4QRXA

Crystal structure of pro-papain mutant at ph 4.0
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
304
structure length
292
Chain Sequence
ERLIQLFESWMLKHNKIYKNIDEKIYRFEIFKDNLKYIDETNKKNNSYWLGLNVFADMSNDEFKEKYTGSIAGNLSYDVNIPEYVDWRQKGAVTPVKNQGSCGSAWAFSAVSTIESIIKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIRNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pro-peptide regulates the substrate specificity and zymogen activation process of papain: A structural and mechanistic insight
rcsb
source organism Carica papaya
molecule tags Hydrolase
molecule keywords pro-papain
total genus 95
structure length 292
sequence length 304
chains with identical sequence C
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 2014-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
A PF08246 Inhibitor_I29 Cathepsin propeptide inhibitor domain (I29)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4qrxA00
3KSEA 2P0RA 2YJ8A 2HXZA 2Y5BA 2R9FA 5EGWA 3ERVA 2OP3A 4AXLA 5A24A 4XUIA 1QDQA 3DF0A 5F02A 4OEMA 2ARYA 3KKUA 2CB5A 3RVXA 1MS6A 4ZUXU 3I3TA 1F2CA 1PBHA 4CDEB 4X6JA 3RVWA 2XU3A 2H7JA 3E1ZB 3IUTA 5JH3A 1DEUA 4QRXA 2E03A 2R9MA 4XR7A 2HD5A 3OVZA 4YYUA 2AUZA 3V6CA 2FUDA 8PCHA 4CDFB 5EF4A 1ICFA 1THEA 1VJVA 1SP4B 5CHTA 3OISA 4RY2A 3K24A 4YYQA 4PP1A 1MIRA 1SNKA 1ME4A 4N8WA 2O6XA 3U8EA 2FYEA 3MHSA 2IBIA 2DC8A 1CVZA 2F1GA 4CZWA 4X6HA 1O0EA 1FH0A 4BQVA 3CH2X 1YT7A 2DZYA 3F75A 1CPJA 4I07A 2F7DA 3MTNA 2AVWA 1JQPA 2FT2A 4MSXA 2NQIA 4QH6A 4N4ZA 2E02A 2E00A 1QOLA 5FPWA 1AU0A 3WXEA 1HUCB 4I05A 4BS5A 4BSQA 4DMYA 4YVAA 2CIOA 3MORA 2GFOA 4FJCA 3N4CA 3CBJA 3GCBA 2DC6A 4FK5A 2AS8A 1ME3A 1Q6KA 3H7DA 3KFQA 2JQGR 2R9NA 2DCBA 1MEMA 1XKGA 1Y08A 5JA7A 2AYOA 3H8BA 3RVVA 9PAPA 3O0UA 4MZOA 2B1MA 1QMYA 3OF8A 1KXRA 1S4VA 1F2AA 2DCDA 5PADA 4HWYA 1M6DA 1AECA 4AXMA 1ITOA 2ACTA 1PCIA 1GMYA 7PCKA 1BGOA 