4QRXA

Crystal structure of pro-papain mutant at ph 4.0
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
304
structure length
292
Chain Sequence
ERLIQLFESWMLKHNKIYKNIDEKIYRFEIFKDNLKYIDETNKKNNSYWLGLNVFADMSNDEFKEKYTGSIAGNLSYDVNIPEYVDWRQKGAVTPVKNQGSCGSAWAFSAVSTIESIIKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIRNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords pro-papain
publication title Pro-peptide regulates the substrate specificity and zymogen activation process of papain: A structural and mechanistic insight
rcsb
source organism Carica papaya
molecule tags Hydrolase
total genus 95
structure length 292
sequence length 304
chains with identical sequence C
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 2014-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
A PF08246 Inhibitor_I29 Cathepsin propeptide inhibitor domain (I29)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4qrxA00
3KX1A 2NQDB 2IPPB 2XU3A 1NPZA 3KKUA 3IOQA 4PADA 4P6GA 3N4CA 5PADA 1PPDA 3K24A 4FK5A 3ZUAA 3CBKA 3CBJA 2DCAA 4PP1A 4YYQA 2ACTA 2NQGA 4I05A 4DMYA 4XR7A 5CHTA 2PNSA 2OZ2A 2E02A 2G8EA 4N4ZA 2OULA 1IWDA 5EF4A 3CH3X 1PPPA 1EWOA 4YYUA 1AYUA 5FPWA 4W5CA 3E1ZB 3B79A 5K16A 2PBHA 1NQCA 2GFOA 2PREA 3IHPA 3WXFA 1MEGA 1KHPA 1MEMA 4PP2E 2DZYA 2AS8A 4BS6A 2JQFR 4CDCB 3BWKA 2E03A 4OEMA 1QMYA 2BDZA 3P5UA 1ICFA 2FQ9A 1AYWA 2DJGB 3H6SA 2AYNA 2P7UA 1ME3A 1CTEA 2XU1A 1U9VA 2PADA 1HUCB 1CSBB 3HHAA 3NHEA 4W4UA 3BPFA 2GHUA 4YV8A 4Q8HA 3DF0A 2AVWA 3F5VA 2FTDA 1CB5A 4BQVA 3PBHA 2FRQA 1F2CA 2NQIA 3S3QA 1KFXL 1ATKA 2C0YA 1CS8A 4RY2A 5CVNB 1U9XA 1EWLA 2XU5A 4YYSA 4WA6A 2OP3A 4X6IA 4QRGA 3WXEA 3V6CA 1MS6A 3BCNA 1NLJA 3ERVA 1EF7A 1ZCMA 3MHSA 2NQAA 3P5VA 3PDFA 1TU6A 1QDQA 3N3GA 1F2BA 1ITOA 1CV8A 1SNKA 2YJCA 5A24A 3LXSA 1S4VA 3P5WA 4P6EA 4PI3A 1XKGA 1PADA 1AECA 4BSQA 2B1NA 1GCBA 1KFUL 1VSNA 1QOLA 1KHQA 1TL9A 3LFYA 1MIRA 2YJ2A 5CHVA 1Q6KA 4KLBA 3RVXA 1GECE 3IV2A 1F2AA 2R9OA 5EGWA 4MZSA 4DMXA 4I07A 4CDEB 3S3RA 3N3KA 2R9NA 1YT7A 1PE6A 3IUTA 2G7YA 1VJVA 2HD5A 2HHNA 2DC7A 1FH0A 3O1GA 2HH5A 3OVZA 2FO5A 1AU4A 1GMYA 1NB3A 1BQIA 3C9EA 3GCBA 4QRVA 1MHWA 2B1MA 1YVBA 1F29A 3QT4A 1AYVA 2FRAA 2FYEA 2XU4A 4AXLA 4FJCA 1STFE 3M99A 3F75A 1CPJA 1ZIVA 2R9FA 3D6SA 9PAPA 2DC6A 3HHIA 3IEJA 2FT2A 3BPMA 2ATOA 1PPOA 4QBBA 1TLOA 3KSEA 2YJBA 4YVAA 5CVOB 8PCHA 2AUXA 6PADA 3OF8A 3IMAA 3OVXA 3I06A 5J94A 3QSDA 3OF9A 5JA7A 4Q8GA 2DC9A 3PW3A 4N79A 4CZWA 3USVA 2O6XA 2DZZA 4AXMA 2F1GA 3MORA 1Y08A 1BP4A 4G54A 4HWYA 2VHSA 1X9YA 4X6JA 2E00A 4BPVA 1MDWA 1U9WA 1QXPA 