2DCAA

X-ray crystal structure analysis of bovine spleen cathepsin b-ca075 complex
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
253
structure length
251
Chain Sequence
LPESFDAREQWPNCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHSNVNVEVSAEDMLTCCGGECGDGCNGGFPSGAWNFWTKKGLVSGGLYNSHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKTCEPGYSPSYKEDKHFGCSSYSVANNEKEIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVSGEIMGGHAIRILGWGVENGTPYWLVGNSWNTDWGDNGFFKILRGQDHCGIESEIVAGMPCT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CATHEPSIN B
publication title Quantitative estimation of each active subsite of cathepsin B for the inhibitory activity, based on the inhibitory activitybinding mode relationship of a series of epoxysuccinyl inhibitors by X-ray crystal structure analyses of the complexes
rcsb
total genus 76
structure length 251
sequence length 253
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2006-01-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2dcaA00
1KFXL 2PBHA 4P6GA 1U9WA 3KX1A 4X6IA 3K24A 1GCBA 4WA6A 2G7YA 2WBFX 4BS6A 2IPPB 1TU6A 3CBJA 4KLBA 3RVWA 4CZWA 2R9MA 4PP2E 2OZ2A 1ITOA 2DZYA 2XU3A 3BPMA 4FIPA 2GHUA 3OVXA 4QRGA 2AYNA 2DCAA 2YJ2A 5JH3A 4AXMA 3V6EA 3AI8A 2AUZA 3IOQA 9PAPA 1EWOA 2P86A 2CIOA 2AIMA 2F1GA 5CVOB 2DC7A 3H8CA 5EGWA 1FH0A 2HHNA 4DMYA 1GMYA 3LFYA 3PDFA 3OF8A 3PBHA 4YYSA 1QOLA 3CH2X 4N4ZA 4X6HA 2E03A 1ICFA 3IUTA 2ATOA 3USVA 1F2AA 1ZIVA 1PCIA 1CTEA 1KXRA 1PXVA 4CDEB 1KHPA 1PE6A 4N8WA 4CDDB 1EWPA 3U8EA 8PCHA 1AYUA 1Q6KA 1CSBB 3GCBA 5CHVA 2E02A 1KHQA 1VSNA 1NL6A 1YVBA 3N3KA 4PADA 3RVVA 2Y5BA 2R9CA 4DMXA 2AS8A 4YYVA 1YK8A 3P5UA 3O1GA 2GFOA 4I05A 4YYQA 3HWNA 4FJCA 2YJ8A 1CJLA 3P5XA 1MIRA 1U9XA 4ZUXU 1U5IA 1ZCMA 3IEJA 4G54A 1YALA 1AIMA 2DJFB 3BOWA 2XU1A 2HXZA 2JQGR 4QBBA 3M99A 1TLOA 7PCKA 3KWZA 1K3BB 3H7DA 3N3GA 2C0YA 2F7DA 3HHIA 4MZSA 3S3RA 2IBIA 3D6SA 2R6NA 3H6SA 4XR7A 2FT2A 5EF4A 1KFUL 2ARYA 3HHAA 4YYWA 1DF0A 1AU4A 1QMYA 3ERVA 3P5WA 3KKUA 2BDLA 6PADA 1EWMA 2XU4A 2YJBA 4HWYA 4BPVA 3BWKA 1ATKA 2NQDB 3IMAA 1NB3A 1O0EA 2XU5A 3IHPA 1M6DA 1AYWA 1U9QX 3E1ZB 3P5VA 2E00A 4CDCB 1THEA 5CHTA 3B79A 3MTNA 3IV2A 1CPJA 1Y08A 1F2BA 3QT4A 1VJVA 1EF7A 3F75A 1CV8A 1NPZA 1GLOA 4BS5A 1U9VA 5J94A 1PPNA 2JQFR 1X9YA 2Y6EA 2DZZA 2AUXA 3OVZA 1BQIA 3ZUAA 3OISA 4QH6A 2NQAA 2O6XA 4PI3A 3PNRA 1BP4A 2HD5A 1A6RA 1STFE 1CB5A 5JA7A 3QSDA 4W4UA 1F29A 3WXGA 1BGOA 1ME3A 2NQGA 1AYVA 2FQ9A 2FTDA 1AU3A 5PADA 2OP3A 2AU1A 2ACTA 2AYOA 3BC3A 3H89A 1Y4HA 5FPWA 3H8BA 2P0RA 3KFQA 3N4CA 3MHSA 3CH3X 1CS8A 1MEGA 