3QT4A 4Q8HA 3AI8A 3P5UA 4P6EA 1GECE 2OULA 2YJCA 1YK8A 4N79A 4OELA 1POPA 6PADA 4I04A 1U9WA 1F2BA 2GHUA 2AIMA 1TU6A 2XU4A 2HHNA 5CVOB 1GCBA 3IMAA 2DJGB 1Y4HA 2JQFR 2R9OA 1QXPA 4QRGA 1NB5A 3WXGA 3P5VA 2PNSA 1YALA 1KFXL 1KFUL 1EWPA 3KWZA 3PNRA 3I06A 3S3QA 3N3GA 4BPVA 2FRAA 1U9XA 1EF7A 3PBHA 3D6SA 1AU3A 1MDWA 1PXVA 2BDZA 3BWKA 2DC7A 1AU2A 1TLOA 3ZUAA 4YYSA 2FRQA 1PPOA 2DCCA 4K7CA 4WA6A 1AYVA 1PPNA 1U9QX 3B79A 4W5BA 4PADA 2PREA 2HH5A 1PE6A 3O1GA 3CBKA 1AU4A 1NL6A 5CHVA 2XU1A 1CB5A 2B1NA 1AYWA 3HHIA 4Q8GA 1NB3A 1NPZA 2G8EA 1K3BB 4CDDB 4YV8A 3F5VA 1VSNA 3HHAA 3C9EA 2IPPB 3LFYA 1PPPA 4PI3A 4KLBA 2FTDA 3K8UA 3BPFA 3CH3X 3K9MA 2PADA 3HD3A 4YYVA 3PDFA 3H6SA 3P5WA 2AU1A 3M99A 4G54A 2DC9A 4QBBA 2G7YA 4BS6A 2R9CA 2BDLA 1NQCA 1EWLA 2NQGA 3QJ3A 1A6RA 1PPDA 4W5CA 3IHPA 1MEGA 3WXFA 2P7UA 1EWOA 1BY8A 3USVA 1PADA 3IV2A 4MZSA 3H8CA 3N3KA 1X9YA 1BP4A 3V6EA 3KWBX 3P5XA 5CVNB 3TNXA 2DJFB 2AYNA 3BOWA 5CVMA 1CV8A 2FO5A 2AUXA 2YJBA 4FIPA 2YJ9A 1F29A 3MHHA 2NQAA 1CS8A 2C0YA 4CDCB 3KW9A 1AYUA 2OZ2A 2XU5A 2VHSA 1PIPA 1GLOA 1YK7A 2G6DA 2FQ9A 4P6GA 1ZCMA 1MHWA 3QSDA 4DMXA 3OF9A 1U9VA 5J94A 3BC3A 3IOQA 3BPMA 2E01A 4QRVA 1BQIA 2G8JA 2Y6EA 1CJLA 4YYWA 2WBFX 3H89A 2DZZA 2PBHA 1STFE 1EWMA 3KX1A 2ATOA 2NQDB 1NLJA 4W4UA 1YVBA 3PW3A 3S3RA 4X6IA 1IWDA 2P86A 1U5IA 1ZIVA 1ATKA 1CSBB 1CTEA 3BCNA 2DCAA 3OVXA 1TL9A 5K16A 4YYRA 1KHPA 3LXSA 3IEJA 1AIMA 3HWNA 2VHFA 1DF0A 2YJ2A 1KHQA 1CQDA 3NHEA 2R6NA 4PP2E
chains in the Genus database with same CATH superfamily
3KSEA 3PHWA 3OQCA 4A5UA 2P0RA 2YJ8A 2HWKA 3C0RA 2HXZA 2Y5BA 2R9FA 5EGWA 2J7QC 3ERVA 3MP2A 2OP3A 4AXLA 5A24A 4XUIA 1QDQA 3DF0A 5F02A 4OEMA 4RNAA 2ARYA 3KKUA 2CB5A 3RVXA 1MS6A 4ZUXU 3I3TA 4M0WA 1F2CA 1PBHA 4CDEB 4X6JA 3RVWA 2XU3A 2H7JA 3E1ZB 3IUTA 5EZQA 5JH3A 1DEUA 4QRXA 2E03A 2R9MA 4XR7A 2HD5A 4BOQA 3OVZA 4YYUA 2AUZA 3V6CA 2FUDA 8PCHA 4CDFB 5EF4A 1ICFA 1THEA 