1U5IA 2IBIA 3KWZA 4N8WA 1DEUA 1DF0A 3HWNA 3QJ3A 2YJ8A 1KXRA 1CVZA 2ARYA 3CH2X 5F02A 2Y5BA 2DJFB 1THEA 1AIMA 2DC8A 3P5XA 4MSXA 3BC3A 2F7DA 3I3TA 1U9QX 4MZOA 1ME4A 4OELA 3OISA 1PBHA 1A6RA 2CB5A 3MHHA 1YALA 3V6EA 1PPNA 2BDLA 1BGOA 4YYRA 3AI8A 3K9MA 1POPA 3K8UA 3H89A 2R6NA 4QH6A 4XUIA 3H8CA 4BS5A 4X6HA 2VHFA 3RVWA 4ZUXU 2Y6EA 1EWPA 1PIPA 2AU1A 1BY8A 1AU2A 1M6DA 4YYWA 2G6DA 3H8BA 2H7JA 3WXGA 5CVMA 2WBFX 4YYVA 4FIPA 1NL6A 2R9CA 3RVVA 3KFQA 2FUDA 1AU3A 1GLOA 1YK8A 2YJ9A 2JQGR 1AU0A 3MTNA 3U8EA 2P0RA 2AIMA 3KWBX 1CQDA 2G8JA 1SP4B 2AUZA 1CJLA 1K3BB 1EWMA 1O0EA 4I04A 1PXVA 4CDFB 2DCCA 2HXZA 7PCKA 1PCIA 3PNRA 1NB5A 1JQPA 2P86A 4W5BA 1YK7A 3KW9A 2DCBA 4K7CA 2CIOA 3HD3A 3TNXA 3O0UA 2R9MA 3H7DA 4QRXA 2E01A 2DCDA 1Y4HA 2AYOA 5JH3A 4CDDB 3BOWA
chains in the Genus database with same CATH superfamily
3KX1A 2NQDB 2IPPB 2XU3A 1NPZA 3KKUA 3IOQA 4PADA 4P6GA 3N4CA 4M0WA 5PADA 1PPDA 3K24A 4FK5A 3ZUAA 3CBKA 3CBJA 2DCAA 4PP1A 4YYQA 4BOUA 2ACTA 2NQGA 2Z84A 4I05A 4DMYA 3PHWA 4XR7A 5CHTA 2PNSA 2OZ2A 2E02A 2HWKA 2G8EA 4N4ZA 2OULA 1IWDA 5EF4A 3CH3X 1PPPA 1EWOA 4YYUA 1AYUA 5FPWA 4W5CA 3E1ZB 3B79A 4D8EA 5K16A 2PBHA 3PRMA 4A5UA 1NQCA 3W30A 2GFOA 2PREA 3IHPA 3WXFA 1MEGA 1KHPA 1MEMA 4PP2E 2DZYA 2AS8A 4BS6A 2JQFR 4CDCB 3BWKA 2E03A 4OEMA 1QMYA 2BDZA 3P5UA 1ICFA 2FQ9A 1AYWA 4D8IA 2DJGB 3H6SA 2AYNA 2JTCA 2P7UA 1ME3A 1CTEA 2XU1A 1U9VA 2PADA 1HUCB 1CSBB 3HHAA 3NHEA 4W4UA 3BPFA 2GHUA 4YV8A 4Q8HA 3DF0A 2AVWA 3F5VA 2FTDA 1CB5A 4BQVA 3PBHA 2FRQA 1F2CA 4XZXA 2NQIA 3S3QA 1KFXL 5EZSA 1ATKA 2BU3A 2C0YA 1CS8A 4RY2A 5CVNB 1U9XA 1EWLA 4BOPA 2XU5A 3E9SA 3PSEA 4YYSA 4WA6A 4ZTBA 4HXDB 2OP3A 4IUMA 4X6IA 4QRGA 4BOZA 3WXEA 3V6CA 1MS6A 3BCNA 1NLJA 3ERVA 1EF7A 4GUAA 1ZCMA 3MHSA 2NQAA 3P5VA 3PDFA 4R3DA 1TU6A 3BBAA 1QDQA 3N3GA 1F2BA 1ITOA 1CV8A 1SNKA 2YJCA 5A24A 3LXSA 1S4VA 3P5WA 4P6EA 4PI3A 4OVZB 3MJ5A 4D8BA 1XKGA 5JZEA 1PADA 1AECA 3RNVA 4BSQA 2B1NA 1GCBA 1KFUL 1VSNA 4RF0A 1QOLA 1KHQA 1TL9A 1YZBA 3LFYA 4RKXA 1MIRA 2YJ2A 5CHVA 1Q6KA 4KLBA 4MI7A 3RVXA 1GECE 2UZJA 3IV2A 1F2AA 2R9OA 4RF1A 5EGWA 4MZSA 4DMXA 4I07A 4CDEB 3S3RA 3N3KA 2R9NA 1YT7A 1PE6A 3IUTA 2G7YA 1VJVA 2HD5A 2HHNA 2DC7A 1FH0A 3O1GA 2HH5A 3OVZA 2FO5A 1AU4A 1GMYA 1NB3A 1BQIA 3C9EA 3GCBA 4QRVA 1MHWA 2B1MA 1YVBA 1F29A 3QT4A 1AYVA 2FRAA 2FYEA 2XU4A 4AXLA 4FJCA 1STFE 1DKIA 3M99A 3F75A 4P16A 1CPJA 1ZIVA 2R9FA 3D6SA 9PAPA 2DC6A 2BTWB 3HHIA 3IEJA 3TMPA 2JRIA 3PHXA 2FT2A 4PT5A 3BPMA 2ATOA 3MTVA 1PPOA 4QBBA 1TLOA 3KSEA 2YJBA 4YVAA 5CVOB 8PCHA 2AUXA 6PADA 3OF8A 3BY4A 3IMAA 3OVXA 3MP2A 3I06A 3PT2A 5J94A 3QSDA 3OF9A 