4YV8A 2DCCA 2FRAA 1CQDA 2BDZA 2AVWA 3K9MA 1MS6A 3CBKA 1YK7A 2G8EA 1EWLA 4W5BA 4CDFB 4K7CA 4OEMA 2H7JA 2P7UA 3KWBX 5K16A 1YT7A 3DF0A 4P6EA 3K8UA 1MDWA 1F2CA 1DEUA 3RVXA 1JQPA 4RY2A 4YVAA 4BSQA 3C9EA 1PPPA 4XUIA 1SP4B 1NLJA 4I04A 3KW9A 1BY8A 1IWDA 3I3TA 2FRQA 2NQIA 2DJGB 4PP1A 3TNXA 4QRVA 5CVNB 1PBHA 2YJ9A 2R9OA 4BQVA 2HH5A 2PNSA 2FUDA 4Q8GA 4OELA 1CVZA 1SNKA 3KSEA 3I06A 3HD3A 3QJ3A 5F02A 1MHWA 2PREA 3F5VA 4FK5A 2DCDA 4QRXA 2FO5A 2CB5A 4MZOA 2R9FA 2OULA 4W5CA 1PIPA 1ME4A 2G6DA 4YYUA 1PPDA 3MHHA 1AECA 3PW3A 1PADA 2PADA 2VHSA 1S4VA 3V6CA 2YJCA 5A24A 1GECE 3WXEA 4X6JA 5CVMA 2DC8A 3BCNA 4AXLA 4I07A 1AU0A 2FYEA 2DCBA 1PPOA 4YYRA 3S3QA 2E01A 1XKGA 3OF9A 3MORA 1QDQA 3LXSA 2DC9A 1HUCB 2G8JA 2B1NA 3O0UA 1NQCA 1AU2A 2R9NA 2DC6A 1NB5A 3BPFA 3NHEA 1TL9A 1MEMA 2VHFA 1QXPA 4N79A 3WXFA 1POPA 4MSXA 4Q8HA 2B1MA
chains in the Genus database with same CATH superfamily
1KFXL 2PBHA 4HXDB 4P6GA 1U9WA 3KX1A 4X6IA 3K24A 1GCBA 4WA6A 3MP2A 2G7YA 2WBFX 4BS6A 1YZBA 3PHWA 2IPPB 1TU6A 3CBJA 4KLBA 4MI7A 3RVWA 4CZWA 2R9MA 4A5UA 4PP2E 2OZ2A 1ITOA 2DZYA 2XU3A 3BPMA 4FIPA 2GHUA 3OVXA 4QRGA 3RNVA 2AYNA 2DCAA 2YJ2A 5JH3A 4AXMA 4IP3A 3V6EA 3PRPA 3AI8A 2AUZA 3IOQA 9PAPA 5E6JA 1EWOA 2P86A 2CIOA 2AIMA 2F1GA 5CVOB 2DC7A 3H8CA 5EGWA 1FH0A 2HHNA 4DMYA 1GMYA 3LFYA 2HWKA 3PDFA 2JRIA 3OF8A 3BBAA 3PBHA 4YYSA 1QOLA 3CH2X 4N4ZA 4X6HA 2E03A 1ICFA 4BOQA 3IUTA 2ATOA 3PT2A 3USVA 1F2AA 1ZIVA 1PVJA 1PCIA 1CTEA 1KXRA 1PXVA 4CDEB 1KHPA 1PE6A 2FE8A 4N8WA 4OW0A 4CDDB 1EWPA 4WURA 3U8EA 8PCHA 1AYUA 1Q6KA 1CSBB 3GCBA 5CHVA 2E02A 1KHQA 4RF0A 1VSNA 1NL6A 1YVBA 3N3KA 4PADA 3RVVA 2Y5BA 2R9CA 4DMXA 2AS8A 4YYVA 1YK8A 3P5UA 3O1GA 2GFOA 4I05A 4D8IA 4YYQA 3BY4A 3HWNA 4FJCA 2YJ8A 1CJLA 3P5XA 1MIRA 1U9XA 4ZUXU 1U5IA 1ZCMA 3IEJA 5JZEA 4MM3B 3E9SA 4D8EA 4G54A 1YALA 2BTWB 3W30A 1AIMA 2DJFB 3BOWA 2XU1A 2HXZA 2Z84A 2JQGR 4QBBA 3M99A 1TLOA 7PCKA 3KWZA 1K3BB 3H7DA 3N3GA 2C0YA 2F7DA 4BOSA 3HHIA 4MZSA 3S3RA 2IBIA 3D6SA 3B21A 2R6NA 3H6SA 3BB7A 4XR7A 2FT2A 5EF4A 1DKIA 1KFUL 2ARYA 3HHAA 4YYWA 1DF0A 1AU4A 4GUAA 1QMYA 3ERVA 3P5WA 3KKUA 2BDLA 6PADA 1EWMA 2XU4A 2YJBA 4HWYA 4BPVA 3BWKA 1ATKA 1UKFA 2NQDB 3IMAA 1NB3A 1O0EA 3ZNHA 2XU5A 3IHPA 4OVZB 1M6DA 1AYWA 1U9QX 4BOZA 3E1ZB 3P5VA 4IUMA 2E00A 4CDCB 1THEA 5CHTA 3B79A 3MTNA 3IV2A 1CPJA 1Y08A 1F2BA 3QT4A 1VJVA 4RNAA 1EF7A 3F75A 1CV8A 1NPZA 1GLOA 4BS5A 1U9VA 5J94A 3TRKA 1PPNA 2JQFR 3W31A 1X9YA 5EZSA 2Y6EA 2DZZA 2AUXA 3OVZA 3C0RA 1BQIA 3ZUAA 3OISA 2JTCA 3PRMA 2NQAA 4QH6A 2O6XA 4PI3A 3PNRA 1BP4A 2HD5A 1A6RA 1STFE 1CB5A 5JA7A 3TMPA 3QSDA 4W4UA 1F29A 3WXGA 1BGOA 