A;  4IUM A;  4WA6 A;  2FUD A;  3PBH A;  2AUX A;  4YVA A;  4MZO A;  4X6H A;  2YJ9 A;  2XU3 A;  4QRV A;  4BOU A;  5CVN B;  4BOP A;  1PVJ A;  3O0U A;  1STF E;  2FTD A;  3BPM A;  2PNS A;  1YVB A;  2PRE A;  3KWZ A;  1YZB A;  2E02 A;  2ARY A;  1PCI A;  1JQP A;  4OVZ B;  1GLO A;  3MHH A;  3OF8 A;  3CH3 X;  3USV A;  3PNR A;  2C0Y A;  5EZQ A;  4FIP A;  1AU0 A;  3P5X A;  3PRP A;  3TMP A;  4CZW A;  3AI8 A;  3KKU A;  1ICF A;  4RF1 A;  1YAL A;  4XZX A;  3P5W A;  4FJC A;  1QOL A;  3HD3 A;  1NL6 A;  4CDD B;  1PAD A;  1AU2 A;  2YJC A;  1Y4H A;  5CHV A;  4YYR A;  1U9V A;  4X6J A;  2BDZ A;  1CB5 A;  1EWM A;  2DC9 A;  3N3K A;  4XUI A;  2DJG B;  2Y6E A;  1GMY A;  3F5V A;  2G6D A;  2NQA A;  3KW9 A;  4OW0 A;  1M6D A;  4MM3 B;  1BY8 A;  2XU1 A;  3ERV A;  1X9Y A;  1TL9 A;  1KXR A;  3H6S A;  3E9S A;  1PPD A;  1MEM A;  4MI7 A;  1PXV A;  1Y08 A;  3KWB X;  3B79 A;  3IOQ A;  2OP3 A;  2XU4 A;  4ZUX U;  2E00 A;  4HWY A;  3F75 A;  4K7C A;  5A24 A;  1ITO A;  3MHS A;  4DMY A;  3LXS A;  2JQF R;  3MP2 A;  1ME3 A;  2BDL A;  9PAP A;  2P0R A;  1BP4 A;  2GFO A;  5CVO B;  4D8B A;  4FK5 A;  3PHX A;  2G8E A;  4YYW A;  4KLB A;  3LFY A;  3KFQ A;  3QJ3 A;  4ZTB A;  3HHI A;  2Z84 A;  1AEC A;  1YK8 A;  2G7Y A;  3OVX A;  2DZY A;  7PCK A;  2NQD B;  2DC6 A;  3IUT A;  2E01 A;  3BBA A;  2AVW A;  2DOS A;  2GHU A;  3I3T A;  2ATO A;  2HH5 A;  3O1G A;  4REZ A;  1PPP A;  2YJB A;  1PPN A;  3P5V A;  4QH6 A;  2R9C A;  3K8U A;  1CQD A;  1NLJ A;  2DCD A;  3KSE A;  2IBI A;  4RKX A;  2IPP B;  2BTW A;  3RVV A;  2R9O A;  2DZZ A;  2AYN A;  4R3D A;  4RY2 A;  5CHT A;  3RNV A;  4Q8G A;  5CVM A;  3PHW A;  4YYV A;  2NQG A;  4CDF B;  5JA7 A;  1ME4 A;  4DMX A;  1O0E A;  4G54 A;  4CDC B;  3V6C A;  2FO5 A;  3OQC A;  2F7D A;  2FYE A;  1CSB B;  5FPW A;  4BOS A;  5JH3 A;  1QMY A;  4MZS A;  3W31 A;  3U8E A;  3MTN A;  4CDE B;  1F2A A;  1AU3 A;  3MJ5 A;  3WXE A;  3IFU A;  3WXG A;  3RVX A;  1A6R A;  2HD5 A;  1EWL A;  1U5I A;  2OZ2 A;  3H8C A;  1TLO A;  1MIR A;  2DCB A;  4OVZ A;  2HWK A;  1UKF A;  1KHP A;  1POP A;  4MSX A;  3H8B A;  4BPV A;  1SP4 B;  5EZS A;  4OEM A;  1ZIV A;  3N4C A;  1S4V A;  1CS8 A;  2HXZ A;  3CBK A;  2YJ2 A;  4A5U A;  3PDF A;  1MDW A;  1QDQ A;  1F2B A;  1KFX L;  5PAD A;  4YV8 A;  1K3B B;  3BY4 A;  2DCC A;  4YYS A;  3PSE A;  3D6S A;  2AIM A;  3B21 A;  3ZNH A;  1F29 A;  4PT5 A;  3OVZ A;  2OUL A;  1DF0 A;  1TU6 A;  3PRM A;  4W5B A;  1MHW A;  4WUR A;  2FRQ A;  2R9M A;  1Q6K A;  1XKG A;  4P6E A;  2F1G A;  2NQI A;  1NB3 A;  2VHS A;  4I04 A;  5J94 A;  4RF0 A;  3BWK A;  