5JA7A 4Q8GA 2DC9A 3PW3A 4N79A 4CZWA 3USVA 2O6XA 4BOQA 2DZZA 4AXMA 2F1GA 3MORA 3B21A 1Y08A 3C0RA 1BP4A 4G54A 4HWYA 2VHSA 3O65A 1X9YA 2J7QC 4X6JA 2E00A 3PRPA 4BPVA 5E6JA 1MDWA 1U9WA 1QXPA 1U5IA 3ZNHA 2IBIA 3KWZA 4OVZA 4N8WA 1DEUA 1DF0A 3HWNA 3QJ3A 2YJ8A 1KXRA 1CVZA 2ARYA 3CH2X 5F02A 2Y5BA 2DJFB 1THEA 4MM3B 1AIMA 2DC8A 3P5XA 4MSXA 3BC3A 2F7DA 3I3TA 1PVJA 1U9QX 4MZOA 1ME4A 2J7QA 4OELA 3TRKA 3OISA 1PBHA 1A6RA 2CB5A 3MHHA 1YALA 3V6EA 1PPNA 2BDLA 1BGOA 4YYRA 3AI8A 3K9MA 3IFUA 1POPA 3K8UA 3H89A 2R6NA 4QH6A 4XUIA 3H8CA 4BS5A 5KO3A 2AGAA 3BB7A 4X6HA 2VHFA 1UKFA 3RVWA 4ZUXU 2Y6EA 4REZA 1EWPA 1PIPA 2AU1A 1BY8A 1AU2A 1M6DA 4YYWA 2G6DA 3H8BA 2H7JA 3WXGA 5CVMA 2WBFX 4YYVA 4FIPA 1NL6A 2R9CA 3RVVA 3KFQA 2FUDA 1AU3A 1GLOA 1YK8A 2YJ9A 2JQGR 2BTWA 1AU0A 3MTNA 3U8EA 2P0RA 3W31A 2AIMA 3KWBX 1CQDA 3PHUA 2G8JA 1SP4B 2AUZA 2DOSA 1CJLA 1K3BB 1EWMA 1O0EA 4OW0A 4I04A 4RNAA 1PXVA 4CDFB 2DCCA 2HXZA 7PCKA 1PCIA 3PNRA 2FE8A 4IP3A 1NB5A 1JQPA 2P86A 4W5BA 1YK7A 3KW9A 4WURA 4BOSA 2DCBA 4K7CA 2CIOA 3HD3A 3TNXA 3O0UA 2R9MA 3H7DA 4QRXA 2E01A 5JH3A 2DCDA 1Y4HA 2AYOA 3OQCA 5EZQA 4CDDB 3BOWA
chains in the Genus database with same CATH topology
3KX1A 2NQDB 2IPPB 2XU3A 1NPZA 3KKUA 3IOQA 4PADA 4P6GA 3N4CA 5PADA 1PPDA 3K24A 4FK5A 3ZUAA 3CBKA 3CBJA 2DCAA 4PP1A 4YYQA 2ACTA 2NQGA 4I05A 4DMYA 4XR7A 5CHTA 2PNSA 2OZ2A 2E02A 2G8EA 4N4ZA 2OULA 1IWDA 5EF4A 3CH3X 1PPPA 1EWOA 4YYUA 1AYUA 5FPWA 4W5CA 3E1ZB 3B79A 4NV7A 5K16A 2PBHA 1NQCA 2GFOA 2PREA 3IHPA 3WXFA 1MEGA 1KHPA 1MEMA 4PP2E 2DZYA 2AS8A 4BS6A 2JQFR 4CDCB 3BWKA 2E03A 4OEMA 4NV8A 1QMYA 2BDZA 3P5UA 1ICFA 2FQ9A 1AYWA 2DJGB 3LTWA 3H6SA 2AYNA 2P7UA 1ME3A 1CTEA 2XU1A 1U9VA 2PADA 1HUCB 1CSBB 3HHAA 3NHEA 4W4UA 3BPFA 2GHUA 4YV8A 4Q8HA 3DF0A 2AVWA 2VFCA 3F5VA 2FTDA 1CB5A 4BQVA 3PBHA 2FRQA 1F2CA 2NQIA 3S3QA 1KFXL 1ATKA 2C0YA 1CS8A 4RY2A 5CVNB 1U9XA 1EWLA 2XU5A 4YYSA 4WA6A 2OP3A 4X6IA 4QRGA 4BGFA 3WXEA 3V6CA 1MS6A 3BCNA 1NLJA 3ERVA 1EF7A 1ZCMA 3MHSA 2NQAA 3P5VA 3PDFA 1TU6A 1QDQA 3N3GA 1F2BA 1ITOA 1CV8A 1SNKA 2YJCA 5A24A 1W5RA 3LXSA 1S4VA 3P5WA 4P6EA 4PI3A 1XKGA 1PADA 1AECA 4BSQA 2B1NA 1GCBA 1KFUL 1VSNA 1QOLA 1KHQA 1TL9A 3LFYA 1MIRA 2YJ2A 5CHVA 1Q6KA 4KLBA 3RVXA 1GECE 3IV2A 1F2AA 2R9OA 4GUZA 5EGWA 4MZSA 4DMXA 4I07A 4CDEB 3S3RA 3N3KA 2R9NA 1YT7A 1PE6A 3IUTA 2G7YA 1VJVA 2HD5A 2HHNA 2DC7A 1FH0A 3O1GA 2HH5A 3OVZA 2FO5A 1AU4A 1GMYA 1NB3A 1BQIA 3C9EA 3GCBA 4QRVA 1MHWA 2B1MA 1YVBA 1F29A 3QT4A 1AYVA 2FRAA 2FYEA 2XU4A 4AXLA 4FJCA 1STFE 3M99A 3F75A 1CPJA 1ZIVA 2R9FA 3D6SA 9PAPA 2DC6A 3HHIA 3IEJA 2FT2A 3BPMA 2ATOA 1PPOA 1GX3A 