1ME3A 2NQGA 2UZJA 1AYVA 2FQ9A 2FTDA 1AU3A 5PADA 2OP3A 2AU1A 2ACTA 2AYOA 4R3DA 3BC3A 3H89A 1Y4HA 5FPWA 3H8BA 2P0RA 3KFQA 3N4CA 3MHSA 3PHUA 3CH3X 1CS8A 1MEGA 4YV8A 2DCCA 2FRAA 5EZQA 1CQDA 2BDZA 2AVWA 3K9MA 1MS6A 3CBKA 1YK7A 4BOPA 2G8EA 1EWLA 4W5BA 4CDFB 4K7CA 4OEMA 2H7JA 2P7UA 3KWBX 5K16A 1YT7A 2DOSA 2J7QA 3O65A 3DF0A 4P6EA 3PSEA 3K8UA 4PT5A 1MDWA 1F2CA 1DEUA 3RVXA 1JQPA 4M0WA 4RY2A 4YVAA 2BTWA 4D8BA 4BSQA 3C9EA 1PPPA 4XUIA 1SP4B 1NLJA 4I04A 3KW9A 1BY8A 4RKXA 1IWDA 3I3TA 2FRQA 2J7QC 2NQIA 2DJGB 4PP1A 3TNXA 4QRVA 5CVNB 1PBHA 2YJ9A 2R9OA 4BQVA 2HH5A 2PNSA 2FUDA 4Q8GA 4OELA 1CVZA 1SNKA 3KSEA 3I06A 3IFUA 3HD3A 4P16A 3QJ3A 5F02A 3PHXA 2BU3A 1MHWA 3MJ5A 4OVZA 2PREA 3F5VA 4FK5A 4RF1A 2DCDA 4QRXA 2FO5A 2CB5A 4MZOA 2R9FA 2OULA 4W5CA 1PIPA 1ME4A 2G6DA 4YYUA 1PPDA 3MHHA 4ZTBA 1AECA 3PW3A 1PADA 2PADA 2VHSA 1S4VA 3V6CA 2YJCA 5A24A 1GECE 3WXEA 4X6JA 5CVMA 2DC8A 3BCNA 4AXLA 4I07A 1AU0A 2FYEA 2DCBA 1PPOA 4BOUA 4YYRA 3S3QA 2E01A 4XZXA 1XKGA 3OF9A 3MORA 1QDQA 3LXSA 2DC9A 1HUCB 2G8JA 5KO3A 2B1NA 3O0UA 1NQCA 1AU2A 2R9NA 3MTVA 2DC6A 2AGAA 1NB5A 3BPFA 3NHEA 1TL9A 1MEMA 2VHFA 1QXPA 4N79A 4REZA 3WXFA 1POPA 3OQCA 4MSXA 4Q8HA 2B1MA
chains in the Genus database with same CATH topology
1KFXL 2PBHA 4P6GA 1U9WA 2BSZA 3KX1A 4X6IA 3K24A 1GCBA 4WA6A 2G7YA 2WBFX 4BS6A 2IPPB 1TU6A 3CBJA 4KLBA 3RVWA 4CZWA 2R9MA 4PP2E 2OZ2A 1ITOA 2DZYA 2XU3A 3BPMA 4FIPA 2GHUA 3OVXA 4QRGA 2AYNA 2DCAA 2YJ2A 5JH3A 4AXMA 3V6EA 3AI8A 2AUZA 3IOQA 9PAPA 1EWOA 2P86A 2CIOA 2AIMA 2F1GA 5CVOB 2DC7A 3H8CA 5EGWA 1FH0A 4C5PA 2HHNA 4DMYA 1GMYA 3LFYA 3PDFA 3OF8A 3PBHA 4YYSA 1QOLA 3CH2X 4N4ZA 4X6HA 2E03A 1ICFA 3IUTA 2ATOA 3USVA 1F2AA 1ZIVA 1W5RA 1PCIA 1CTEA 1KXRA 1PXVA 4CDEB 1KHPA 1PE6A 4N8WA 4CDDB 1EWPA 3U8EA 8PCHA 1AYUA 1GX3A 1Q6KA 1CSBB 3GCBA 4NV8A 2E02A 1KHQA 5CHVA 1VSNA 1NL6A 1YVBA 3N3KA 4PADA 3RVVA 2Y5BA 2R9CA 4DMXA 2AS8A 4YYVA 1YK8A 3P5UA 3O1GA 2GFOA 4I05A 4YYQA 3HWNA 4FJCA 2YJ8A 1CJLA 3P5XA 1MIRA 1U9XA 4ZUXU 1U5IA 1ZCMA 3IEJA 4G54A 1YALA 1AIMA 2DJFB 3BOWA 2XU1A 2HXZA 2JQGR 4QBBA 3M99A 1TLOA 7PCKA 3KWZA 1K3BB 3H7DA 3N3GA 2C0YA 2F7DA 3HHIA 4MZSA 3S3RA 2IBIA 3D6SA 4BGFA 2R6NA 3H6SA 4XR7A 2FT2A 5EF4A 1KFUL 2ARYA 3HHAA 4YYWA 1DF0A 1AU4A 1QMYA 3ERVA 3P5WA 3KKUA 2BDLA 6PADA 1EWMA 2XU4A 2YJBA 4HWYA 4BPVA 3BWKA 1ATKA 2NQDB 3IMAA 1NB3A 1O0EA 1W4TA 2XU5A 3IHPA 1M6DA 1AYWA 1U9QX 2VFCA 3E1ZB 3P5VA 1W6FA 2E00A 4CDCB 1THEA 5CHTA 3B79A 3MTNA 3IV2A 1E2TA 1CPJA 1Y08A 1F2BA 3QT4A 1VJVA 1EF7A 3F75A 1CV8A 1NPZA 1GLOA 4BS5A 1U9VA 5J94A 1PPNA 2JQFR 1X9YA 2Y6EA 2DZZA 2AUXA 3OVZA 1BQIA 2VFBA 3ZUAA 