4N79 A;  3KX1 A;  4P16 A;  3I06 A;  2CB5 A;  2H7J A;  2VHF A;  2G8J A;  3H7D A;  4OEL A;  2Y5B A;  2O6X A;  5EGW A;  4BQV A;  4W5C A;  1CVZ A;  2HHN A;  1QXP A;  3TRK A;  3IEJ A;  3CH2 X;  2JTC A;  1HUC B;  2PAD A;  4AXM A;  1GEC E;  1NPZ A;  1YK7 A;  2DC7 A;  4I07 A;  4I05 A;  2FE8 A;  3HHA A;  2DJF B;  3PT2 A;  1AYV A;  1IWD A;  1AYW A;  1DKI A;  3DF0 A;  3WXF A;  3M99 A;  3P5U A;  2FQ9 A;  4YYU A;  1MS6 A;  1DEU A;  2AGA A;  4D8I A;  1BQI A;  2DC8 A;  3IHP A;  4PAD A;  3QSD A;  2JQG R;  3E1Z B;  4PP1 A;  4IP3 A;  2CIO A;  5K16 A;  1NQC A;  2UZJ A;  1AYU A;  1KHQ A;  4N8W A;  2B1N A;  1VJV A;  4XR7 A;  2FRA A;  2J7Q C;  4QBB A;  3ZUA A;  2B1M A;  1CJL A;  2BU3 A;  4BOZ A;  4W4U A;  5JZE A;  3GCB A;  4GUA A;  1GCB A;  4QRX A;  3V6E A;  1SNK A;  3BPF A;  1CPJ A;  1ZCM A;  4RNA A;  1CV8 A;  1ATK A;  2E03 A;  3S3R A;  2AYO A;  1PIP A;  2YJ8 A;  4YYQ A;  4D8E A;  2FT2 A;  2WBF X;  1NB5 A;  2ACT A;  2AS8 A;  3QT4 A;  4QRG A;  4M0W A;  3N3G A;  1F2C A;  4BS6 A;  3HWN A;  3PW3 A;  8PCH A;  2P7U A;  1BGO A;  2PBH A;  4PI3 A;  3IMA A;  1U9Q X;  1EF7 A;  3OF9 A;  3TNX A;  2R9F A;  1PBH A;  3OIS A;  4BOQ A;  3PHU A;  3W30 A;  5KO3 A;  3H89 A;  2AUZ A;  5F02 A;  2JRI A;  4BS5 A;  4P6G A;  1AU4 A;  1YT7 A;  3C0R A;  2XU5 A;  1EWP A;  3K24 A; 
#chains in the Genus database with same CATH homology
 1FH0 A;  4X6I A;  3RVW A;  4PP2 E;  1VSN A;  1KFU L;  2AU1 A;  1AIM A;  2R9N A;  6PAD A;  4AXL A;  2DCA A;  5EF4 A;  4N4Z A;  1CTE A;  1U9W A;  3IV2 A;  1U9X A;  3S3Q A;  3BC3 A;  3BCN A;  3CBJ A;  1PE6 A;  2R6N A;  4Q8H A;  3BOW A;  3NHE A;  1MEG A;  1EWO A;  4BSQ A;  2P86 A;  3C9E A;  3K9M A;  3MOR A;  1PPO A;  1THE A;  1GX3 A;  4WA6 A;  2FUD A;  3PBH A;  2AUX A;  4YVA A;  4MZO A;  4X6H A;  2YJ9 A;  2XU3 A;  4QRV A;  1W6F A;  5CVN B;  3O0U A;  1STF E;  2FTD A;  4C5P A;  3BPM A;  2PNS A;  1YVB A;  2PRE A;  3KWZ A;  2E02 A;  2ARY A;  1PCI A;  1JQP A;  1GLO A;  3MHH A;  3OF8 A;  3CH3 X;  1W4T A;  3USV A;  3PNR A;  2C0Y A;  4FIP A;  1AU0 A;  3P5X A;  4CZW A;  3AI8 A;  3KKU A;  1ICF A;  1YAL A;  3P5W A;  4FJC A;  1QOL A;  3LTW A;  3HD3 A;  1NL6 A;  4CDD B;  1PAD A;  1AU2 A;  2YJC A;  1Y4H A;  5CHV A;  4YYR A;  1U9V A;  4X6J A;  2BDZ A;  1CB5 A;  1EWM A;  2DC9 A;  3N3K A;  4XUI A;  2DJG B;  2Y6E A;  1GMY A;  3F5V A;  2G6D A;  2NQA A;  3KW9 A;  1M6D A;  1BY8 A;  4NV7 A;  2XU1 A;  3ERV A;  1X9Y A;  1TL9 A;  1KXR A;  3H6S A;  2VFB A;  1PPD A;  1MEM A;  1PXV A;  1Y08 A;  3KWB X;  3B79 A;  3IOQ A;  2OP3 A;  2XU4 A;  4ZUX U;  