3D9WA 4QBBA 1TLOA 3KSEA 2YJBA 4YVAA 5CVOB 8PCHA 2AUXA 6PADA 3OF8A 1W6FA 3IMAA 3OVXA 3I06A 5J94A 3QSDA 3OF9A 4B55A 4Q8GA 5JA7A 2DC9A 3PW3A 4N79A 4CZWA 3USVA 2O6XA 2DZZA 4AXMA 2F1GA 3MORA 1Y08A 1BP4A 4G54A 4HWYA 2VHSA 1X9YA 4X6JA 2E00A 4BPVA 1MDWA 1U9WA 1QXPA 1U5IA 2IBIA 3KWZA 4N8WA 1DEUA 1DF0A 3HWNA 3QJ3A 2YJ8A 1KXRA 1CVZA 2ARYA 3CH2X 5F02A 2Y5BA 2DJFB 1THEA 1AIMA 2DC8A 3P5XA 4MSXA 3BC3A 2F7DA 3I3TA 1U9QX 4MZOA 1ME4A 4OELA 3OISA 1PBHA 1A6RA 2CB5A 3MHHA 1YALA 3V6EA 1PPNA 2BDLA 1BGOA 4YYRA 3AI8A 3K9MA 1POPA 3K8UA 3H89A 2R6NA 4QH6A 4XUIA 3H8CA 4BS5A 2BSZA 4X6HA 2VHFA 3RVWA 4ZUXU 2Y6EA 1EWPA 1PIPA 1E2TA 2AU1A 1BY8A 1AU2A 1M6DA 4YYWA 2G6DA 3H8BA 2H7JA 4C5PA 3WXGA 5CVMA 2VFBA 2WBFX 4YYVA 4FIPA 1NL6A 2R9CA 3RVVA 3KFQA 2FUDA 1AU3A 1GLOA 1YK8A 2YJ9A 2JQGR 1AU0A 3MTNA 3U8EA 2P0RA 2AIMA 3KWBX 1CQDA 2G8JA 1SP4B 2AUZA 1CJLA 1K3BB 1W4TA 1EWMA 1O0EA 4I04A 1PXVA 4CDFB 2DCCA 2HXZA 7PCKA 1PCIA 3PNRA 1NB5A 1JQPA 2P86A 4W5BA 1YK7A 3KW9A 2DCBA 4K7CA 2CIOA 3HD3A 3TNXA 3O0UA 2R9MA 3H7DA 4QRXA 2E01A 2DCDA 1Y4HA 2AYOA 5JH3A 4CDDB 3BOWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KX1 A;  2NQD B;  2IPP B;  2XU3 A;  1NPZ A;  3KKU A;  3IOQ A;  4PAD A;  4P6G A;  3N4C A;  5PAD A;  1PPD A;  3K24 A;  4FK5 A;  3ZUA A;  3CBK A;  3CBJ A;  2DCA A;  4PP1 A;  4YYQ A;  2ACT A;  2NQG A;  4I05 A;  4DMY A;  4XR7 A;  5CHT A;  2PNS A;  2OZ2 A;  2E02 A;  2G8E A;  4N4Z A;  2OUL A;  1IWD A;  5EF4 A;  3CH3 X;  1PPP A;  1EWO A;  4YYU A;  1AYU A;  5FPW A;  4W5C A;  3E1Z B;  3B79 A;  5K16 A;  2PBH A;  1NQC A;  2GFO A;  2PRE A;  3IHP A;  3WXF A;  1MEG A;  1KHP A;  1MEM A;  4PP2 E;  2DZY A;  2AS8 A;  4BS6 A;  2JQF R;  4CDC B;  3BWK A;  2E03 A;  4OEM A;  1QMY A;  2BDZ A;  3P5U A;  1ICF A;  2FQ9 A;  1AYW A;  2DJG B;  3H6S A;  2AYN A;  2P7U A;  1ME3 A;  1CTE A;  2XU1 A;  1U9V A;  2PAD A;  1HUC B;  1CSB B;  3HHA A;  3NHE A;  4W4U A;  3BPF A;  2GHU A;  4YV8 A;  4Q8H A;  3DF0 A;  2AVW A;  3F5V A;  2FTD A;  1CB5 A;  4BQV A;  3PBH A;  2FRQ A;  1F2C A;  2NQI A;  3S3Q A;  1KFX L;  1ATK A;  2C0Y A;  1CS8 A;  4RY2 A;  5CVN B;  1U9X A;  1EWL A;  2XU5 A;  4YYS A;  4WA6 A;  2OP3 A;  4X6I A;  4QRG A;  3WXE A;  3V6C A;  1MS6 A;  3BCN A;  1NLJ A;  3ERV A;  1EF7 A;  1ZCM A;  3MHS A;  2NQA A;  3P5V A;  3PDF A;  1TU6 A;  1QDQ A;  3N3G A;  1F2B A;  1ITO A;  1CV8 A;  1SNK A;  2YJC A;  5A24 A;  3LXS A;  1S4V A;  3P5W A;  4P6E A;  4PI3 A;  1XKG A;  1PAD A;  1AEC A;  4BSQ A;  2B1N A;  1GCB A;  1KFU L;  1VSN A;  1QOL A;  1KHQ A;  1TL9 A;  3LFY A;  1MIR A;  2YJ2 A;  5CHV A;  