3OISA 4QH6A 2NQAA 2O6XA 4PI3A 3PNRA 1BP4A 2HD5A 1A6RA 1STFE 1CB5A 5JA7A 3QSDA 4W4UA 1F29A 3WXGA 1BGOA 1ME3A 2NQGA 1AYVA 2FQ9A 2FTDA 1AU3A 5PADA 2OP3A 2AU1A 2ACTA 2AYOA 3BC3A 3H89A 1Y4HA 5FPWA 3H8BA 2P0RA 3KFQA 3N4CA 3D9WA 3MHSA 3CH3X 1CS8A 1MEGA 4YV8A 2DCCA 2FRAA 1CQDA 2BDZA 2AVWA 3K9MA 1MS6A 3CBKA 1YK7A 2G8EA 1EWLA 4W5BA 4CDFB 4K7CA 4OEMA 2H7JA 2P7UA 3KWBX 5K16A 1YT7A 3DF0A 4P6EA 3K8UA 1MDWA 1F2CA 1DEUA 3RVXA 1JQPA 4RY2A 4YVAA 4NV7A 4BSQA 3C9EA 1PPPA 4XUIA 1SP4B 1NLJA 4I04A 3KW9A 1BY8A 1IWDA 3I3TA 2FRQA 2NQIA 2DJGB 4PP1A 3TNXA 4QRVA 5CVNB 1PBHA 2YJ9A 2R9OA 4BQVA 2HH5A 2PNSA 2FUDA 4Q8GA 4OELA 1CVZA 1SNKA 3LTWA 3KSEA 3I06A 3HD3A 3QJ3A 5F02A 1MHWA 2PREA 3F5VA 4FK5A 2DCDA 4QRXA 2FO5A 2CB5A 4MZOA 2R9FA 2OULA 4W5CA 1PIPA 1ME4A 2G6DA 4YYUA 1PPDA 3MHHA 1AECA 3PW3A 1PADA 2PADA 2VHSA 1S4VA 3V6CA 2YJCA 5A24A 1GECE 3WXEA 4X6JA 5CVMA 2DC8A 3BCNA 4AXLA 4I07A 1AU0A 2FYEA 2DCBA 1PPOA 4YYRA 3S3QA 2E01A 1XKGA 3OF9A 3MORA 1QDQA 3LXSA 2DC9A 1HUCB 2G8JA 2B1NA 4GUZA 3O0UA 1NQCA 1AU2A 2R9NA 2DC6A 1NB5A 3BPFA 3NHEA 1TL9A 4B55A 1MEMA 2VHFA 1QXPA 4N79A 3WXFA 1POPA 4MSXA 4Q8HA 2B1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KFX L;  2PBH A;  4P6G A;  1U9W A;  3KX1 A;  4X6I A;  3K24 A;  1GCB A;  4WA6 A;  2G7Y A;  2WBF X;  4BS6 A;  2IPP B;  1TU6 A;  3CBJ A;  4KLB A;  3RVW A;  4CZW A;  2R9M A;  4PP2 E;  2OZ2 A;  1ITO A;  2DZY A;  2XU3 A;  3BPM A;  4FIP A;  2GHU A;  3OVX A;  4QRG A;  2AYN A;  2DCA A;  2YJ2 A;  5JH3 A;  4AXM A;  3V6E A;  3AI8 A;  2AUZ A;  3IOQ A;  9PAP A;  1EWO A;  2P86 A;  2CIO A;  2AIM A;  2F1G A;  5CVO B;  2DC7 A;  3H8C A;  5EGW A;  1FH0 A;  2HHN A;  4DMY A;  1GMY A;  3LFY A;  3PDF A;  3OF8 A;  3PBH A;  4YYS A;  1QOL A;  3CH2 X;  4N4Z A;  4X6H A;  2E03 A;  1ICF A;  3IUT A;  2ATO A;  3USV A;  1F2A A;  1ZIV A;  1PCI A;  1CTE A;  1KXR A;  1PXV A;  4CDE B;  1KHP A;  1PE6 A;  4N8W A;  4CDD B;  1EWP A;  3U8E A;  8PCH A;  1AYU A;  1Q6K A;  1CSB B;  3GCB A;  5CHV A;  2E02 A;  1KHQ A;  1VSN A;  1NL6 A;  1YVB A;  3N3K A;  4PAD A;  3RVV A;  2Y5B A;  2R9C A;  4DMX A;  2AS8 A;  4YYV A;  1YK8 A;  3P5U A;  3O1G A;  2GFO A;  4I05 A;  4YYQ A;  3HWN A;  4FJC A;  2YJ8 A;  1CJL A;  3P5X A;  1MIR A;  1U9X A;  4ZUX U;  1U5I A;  1ZCM A;  3IEJ A;  4G54 A;  1YAL A;  1AIM A;  2DJF B;  3BOW A;  2XU1 A;  2HXZ A;  2JQG R;  4QBB A;  3M99 A;  1TLO A;  7PCK A;  3KWZ A;  1K3B B;  3H7D A;  3N3G A;  2C0Y A;  2F7D A;  3HHI A;  4MZS A;  3S3R A;  2IBI A;  3D6S A;  2R6N A;  3H6S A;  4XR7 A;  2FT2 A;  5EF4 A;  1KFU L;  2ARY A;  3HHA A;  4YYW A;  1DF0 A;  