4BOUA 1VJVA 1SP4B 4XZXA 5CHTA 3OISA 4RY2A 3K24A 4YYQA 4PP1A 1MIRA 1SNKA 1ME4A 4N8WA 2O6XA 4RF0A 3U8EA 2FYEA 3MHSA 2IBIA 2DC8A 1CVZA 2F1GA 4CZWA 2FE8A 1YZBA 4X6HA 1O0EA 2JRIA 1FH0A 4BQVA 1UKFA 3CH2X 1YT7A 2DZYA 3F75A 1CPJA 4I07A 2F7DA 3MTNA 2AVWA 4OVZA 3W31A 1JQPA 2FT2A 4MSXA 2NQIA 2BTWA 4QH6A 4N4ZA 5EZSA 3PRPA 2E02A 2E00A 1QOLA 5FPWA 1AU0A 3WXEA 1HUCB 4I05A 4BS5A 4ZTBA 4BSQA 4DMYA 4YVAA 4D8IA 2CIOA 3MORA 2GFOA 4FJCA 3N4CA 3CBJA 3GCBA 2DC6A 4FK5A 2AS8A 1ME3A 1Q6KA 3H7DA 3KFQA 4IUMA 2JQGR 2R9NA 2DCBA 1MEMA 1XKGA 1Y08A 5JA7A 2AYOA 3H8BA 4D8BA 3RVVA 9PAPA 3O0UA 4MZOA 2B1MA 1QMYA 3OF8A 1KXRA 1S4VA 1F2AA 2DCDA 5PADA 4HWYA 4D8EA 1M6DA 1AECA 3PHXA 4AXMA 1ITOA 2ACTA 1PCIA 1GMYA 7PCKA 1BGOA 3QT4A 4Q8HA 4IP3A 3AI8A 3P5UA 4P6EA 2J7QA 1GECE 4HXDB 2OULA 2YJCA 1YK8A 3B21A 4N79A 4OELA 1POPA 6PADA 4I04A 2Z84A 1U9WA 1F2BA 2GHUA 2AIMA 4RKXA 4BOZA 4REZA 1TU6A 2XU4A 2HHNA 5CVOB 1GCBA 3IMAA 2DJGB 2BU3A 1Y4HA 2JQFR 2R9OA 2JTCA 1QXPA 4R3DA 4QRGA 1NB5A 3WXGA 3P5VA 2PNSA 1YALA 1KFXL 1KFUL 1EWPA 2DOSA 3KWZA 3PNRA 4OVZB 2AGAA 3I06A 3S3QA 3N3GA 4BPVA 2FRAA 1U9XA 1EF7A 4PT5A 3PBHA 3W30A 3D6SA 1AU3A 1MDWA 1PXVA 2BDZA 3BWKA 2DC7A 1AU2A 1TLOA 3ZUAA 4YYSA 2FRQA 1PPOA 2DCCA 4K7CA 4WA6A 1AYVA 1PPNA 1U9QX 3B79A 4W5BA 4PADA 2PREA 2HH5A 1PE6A 3O1GA 3CBKA 1AU4A 1DKIA 1NL6A 5CHVA 2XU1A 1CB5A 2B1NA 5KO3A 1AYWA 3HHIA 4Q8GA 1NB3A 1NPZA 2G8EA 1K3BB 4CDDB 3ZNHA 4YV8A 3F5VA 1VSNA 3HHAA 3C9EA 2IPPB 3LFYA 1PPPA 4PI3A 3RNVA 4KLBA 2FTDA 3K8UA 3BPFA 3CH3X 3K9MA 2PADA 3HD3A 4YYVA 3PDFA 2UZJA 3H6SA 3P5WA 2AU1A 3M99A 4G54A 2DC9A 4QBBA 2G7YA 4BS6A 5E6JA 2R9CA 4MM3B 2BDLA 3E9SA 3PT2A 1NQCA 3TMPA 1EWLA 2NQGA 3QJ3A 1A6RA 1PPDA 4MI7A 4W5CA 3IHPA 1MEGA 3WXFA 2P7UA 1EWOA 1BY8A 3USVA 1PADA 3IV2A 4MZSA 3H8CA 3N3KA 4BOPA 1X9YA 1BP4A 3V6EA 3KWBX 3P5XA 3PHUA 5CVNB 3TNXA 2DJFB 2AYNA 3BOWA 5CVMA 1CV8A 2FO5A 2AUXA 2YJBA 4FIPA 4RF1A 2YJ9A 