1Q6K A;  4KLB A;  3RVX A;  1GEC E;  3IV2 A;  1F2A A;  2R9O A;  5EGW A;  4MZS A;  4DMX A;  4I07 A;  4CDE B;  3S3R A;  3N3K A;  2R9N A;  1YT7 A;  1PE6 A;  3IUT A;  2G7Y A;  1VJV A;  2HD5 A;  2HHN A;  2DC7 A;  1FH0 A;  3O1G A;  2HH5 A;  3OVZ A;  2FO5 A;  1AU4 A;  1GMY A;  1NB3 A;  1BQI A;  3C9E A;  3GCB A;  4QRV A;  1MHW A;  2B1M A;  1YVB A;  1F29 A;  3QT4 A;  1AYV A;  2FRA A;  2FYE A;  2XU4 A;  4AXL A;  4FJC A;  1STF E;  3M99 A;  3F75 A;  1CPJ A;  1ZIV A;  2R9F A;  3D6S A;  9PAP A;  2DC6 A;  3HHI A;  3IEJ A;  2FT2 A;  3BPM A;  2ATO A;  1PPO A;  4QBB A;  1TLO A;  3KSE A;  2YJB A;  4YVA A;  5CVO B;  8PCH A;  2AUX A;  6PAD A;  3OF8 A;  3IMA A;  3OVX A;  3I06 A;  5J94 A;  3QSD A;  3OF9 A;  5JA7 A;  4Q8G A;  2DC9 A;  3PW3 A;  4N79 A;  4CZW A;  3USV A;  2O6X A;  2DZZ A;  4AXM A;  2F1G A;  3MOR A;  1Y08 A;  1BP4 A;  4G54 A;  4HWY A;  2VHS A;  1X9Y A;  4X6J A;  2E00 A;  4BPV A;  1MDW A;  1U9W A;  1QXP A;  1U5I A;  2IBI A;  3KWZ A;  4N8W A;  1DEU A;  1DF0 A;  3HWN A;  3QJ3 A;  2YJ8 A;  1KXR A;  1CVZ A;  2ARY A;  3CH2 X;  5F02 A;  2Y5B A;  2DJF B;  1THE A;  1AIM A;  2DC8 A;  3P5X A;  4MSX A;  3BC3 A;  2F7D A;  3I3T A;  1U9Q X;  4MZO A;  1ME4 A;  4OEL A;  3OIS A;  1PBH A;  1A6R A;  2CB5 A;  3MHH A;  1YAL A;  3V6E A;  1PPN A;  2BDL A;  1BGO A;  4YYR A;  3AI8 A;  3K9M A;  1POP A;  3K8U A;  3H89 A;  2R6N A;  4QH6 A;  4XUI A;  3H8C A;  4BS5 A;  4X6H A;  2VHF A;  3RVW A;  4ZUX U;  2Y6E A;  1EWP A;  1PIP A;  2AU1 A;  1BY8 A;  1AU2 A;  1M6D A;  4YYW A;  2G6D A;  3H8B A;  2H7J A;  3WXG A;  5CVM A;  2WBF X;  4YYV A;  4FIP A;  1NL6 A;  2R9C A;  3RVV A;  3KFQ A;  2FUD A;  1AU3 A;  1GLO A;  1YK8 A;  2YJ9 A;  2JQG R;  1AU0 A;  3MTN A;  3U8E A;  2P0R A;  2AIM A;  3KWB X;  1CQD A;  2G8J A;  1SP4 B;  2AUZ A;  1CJL A;  1K3B B;  1EWM A;  1O0E A;  4I04 A;  1PXV A;  4CDF B;  2DCC A;  2HXZ A;  7PCK A;  1PCI A;  3PNR A;  1NB5 A;  1JQP A;  2P86 A;  4W5B A;  1YK7 A;  3KW9 A;  2DCB A;  4K7C A;  2CIO A;  3HD3 A;  3TNX A;  3O0U A;  2R9M A;  3H7D A;  4QRX A;  2E01 A;  2DCD A;  1Y4H A;  2AYO A;  5JH3 A;  4CDD B;  3BOW A; 
#chains in the Genus database with same CATH topology
 3KX1 A;  2NQD B;  2IPP B;  2XU3 A;  1NPZ A;  3KKU A;  3IOQ A;  4PAD A;  4P6G A;  3N4C A;  4M0W A;  5PAD A;  1PPD A;  3K24 A;  4FK5 A;  3ZUA A;  3CBK A;  3CBJ A;  2DCA A;  4PP1 A;  4YYQ A;  4BOU A;  2ACT A;  2NQG A;  2Z84 A;  4I05 A;  4DMY A;  3PHW A;  4XR7 A;  5CHT A;  2PNS A;  2OZ2 A;  2E02 A;  2HWK A;  2G8E A;  4N4Z A;  2OUL A;  1IWD A;  5EF4 A;  3CH3 X;  1PPP A;  1EWO