1AU4 A;  1QMY A;  3ERV A;  3P5W A;  3KKU A;  2BDL A;  6PAD A;  1EWM A;  2XU4 A;  2YJB A;  4HWY A;  4BPV A;  3BWK A;  1ATK A;  2NQD B;  3IMA A;  1NB3 A;  1O0E A;  2XU5 A;  3IHP A;  1M6D A;  1AYW A;  1U9Q X;  3E1Z B;  3P5V A;  2E00 A;  4CDC B;  1THE A;  5CHT A;  3B79 A;  3MTN A;  3IV2 A;  1CPJ A;  1Y08 A;  1F2B A;  3QT4 A;  1VJV A;  1EF7 A;  3F75 A;  1CV8 A;  1NPZ A;  1GLO A;  4BS5 A;  1U9V A;  5J94 A;  1PPN A;  2JQF R;  1X9Y A;  2Y6E A;  2DZZ A;  2AUX A;  3OVZ A;  1BQI A;  3ZUA A;  3OIS A;  4QH6 A;  2NQA A;  2O6X A;  4PI3 A;  3PNR A;  1BP4 A;  2HD5 A;  1A6R A;  1STF E;  1CB5 A;  5JA7 A;  3QSD A;  4W4U A;  1F29 A;  3WXG A;  1BGO A;  1ME3 A;  2NQG A;  1AYV A;  2FQ9 A;  2FTD A;  1AU3 A;  5PAD A;  2OP3 A;  2AU1 A;  2ACT A;  2AYO A;  3BC3 A;  3H89 A;  1Y4H A;  5FPW A;  3H8B A;  2P0R A;  3KFQ A;  3N4C A;  3MHS A;  3CH3 X;  1CS8 A;  1MEG A;  4YV8 A;  2DCC A;  2FRA A;  1CQD A;  2BDZ A;  2AVW A;  3K9M A;  1MS6 A;  3CBK A;  1YK7 A;  2G8E A;  1EWL A;  4W5B A;  4CDF B;  4K7C A;  4OEM A;  2H7J A;  2P7U A;  3KWB X;  5K16 A;  1YT7 A;  3DF0 A;  4P6E A;  3K8U A;  1MDW A;  1F2C A;  1DEU A;  3RVX A;  1JQP A;  4RY2 A;  4YVA A;  4BSQ A;  3C9E A;  1PPP A;  4XUI A;  1SP4 B;  1NLJ A;  4I04 A;  3KW9 A;  1BY8 A;  1IWD A;  3I3T A;  2FRQ A;  2NQI A;  2DJG B;  4PP1 A;  3TNX A;  4QRV A;  5CVN B;  1PBH A;  2YJ9 A;  2R9O A;  4BQV A;  2HH5 A;  2PNS A;  2FUD A;  4Q8G A;  4OEL A;  1CVZ A;  1SNK A;  3KSE A;  3I06 A;  3HD3 A;  3QJ3 A;  5F02 A;  1MHW A;  2PRE A;  3F5V A;  4FK5 A;  2DCD A;  4QRX A;  2FO5 A;  2CB5 A;  4MZO A;  2R9F A;  2OUL A;  4W5C A;  1PIP A;  1ME4 A;  2G6D A;  4YYU A;  1PPD A;  3MHH A;  1AEC A;  3PW3 A;  1PAD A;  2PAD A;  2VHS A;  1S4V A;  3V6C A;  2YJC A;  5A24 A;  1GEC E;  3WXE A;  4X6J A;  5CVM A;  2DC8 A;  3BCN A;  4AXL A;  4I07 A;  1AU0 A;  2FYE A;  2DCB A;  1PPO A;  4YYR A;  3S3Q A;  2E01 A;  1XKG A;  3OF9 A;  3MOR A;  1QDQ A;  3LXS A;  2DC9 A;  1HUC B;  2G8J A;  2B1N A;  3O0U A;  1NQC A;  1AU2 A;  2R9N A;  2DC6 A;  1NB5 A;  3BPF A;  3NHE A;  1TL9 A;  1MEM A;  2VHF A;  1QXP A;  4N79 A;  3WXF A;  1POP A;  4MSX A;  4Q8H A;  2B1M A; 
#chains in the Genus database with same CATH topology