1F29A 3MHHA 2NQAA 1CS8A 2C0YA 4WURA 4CDCB 4BOSA 3KW9A 1AYUA 2OZ2A 2XU5A 2VHSA 1PIPA 1GLOA 1YK7A 2G6DA 2FQ9A 3BB7A 1PVJA 4P6GA 1ZCMA 1MHWA 3QSDA 3MTVA 4DMXA 3MJ5A 4P16A 3OF9A 1U9VA 4OW0A 5J94A 3BC3A 3IOQA 3BPMA 3PSEA 5JZEA 2E01A 4QRVA 1BQIA 3IFUA 2G8JA 2Y6EA 1CJLA 4YYWA 2WBFX 3H89A 3O65A 2DZZA 2PBHA 1STFE 1EWMA 3KX1A 2ATOA 2NQDB 1NLJA 4W4UA 3BBAA 1YVBA 3PW3A 3S3RA 4X6IA 1IWDA 2P86A 1U5IA 3BY4A 1ZIVA 1ATKA 1CSBB 1CTEA 2BTWB 4GUAA 3BCNA 2DCAA 3OVXA 1TL9A 3TRKA 5K16A 4YYRA 1KHPA 3LXSA 3IEJA 1AIMA 3HWNA 2VHFA 1DF0A 2YJ2A 3PRMA 1KHQA 1CQDA 3NHEA 2R6NA 4PP2E
chains in the Genus database with same CATH topology
3KSEA 2P0RA 2YJ8A 2HXZA 2Y5BA 2R9FA 5EGWA 3D9WA 3ERVA 2OP3A 4AXLA 5A24A 4XUIA 1QDQA 3DF0A 5F02A 4OEMA 2ARYA 3KKUA 2CB5A 3RVXA 1MS6A 4ZUXU 3I3TA 1F2CA 1PBHA 4CDEB 4X6JA 3RVWA 2XU3A 2H7JA 3E1ZB 3IUTA 5JH3A 1DEUA 1W4TA 4QRXA 2E03A 2R9MA 4XR7A 2HD5A 3OVZA 1W6FA 4YYUA 2AUZA 3V6CA 2FUDA 8PCHA 4CDFB 5EF4A 1ICFA 1THEA 1VJVA 1SP4B 5CHTA 3OISA 4RY2A 3K24A 4YYQA 4PP1A 1MIRA 1SNKA 1ME4A 4N8WA 2O6XA 3U8EA 2FYEA 3MHSA 2IBIA 2DC8A 1CVZA 2F1GA 4CZWA 4X6HA 1O0EA 1FH0A 4BQVA 3CH2X 1YT7A 2DZYA 3F75A 1CPJA 4I07A 2F7DA 3MTNA 2AVWA 4C5PA 4BGFA 1JQPA 2FT2A 4MSXA 2NQIA 4QH6A 4N4ZA 2E02A 2E00A 1QOLA 5FPWA 1AU0A 1E2TA 3WXEA 1HUCB 4I05A 4BS5A 4BSQA 4DMYA 4YVAA 2CIOA 3MORA 2GFOA 4FJCA 3N4CA 3CBJA 3GCBA 2DC6A 4FK5A 2AS8A 1ME3A 2BSZA 1Q6KA 3H7DA 3KFQA 3LTWA 2JQGR 2R9NA 2DCBA 1MEMA 1XKGA 1Y08A 5JA7A 2AYOA 3H8BA 3RVVA 9PAPA 3O0UA 4MZOA 2B1MA 1QMYA 3OF8A 1KXRA 1S4VA 1F2AA 2DCDA 5PADA 4HWYA 1M6DA 1AECA 4AXMA 1ITOA 2ACTA 1PCIA 1GMYA 7PCKA 1BGOA 3QT4A 4Q8HA 3AI8A 3P5UA 4P6EA 1GECE 2OULA 2YJCA 1YK8A 4N79A 4NV8A 4OELA 1POPA 6PADA 4I04A 1U9WA 1F2BA 2GHUA 2AIMA 1TU6A 2XU4A 2HHNA 5CVOB 1GCBA 3IMAA 2DJGB 1Y4HA 2JQFR 2R9OA 1QXPA 4QRGA 1NB5A 3WXGA 3P5VA 2PNSA 1YALA 1KFXL 1KFUL 1W5RA 1EWPA 3KWZA 3PNRA 3I06A 