A;  4YYU A;  1AYU A;  5FPW A;  4W5C A;  3E1Z B;  3B79 A;  4D8E A;  5K16 A;  2PBH A;  3PRM A;  4A5U A;  1NQC A;  3W30 A;  2GFO A;  2PRE A;  3IHP A;  3WXF A;  1MEG A;  1KHP A;  1MEM A;  4PP2 E;  2DZY A;  2AS8 A;  4BS6 A;  2JQF R;  4CDC B;  3BWK A;  2E03 A;  4OEM A;  1QMY A;  2BDZ A;  3P5U A;  1ICF A;  2FQ9 A;  1AYW A;  4D8I A;  2DJG B;  3H6S A;  2AYN A;  2JTC A;  2P7U A;  1ME3 A;  1CTE A;  2XU1 A;  1U9V A;  2PAD A;  1HUC B;  1CSB B;  3HHA A;  3NHE A;  4W4U A;  3BPF A;  2GHU A;  4YV8 A;  4Q8H A;  3DF0 A;  2AVW A;  3F5V A;  2FTD A;  1CB5 A;  4BQV A;  3PBH A;  2FRQ A;  1F2C A;  4XZX A;  2NQI A;  3S3Q A;  1KFX L;  5EZS A;  1ATK A;  2BU3 A;  2C0Y A;  1CS8 A;  4RY2 A;  5CVN B;  1U9X A;  1EWL A;  4BOP A;  2XU5 A;  3E9S A;  3PSE A;  4YYS A;  4WA6 A;  4ZTB A;  4HXD B;  2OP3 A;  4IUM A;  4X6I A;  4QRG A;  4BOZ A;  3WXE A;  3V6C A;  1MS6 A;  3BCN A;  1NLJ A;  3ERV A;  1EF7 A;  4GUA A;  1ZCM A;  3MHS A;  2NQA A;  3P5V A;  3PDF A;  4R3D A;  1TU6 A;  3BBA A;  1QDQ A;  3N3G A;  1F2B A;  1ITO A;  1CV8 A;  1SNK A;  2YJC A;  5A24 A;  3LXS A;  1S4V A;  3P5W A;  4P6E A;  4PI3 A;  4OVZ B;  3MJ5 A;  4D8B A;  1XKG A;  5JZE A;  1PAD A;  1AEC A;  3RNV A;  4BSQ A;  2B1N A;  1GCB A;  1KFU L;  1VSN A;  4RF0 A;  1QOL A;  1KHQ A;  1TL9 A;  1YZB A;  3LFY A;  4RKX A;  1MIR A;  2YJ2 A;  5CHV A;  1Q6K A;  4KLB A;  4MI7 A;  3RVX A;  1GEC E;  2UZJ A;  3IV2 A;  1F2A A;  2R9O A;  4RF1 A;  5EGW A;  4MZS A;  4DMX A;  4I07 A;  4CDE B;  3S3R A;  3N3K A;  2R9N A;  1YT7 A;  1PE6 A;  3IUT A;  2G7Y A;  1VJV A;  2HD5 A;  2HHN A;  2DC7 A;  1FH0 A;  3O1G A;  2HH5 A;  3OVZ A;  2FO5 A;  1AU4 A;  1GMY A;  1NB3 A;  1BQI A;  3C9E A;  3GCB A;  4QRV A;  1MHW A;  2B1M A;  1YVB A;  1F29 A;  3QT4 A;  1AYV A;  2FRA A;  2FYE A;  2XU4 A;  4AXL A;  4FJC A;  1STF E;  1DKI A;  3M99 A;  3F75 A;  4P16 A;  1CPJ A;  1ZIV A;  2R9F A;  3D6S A;  9PAP A;  2DC6 A;  2BTW B;  3HHI A;  3IEJ A;  3TMP A;  2JRI A;  3PHX A;  2FT2 A;  4PT5 A;  3BPM A;  2ATO A;  3MTV A;  1PPO A;  4QBB A;  1TLO A;  3KSE A;  2YJB A;  4YVA A;  5CVO B;  8PCH A;  2AUX A;  6PAD A;  3OF8 A;  3BY4 A;  3IMA A;  3OVX A;  3MP2 A;  3I06 A;  3PT2 A;  5J94 A;  3QSD A;  3OF9 A;  5JA7 A;  4Q8G A;  2DC9 A;  3PW3 A;  4N79 A;  4CZW A;  3USV A;  2O6X A;  4BOQ A;  2DZZ A;  4AXM A;  2F1G A;  3MOR A;  3B21 A;  1Y08 A;  3C0R A;  1BP4 A;  4G54 A;  4HWY A;  2VHS A;  3O65 A;  1X9Y A;  2J7Q C;  4X6J A;  2E00 A;  3PRP A;  4BPV A;  5E6J A;  1MDW A;  1U9W A;  1QXP A;  1U5I A;  3ZNH A;  2IBI A;  3KWZ A;  4OVZ A;  4N8W A;  1DEU A;  1DF0 