 1KFX L;  2PBH A;  4HXD B;  4P6G A;  1U9W A;  3KX1 A;  4X6I A;  3K24 A;  1GCB A;  4WA6 A;  3MP2 A;  2G7Y A;  2WBF X;  4BS6 A;  1YZB A;  3PHW A;  2IPP B;  1TU6 A;  3CBJ A;  4KLB A;  4MI7 A;  3RVW A;  4CZW A;  2R9M A;  4A5U A;  4PP2 E;  2OZ2 A;  1ITO A;  2DZY A;  2XU3 A;  3BPM A;  4FIP A;  2GHU A;  3OVX A;  4QRG A;  3RNV A;  2AYN A;  2DCA A;  2YJ2 A;  5JH3 A;  4AXM A;  4IP3 A;  3V6E A;  3PRP A;  3AI8 A;  2AUZ A;  3IOQ A;  9PAP A;  5E6J A;  1EWO A;  2P86 A;  2CIO A;  2AIM A;  2F1G A;  5CVO B;  2DC7 A;  3H8C A;  5EGW A;  1FH0 A;  2HHN A;  4DMY A;  1GMY A;  3LFY A;  2HWK A;  3PDF A;  2JRI A;  3OF8 A;  3BBA A;  3PBH A;  4YYS A;  1QOL A;  3CH2 X;  4N4Z A;  4X6H A;  2E03 A;  1ICF A;  4BOQ A;  3IUT A;  2ATO A;  3PT2 A;  3USV A;  1F2A A;  1ZIV A;  1PVJ A;  1PCI A;  1CTE A;  1KXR A;  1PXV A;  4CDE B;  1KHP A;  1PE6 A;  2FE8 A;  4N8W A;  4OW0 A;  4CDD B;  1EWP A;  4WUR A;  3U8E A;  8PCH A;  1AYU A;  1Q6K A;  1CSB B;  3GCB A;  5CHV A;  2E02 A;  1KHQ A;  4RF0 A;  1VSN A;  1NL6 A;  1YVB A;  3N3K A;  4PAD A;  3RVV A;  2Y5B A;  2R9C A;  4DMX A;  2AS8 A;  4YYV A;  1YK8 A;  3P5U A;  3O1G A;  2GFO A;  4I05 A;  4D8I A;  4YYQ A;  3BY4 A;  3HWN A;  4FJC A;  2YJ8 A;  1CJL A;  3P5X A;  1MIR A;  1U9X A;  4ZUX U;  1U5I A;  1ZCM A;  3IEJ A;  5JZE A;  4MM3 B;  3E9S A;  4D8E A;  4G54 A;  1YAL A;  2BTW B;  3W30 A;  1AIM A;  2DJF B;  3BOW A;  2XU1 A;  2HXZ A;  2Z84 A;  2JQG R;  4QBB A;  3M99 A;  1TLO A;  7PCK A;  3KWZ A;  1K3B B;  3H7D A;  3N3G A;  2C0Y A;  2F7D A;  4BOS A;  3HHI A;  4MZS A;  3S3R A;  2IBI A;  3D6S A;  3B21 A;  2R6N A;  3H6S A;  3BB7 A;  4XR7 A;  2FT2 A;  5EF4 A;  1DKI A;  1KFU L;  2ARY A;  3HHA A;  4YYW A;  1DF0 A;  1AU4 A;  4GUA A;  1QMY A;  3ERV A;  3P5W A;  3KKU A;  2BDL A;  6PAD A;  1EWM A;  2XU4 A;  2YJB A;  4HWY A;  4BPV A;  3BWK A;  1ATK A;  1UKF A;  2NQD B;  3IMA A;  1NB3 A;  1O0E A;  3ZNH A;  2XU5 A;  3IHP A;  4OVZ B;  1M6D A;  1AYW A;  1U9Q X;  4BOZ A;  3E1Z B;  3P5V A;  4IUM A;  2E00 A;  4CDC B;  1THE A;  5CHT A;  3B79 A;  3MTN A;  3IV2 A;  1CPJ A;  1Y08 A;  1F2B A;  3QT4 A;  1VJV A;  4RNA A;  1EF7 A;  3F75 A;  1CV8 A;  1NPZ A;  1GLO A;  4BS5 A;  1U9V A;  5J94 A;  3TRK A;  1PPN A;  2JQF R;  3W31 A;  1X9Y A;  5EZS A;  2Y6E A;  2DZZ A;  2AUX A;  3OVZ A;  3C0R A;  1BQI A;  3ZUA A;  3OIS A;  2JTC A;  3PRM A;  2NQA A;  4QH6 A;  2O6X A;  4PI3 A;  3PNR A;  1BP4 A;  2HD5 A;  1A6R A;  1STF E;  1CB5 A;  5JA7 A;  3TMP A;  3QSD A;  4W4U A;  1F29 A;  3WXG A;  1BGO A;  1ME3 A;  2NQG A;  2UZJ A;  1AYV A;  2FQ9 A;  2FTD A;  1AU3 A;  5PAD A;  2OP3 A;  2AU1 A;  2ACT A;  2AYO A;  4R3D A;  3BC3 A;  3H89 A;  1Y4H A;  5FPW A;  3H8B A;  2P0R A;  3KFQ A;  3N4C A;  3MHS A;  3PHU A;  3CH3 X;  1CS8 A;  1MEG A;  4YV8 A;  2DCC A;  2FRA A;  5EZQ A;  1CQD A;  2BDZ A;  2AVW A;  3K9M A;  1MS6 A;  3CBK A;  1YK7 A;  4BOP A;  2G8E A;  1EWL A;  4W5B A;  4CDF B;  4K7C A;  4OEM A;  2H7J A;  