2E00 A;  4HWY A;  3F75 A;  4K7C A;  5A24 A;  1ITO A;  3MHS A;  4DMY A;  3LXS A;  2JQF R;  1ME3 A;  2BDL A;  9PAP A;  2P0R A;  1BP4 A;  2GFO A;  5CVO B;  4FK5 A;  2G8E A;  4YYW A;  4KLB A;  3LFY A;  3KFQ A;  3QJ3 A;  3HHI A;  4NV8 A;  1AEC A;  1YK8 A;  2G7Y A;  3OVX A;  2DZY A;  7PCK A;  2NQD B;  2DC6 A;  3IUT A;  2E01 A;  2AVW A;  2GHU A;  3I3T A;  2ATO A;  2HH5 A;  3O1G A;  1PPP A;  2YJB A;  2BSZ A;  1PPN A;  3P5V A;  4GUZ A;  4QH6 A;  2R9C A;  3K8U A;  1CQD A;  1NLJ A;  2DCD A;  3KSE A;  2IPP B;  3RVV A;  2R9O A;  2DZZ A;  2AYN A;  4RY2 A;  5CHT A;  4Q8G A;  5CVM A;  4YYV A;  2NQG A;  4CDF B;  5JA7 A;  1ME4 A;  4DMX A;  1O0E A;  4G54 A;  4CDC B;  3V6C A;  2FO5 A;  2F7D A;  2FYE A;  1CSB B;  5FPW A;  5JH3 A;  1QMY A;  4MZS A;  3U8E A;  3MTN A;  4CDE B;  1F2A A;  1AU3 A;  3WXE A;  3WXG A;  3RVX A;  1A6R A;  2HD5 A;  1EWL A;  1U5I A;  2OZ2 A;  3H8C A;  1TLO A;  1MIR A;  2DCB A;  1KHP A;  1POP A;  4MSX A;  3H8B A;  4BPV A;  1SP4 B;  4OEM A;  1ZIV A;  3N4C A;  1S4V A;  1CS8 A;  2HXZ A;  3CBK A;  2YJ2 A;  3PDF A;  1MDW A;  1QDQ A;  1F2B A;  1KFX L;  5PAD A;  4YV8 A;  1K3B B;  2DCC A;  4YYS A;  3D6S A;  2AIM A;  1F29 A;  3OVZ A;  2OUL A;  1DF0 A;  1TU6 A;  4W5B A;  1MHW A;  2FRQ A;  2R9M A;  2VFC A;  1Q6K A;  1XKG A;  4P6E A;  2F1G A;  2NQI A;  1NB3 A;  2VHS A;  4I04 A;  5J94 A;  3BWK A;  4N79 A;  3KX1 A;  3I06 A;  2CB5 A;  2H7J A;  2VHF A;  2G8J A;  3H7D A;  4OEL A;  2Y5B A;  2O6X A;  5EGW A;  4BQV A;  4W5C A;  1CVZ A;  2HHN A;  1QXP A;  3IEJ A;  3CH2 X;  1HUC B;  2PAD A;  4AXM A;  1GEC E;  1NPZ A;  1YK7 A;  2DC7 A;  4I07 A;  4I05 A;  3HHA A;  2DJF B;  1AYV A;  1IWD A;  1AYW A;  3DF0 A;  3WXF A;  3M99 A;  3P5U A;  2FQ9 A;  4YYU A;  1MS6 A;  1DEU A;  1BQI A;  2DC8 A;  3IHP A;  4PAD A;  3QSD A;  2JQG R;  3E1Z B;  4PP1 A;  2CIO A;  5K16 A;  1E2T A;  1NQC A;  1AYU A;  1KHQ A;  4N8W A;  2B1N A;  4B55 A;  1VJV A;  4XR7 A;  2FRA A;  4QBB A;  3ZUA A;  2B1M A;  1CJL A;  4W4U A;  3D9W A;  3GCB A;  1GCB A;  4QRX A;  3V6E A;  1SNK A;  3BPF A;  1CPJ A;  1ZCM A;  1CV8 A;  1ATK A;  2E03 A;  3S3R A;  2AYO A;  1PIP A;  2YJ8 A;  4YYQ A;  2FT2 A;  2WBF X;  1NB5 A;  2ACT A;  2AS8 A;  3QT4 A;  4QRG A;  3N3G A;  1F2C A;  4BS6 A;  3HWN A;  3PW3 A;  1W5R A;  8PCH A;  2P7U A;  1BGO A;  2PBH A;  4PI3 A;  4BGF A;  3IMA A;  1U9Q X;  1EF7 A;  3OF9 A;  3TNX A;  2R9F A;  1PBH A;  3OIS A;  3H89 A;  2AUZ A;  5F02 A;  4BS5 A;  4P6G A;  1AU4 A;  1YT7 A;  2IBI A;  2XU5 A;  1EWP A;  3K24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...