A;  3HWN A;  3QJ3 A;  2YJ8 A;  1KXR A;  1CVZ A;  2ARY A;  3CH2 X;  5F02 A;  2Y5B A;  2DJF B;  1THE A;  4MM3 B;  1AIM A;  2DC8 A;  3P5X A;  4MSX A;  3BC3 A;  2F7D A;  3I3T A;  1PVJ A;  1U9Q X;  4MZO A;  1ME4 A;  2J7Q A;  4OEL A;  3TRK A;  3OIS A;  1PBH A;  1A6R A;  2CB5 A;  3MHH A;  1YAL A;  3V6E A;  1PPN A;  2BDL A;  1BGO A;  4YYR A;  3AI8 A;  3K9M A;  3IFU A;  1POP A;  3K8U A;  3H89 A;  2R6N A;  4QH6 A;  4XUI A;  3H8C A;  4BS5 A;  5KO3 A;  2AGA A;  3BB7 A;  4X6H A;  2VHF A;  1UKF A;  3RVW A;  4ZUX U;  2Y6E A;  4REZ A;  1EWP A;  1PIP A;  2AU1 A;  1BY8 A;  1AU2 A;  1M6D A;  4YYW A;  2G6D A;  3H8B A;  2H7J A;  3WXG A;  5CVM A;  2WBF X;  4YYV A;  4FIP A;  1NL6 A;  2R9C A;  3RVV A;  3KFQ A;  2FUD A;  1AU3 A;  1GLO A;  1YK8 A;  2YJ9 A;  2JQG R;  2BTW A;  1AU0 A;  3MTN A;  3U8E A;  2P0R A;  3W31 A;  2AIM A;  3KWB X;  1CQD A;  3PHU A;  2G8J A;  1SP4 B;  2AUZ A;  2DOS A;  1CJL A;  1K3B B;  1EWM A;  1O0E A;  4OW0 A;  4I04 A;  4RNA A;  1PXV A;  4CDF B;  2DCC A;  2HXZ A;  7PCK A;  1PCI A;  3PNR A;  2FE8 A;  4IP3 A;  1NB5 A;  1JQP A;  2P86 A;  4W5B A;  1YK7 A;  3KW9 A;  4WUR A;  4BOS A;  2DCB A;  4K7C A;  2CIO A;  3HD3 A;  3TNX A;  3O0U A;  2R9M A;  3H7D A;  4QRX A;  2E01 A;  5JH3 A;  2DCD A;  1Y4H A;  2AYO A;  3OQC A;  5EZQ A;  4CDD B;  3BOW A; 
#chains in the Genus database with same CATH homology
 3KX1 A;  2NQD B;  2IPP B;  2XU3 A;  1NPZ A;  3KKU A;  3IOQ A;  4PAD A;  4P6G A;  3N4C A;  5PAD A;  1PPD A;  3K24 A;  4FK5 A;  3ZUA A;  3CBK A;  3CBJ A;  2DCA A;  4PP1 A;  4YYQ A;  2ACT A;  2NQG A;  4I05 A;  4DMY A;  4XR7 A;  5CHT A;  2PNS A;  2OZ2 A;  2E02 A;  2G8E A;  4N4Z A;  2OUL A;  1IWD A;  5EF4 A;  3CH3 X;  1PPP A;  1EWO A;  4YYU A;  1AYU A;  5FPW A;  4W5C A;  3E1Z B;  3B79 A;  4NV7 A;  5K16 A;  2PBH A;  1NQC A;  2GFO A;  2PRE A;  3IHP A;  3WXF A;  1MEG A;  1KHP A;  1MEM A;  4PP2 E;  2DZY A;  2AS8 A;  4BS6 A;  2JQF R;  4CDC B;  3BWK A;  2E03 A;  4OEM A;  4NV8 A;  1QMY A;  2BDZ A;  3P5U A;  1ICF A;  2FQ9 A;  1AYW A;  2DJG B;  3LTW A;  3H6S A;  2AYN A;  2P7U A;  1ME3 A;  1CTE A;  2XU1 A;  1U9V A;  2PAD A;  1HUC B;  1CSB B;  3HHA A;  3NHE A;  4W4U A;  3BPF A;  2GHU A;  4YV8 A;  4Q8H A;  3DF0 A;  2AVW A;  2VFC A;  3F5V A;  2FTD A;  1CB5 A;  4BQV A;  3PBH A;  2FRQ A;  1F2C A;  2NQI A;  3S3Q A;  1KFX L;  1ATK A;  2C0Y A;  1CS8 A;  4RY2 A;  5CVN B;  1U9X A;  1EWL A;  2XU5 A;  4YYS A;  4WA6 A;  2OP3 A;  4X6I A;  4QRG A;  4BGF A;  3WXE A;  3V6C A;  1MS6 A;  3BCN A;  1NLJ A;  3ERV A;  1EF7 A;  1ZCM A;  3MHS A;  2NQA A;  