2P7U A;  3KWB X;  5K16 A;  1YT7 A;  2DOS A;  2J7Q A;  3O65 A;  3DF0 A;  4P6E A;  3PSE A;  3K8U A;  4PT5 A;  1MDW A;  1F2C A;  1DEU A;  3RVX A;  1JQP A;  4M0W A;  4RY2 A;  4YVA A;  2BTW A;  4D8B A;  4BSQ A;  3C9E A;  1PPP A;  4XUI A;  1SP4 B;  1NLJ A;  4I04 A;  3KW9 A;  1BY8 A;  4RKX A;  1IWD A;  3I3T A;  2FRQ A;  2J7Q C;  2NQI A;  2DJG B;  4PP1 A;  3TNX A;  4QRV A;  5CVN B;  1PBH A;  2YJ9 A;  2R9O A;  4BQV A;  2HH5 A;  2PNS A;  2FUD A;  4Q8G A;  4OEL A;  1CVZ A;  1SNK A;  3KSE A;  3I06 A;  3IFU A;  3HD3 A;  4P16 A;  3QJ3 A;  5F02 A;  3PHX A;  2BU3 A;  1MHW A;  3MJ5 A;  4OVZ A;  2PRE A;  3F5V A;  4FK5 A;  4RF1 A;  2DCD A;  4QRX A;  2FO5 A;  2CB5 A;  4MZO A;  2R9F A;  2OUL A;  4W5C A;  1PIP A;  1ME4 A;  2G6D A;  4YYU A;  1PPD A;  3MHH A;  4ZTB A;  1AEC A;  3PW3 A;  1PAD A;  2PAD A;  2VHS A;  1S4V A;  3V6C A;  2YJC A;  5A24 A;  1GEC E;  3WXE A;  4X6J A;  5CVM A;  2DC8 A;  3BCN A;  4AXL A;  4I07 A;  1AU0 A;  2FYE A;  2DCB A;  1PPO A;  4BOU A;  4YYR A;  3S3Q A;  2E01 A;  4XZX A;  1XKG A;  3OF9 A;  3MOR A;  1QDQ A;  3LXS A;  2DC9 A;  1HUC B;  2G8J A;  5KO3 A;  2B1N A;  3O0U A;  1NQC A;  1AU2 A;  2R9N A;  3MTV A;  2DC6 A;  2AGA A;  1NB5 A;  3BPF A;  3NHE A;  1TL9 A;  1MEM A;  2VHF A;  1QXP A;  4N79 A;  4REZ A;  3WXF A;  1POP A;  3OQC A;  4MSX A;  4Q8H A;  2B1M A; 
#chains in the Genus database with same CATH homology
 1KFX L;  2PBH A;  4P6G A;  1U9W A;  2BSZ A;  3KX1 A;  4X6I A;  3K24 A;  1GCB A;  4WA6 A;  2G7Y A;  2WBF X;  4BS6 A;  2IPP B;  1TU6 A;  3CBJ A;  4KLB A;  3RVW A;  4CZW A;  2R9M A;  4PP2 E;  2OZ2 A;  1ITO A;  2DZY A;  2XU3 A;  3BPM A;  4FIP A;  2GHU A;  3OVX A;  4QRG A;  2AYN A;  2DCA A;  2YJ2 A;  5JH3 A;  4AXM A;  3V6E A;  3AI8 A;  2AUZ A;  3IOQ A;  9PAP A;  1EWO A;  2P86 A;  2CIO A;  2AIM A;  2F1G A;  5CVO B;  2DC7 A;  3H8C A;  5EGW A;  1FH0 A;  4C5P A;  2HHN A;  4DMY A;  1GMY A;  3LFY A;  3PDF A;  3OF8 A;  3PBH A;  4YYS A;  1QOL A;  3CH2 X;  4N4Z A;  4X6H A;  2E03 A;  1ICF A;  3IUT A;  2ATO A;  3USV A;  1F2A A;  1ZIV A;  1W5R A;  1PCI A;  1CTE A;  1KXR A;  1PXV A;  4CDE B;  1KHP A;  1PE6 A;  4N8W A;  4CDD B;  1EWP A;  3U8E A;  8PCH A;  1AYU A;  1GX3 A;  1Q6K A;  1CSB B;  3GCB A;  4NV8 A;  2E02 A;  1KHQ A;  5CHV A;  1VSN A;  1NL6 A;  1YVB A;  3N3K A;  4PAD A;  3RVV A;  2Y5B A;  2R9C A;  4DMX A;  2AS8 A;  4YYV A;  1YK8 A;  3P5U A;  3O1G A;  2GFO A;  4I05 A;  4YYQ A;  3HWN A;  4FJC A;  2YJ8 A;  1CJL A;  3P5X A;  1MIR A;  1U9X A;  4ZUX U;  1U5I A;  1ZCM A;  3IEJ A;  4G54 A;  1YAL A;  1AIM A;  2DJF B;  3BOW A;  2XU1 A;  2HXZ A;  2JQG R;  4QBB A;  3M99 A;  1TLO A;  7PCK A;  3KWZ A;  1K3B B;  3H7D A;  3N3G A;  2C0Y A;  2F7D A;  3HHI A;  4MZS A;  3S3R A;  2IBI A;  3D6S A;  4BGF A;  2R6N A;  3H6S A;  4XR7 A;  2FT2 A;  5EF4 A;  1KFU L;  2ARY A;  3HHA A;  4YYW A;  1DF0 A;  1AU4 A;  1QMY A;  3ERV A;  3P5W A;  3KKU A;  2BDL A;  6PAD A;  1EWM A;  2XU4 A;  2YJB A;  4HWY A;  4BPV A;  3BWK A;  1ATK A;  2NQD B;  3IMA A;  1NB3 A;  1O0E A;  1W4T A;  2XU5 A;  3IHP A;  1M6D A;  1AYW A;  1U9Q X;  2VFC A;  3E1Z B;  3P5V A;  1W6F A;  2E00 A;  4CDC B;  1THE A;  5CHT A;  3B79 A;  3MTN A;  3IV2 A;  1E2T A;  1CPJ A;  1Y08 A;  1F2B A;  3QT4 A;  1VJV A;  1EF7 A;  3F75 A;  1CV8 A;  1NPZ A;  1GLO A;  4BS5 A;  1U9V A;  5J94 A;  1PPN A;  2JQF R;  1X9Y A;  2Y6E A;  2DZZ A;  2AUX A;  3OVZ A;  1BQI A;  2VFB A;  3ZUA A;  3OIS A;  4QH6 A;  2NQA A;  2O6X A;  4PI3 A;  3PNR A;  1BP4 A;  2HD5 A;  1A6R A;  1STF E;  1CB5 A;  5JA7 A;  3QSD A;  4W4U A;  1F29 A;  3WXG A;  1BGO A;  1ME3 A;  2NQG A;  1AYV A;  2FQ9 A;  2FTD A;  1AU3 A;  5PAD A;  2OP3 A;  2AU1 A;  2ACT A;  2AYO A;  3BC3 A;  3H89 A;  1Y4H A;  5FPW A;  3H8B A;  2P0R A;  3KFQ A;  3N4C A;  3D9W A;  3MHS A;  3CH3 X;  1CS8 A;  1MEG A;  4YV8 A;  2DCC A;  2FRA A;  1CQD A;  2BDZ A;  2AVW A;  3K9M A;  1MS6 A;  3CBK A;  1YK7 A;  2G8E A;  1EWL A;  4W5B A;  4CDF B;  4K7C A;  4OEM A;  2H7J A;  2P7U A;  3KWB X;  5K16 A;  1YT7 A;  3DF0 A;  4P6E A;  3K8U A;  1MDW A;  1F2C A;  1DEU A;  3RVX A;  1JQP A;  4RY2 A;  4YVA A;  4NV7 A;  4BSQ A;  3C9E A;  1PPP A;  4XUI A;  1SP4 B;  1NLJ A;  4I04 A;  3KW9 A;  1BY8 A;  1IWD A;  3I3T A;  2FRQ A;  2NQI A;  2DJG B;  4PP1 A;  3TNX A;  4QRV A;  5CVN B;  1PBH A;  2YJ9 A;  2R9O A;  4BQV A;  2HH5 A;  2PNS A;  2FUD A;  4Q8G A;  4OEL A;  1CVZ A;  1SNK A;  3LTW A;  3KSE A;  3I06 A;  3HD3 A;  3QJ3 A;  5F02 A;  1MHW A;  2PRE A;  3F5V A;  4FK5 A;  2DCD A;  4QRX A;  2FO5 A;  2CB5 A;  4MZO A;  2R9F A;  2OUL A;  4W5C A;  1PIP A;  1ME4 A;  2G6D A;  4YYU A;  1PPD A;  3MHH A;  1AEC A;  3PW3 A;  1PAD A;  2PAD A;  2VHS A;  1S4V A;  3V6C A;  2YJC A;  5A24 A;  1GEC E;  3WXE A;  4X6J A;  5CVM A;  2DC8 A;  3BCN A;  4AXL A;  4I07 A;  1AU0 A;  2FYE A;  2DCB A;  1PPO A;  4YYR A;  3S3Q A;  2E01 A;  1XKG A;  3OF9 A;  3MOR A;  1QDQ A;  3LXS A;  2DC9 A;  1HUC B;  2G8J A;  2B1N A;  4GUZ A;  3O0U A;  1NQC A;  1AU2 A;  2R9N A;  2DC6 A;  1NB5 A;  3BPF A;  3NHE A;  1TL9 A;  4B55 A;  1MEM A;  2VHF A;  1QXP A;  4N79 A;  3WXF A;  1POP A;  4MSX A;  4Q8H A;  2B1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...