3P5V A;  3PDF A;  1TU6 A;  1QDQ A;  3N3G A;  1F2B A;  1ITO A;  1CV8 A;  1SNK A;  2YJC A;  5A24 A;  1W5R A;  3LXS A;  1S4V A;  3P5W A;  4P6E A;  4PI3 A;  1XKG A;  1PAD A;  1AEC A;  4BSQ A;  2B1N A;  1GCB A;  1KFU L;  1VSN A;  1QOL A;  1KHQ A;  1TL9 A;  3LFY A;  1MIR A;  2YJ2 A;  5CHV A;  1Q6K A;  4KLB A;  3RVX A;  1GEC E;  3IV2 A;  1F2A A;  2R9O A;  4GUZ A;  5EGW A;  4MZS A;  4DMX A;  4I07 A;  4CDE B;  3S3R A;  3N3K A;  2R9N A;  1YT7 A;  1PE6 A;  3IUT A;  2G7Y A;  1VJV A;  2HD5 A;  2HHN A;  2DC7 A;  1FH0 A;  3O1G A;  2HH5 A;  3OVZ A;  2FO5 A;  1AU4 A;  1GMY A;  1NB3 A;  1BQI A;  3C9E A;  3GCB A;  4QRV A;  1MHW A;  2B1M A;  1YVB A;  1F29 A;  3QT4 A;  1AYV A;  2FRA A;  2FYE A;  2XU4 A;  4AXL A;  4FJC A;  1STF E;  3M99 A;  3F75 A;  1CPJ A;  1ZIV A;  2R9F A;  3D6S A;  9PAP A;  2DC6 A;  3HHI A;  3IEJ A;  2FT2 A;  3BPM A;  2ATO A;  1PPO A;  1GX3 A;  3D9W A;  4QBB A;  1TLO A;  3KSE A;  2YJB A;  4YVA A;  5CVO B;  8PCH A;  2AUX A;  6PAD A;  3OF8 A;  1W6F A;  3IMA A;  3OVX A;  3I06 A;  5J94 A;  3QSD A;  3OF9 A;  4B55 A;  4Q8G A;  5JA7 A;  2DC9 A;  3PW3 A;  4N79 A;  4CZW A;  3USV A;  2O6X A;  2DZZ A;  4AXM A;  2F1G A;  3MOR A;  1Y08 A;  1BP4 A;  4G54 A;  4HWY A;  2VHS A;  1X9Y A;  4X6J A;  2E00 A;  4BPV A;  1MDW A;  1U9W A;  1QXP A;  1U5I A;  2IBI A;  3KWZ A;  4N8W A;  1DEU A;  1DF0 A;  3HWN A;  3QJ3 A;  2YJ8 A;  1KXR A;  1CVZ A;  2ARY A;  3CH2 X;  5F02 A;  2Y5B A;  2DJF B;  1THE A;  1AIM A;  2DC8 A;  3P5X A;  4MSX A;  3BC3 A;  2F7D A;  3I3T A;  1U9Q X;  4MZO A;  1ME4 A;  4OEL A;  3OIS A;  1PBH A;  1A6R A;  2CB5 A;  3MHH A;  1YAL A;  3V6E A;  1PPN A;  2BDL A;  1BGO A;  4YYR A;  3AI8 A;  3K9M A;  1POP A;  3K8U A;  3H89 A;  2R6N A;  4QH6 A;  4XUI A;  3H8C A;  4BS5 A;  2BSZ A;  4X6H A;  2VHF A;  3RVW A;  4ZUX U;  2Y6E A;  1EWP A;  1PIP A;  1E2T A;  2AU1 A;  1BY8 A;  1AU2 A;  1M6D A;  4YYW A;  2G6D A;  3H8B A;  2H7J A;  4C5P A;  3WXG A;  5CVM A;  2VFB A;  2WBF X;  4YYV A;  4FIP A;  1NL6 A;  2R9C A;  3RVV A;  3KFQ A;  2FUD A;  1AU3 A;  1GLO A;  1YK8 A;  2YJ9 A;  2JQG R;  1AU0 A;  3MTN A;  3U8E A;  2P0R A;  2AIM A;  3KWB X;  1CQD A;  2G8J A;  1SP4 B;  2AUZ A;  1CJL A;  1K3B B;  1W4T A;  1EWM A;  1O0E A;  4I04 A;  1PXV A;  4CDF B;  2DCC A;  2HXZ A;  7PCK A;  1PCI A;  3PNR A;  1NB5 A;  1JQP A;  2P86 A;  4W5B A;  1YK7 A;  3KW9 A;  2DCB A;  4K7C A;  2CIO A;  3HD3 A;  3TNX A;  3O0U A;  2R9M A;  3H7D A;  4QRX A;  2E01 A;  2DCD A;  1Y4H A;  2AYO A;  5JH3 A;  4CDD B;  3BOW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...