3S3QA 3N3GA 4BPVA 2FRAA 1U9XA 1EF7A 3PBHA 3D6SA 1AU3A 1MDWA 1PXVA 2BDZA 3BWKA 2DC7A 1AU2A 1TLOA 3ZUAA 4YYSA 4WA6A 2FRQA 1PPOA 2DCCA 4K7CA 1AYVA 1PPNA 1U9QX 3B79A 4W5BA 4PADA 2PREA 2HH5A 1PE6A 3O1GA 3CBKA 1AU4A 1NL6A 5CHVA 2VFBA 2XU1A 1CB5A 2B1NA 1AYWA 3HHIA 4Q8GA 1NB3A 1NPZA 2G8EA 1GX3A 1K3BB 4CDDB 4YV8A 3F5VA 1VSNA 3HHAA 4NV7A 3C9EA 2IPPB 3LFYA 1PPPA 4PI3A 4KLBA 2FTDA 3K8UA 3BPFA 3CH3X 3K9MA 2PADA 3HD3A 4YYVA 3PDFA 3H6SA 3P5WA 2AU1A 3M99A 4G54A 2DC9A 4QBBA 2G7YA 4BS6A 2R9CA 2BDLA 1NQCA 1EWLA 2NQGA 3QJ3A 1A6RA 1PPDA 4W5CA 3IHPA 1MEGA 3WXFA 2P7UA 1EWOA 1BY8A 3USVA 1PADA 3IV2A 4MZSA 3H8CA 3N3KA 1X9YA 1BP4A 3V6EA 3KWBX 3P5XA 5CVNB 3TNXA 2DJFB 2AYNA 3BOWA 5CVMA 1CV8A 4B55A 2FO5A 2AUXA 2YJBA 4FIPA 2YJ9A 1F29A 3MHHA 2NQAA 1CS8A 2C0YA 4CDCB 3KW9A 1AYUA 2OZ2A 2XU5A 2VHSA 1PIPA 1GLOA 1YK7A 2G6DA 2FQ9A 4P6GA 1ZCMA 1MHWA 3QSDA 4DMXA 3OF9A 1U9VA 5J94A 3BC3A 3IOQA 3BPMA 2E01A 4QRVA 1BQIA 2G8JA 2Y6EA 1CJLA 4YYWA 2WBFX 3H89A 2DZZA 2PBHA 1STFE 1EWMA 3KX1A 2ATOA 2NQDB 1NLJA 4W4UA 1YVBA 3PW3A 3S3RA 4X6IA 1IWDA 2P86A 1U5IA 1ZIVA 1ATKA 1CSBB 1CTEA 2VFCA 3BCNA 2DCAA 4GUZA 3OVXA 1TL9A 5K16A 4YYRA 1KHPA 3LXSA 3IEJA 1AIMA 3HWNA 2VHFA 1DF0A 2YJ2A 1KHQA 1CQDA 3NHEA 2R6NA 4PP2E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KSE A;  2P0R A;  2YJ8 A;  2HXZ A;  2Y5B A;  2R9F A;  5EGW A;  3ERV A;  2OP3 A;  4AXL A;  5A24 A;  4XUI A;  1QDQ A;  3DF0 A;  5F02 A;  4OEM A;  2ARY A;  3KKU A;  2CB5 A;  3RVX A;  1MS6 A;  4ZUX U;  3I3T A;  1F2C A;  1PBH A;  4CDE B;  4X6J A;  3RVW A;  2XU3 A;  2H7J A;  3E1Z B;  3IUT A;  5JH3 A;  1DEU A;  4QRX A;  2E03 A;  2R9M A;  4XR7 A;  2HD5 A;  3OVZ A;  4YYU A;  2AUZ A;  3V6C A;  2FUD A;  8PCH A;  4CDF B;  5EF4 A;  1ICF A;  1THE A;  1VJV A;  1SP4 B;  5CHT A;  3OIS A;  4RY2 A;  3K24 A;  4YYQ A;  4PP1 A;  1MIR A;  1SNK A;  1ME4 A;  4N8W A;  2O6X A;  3U8E A;  2FYE A;  3MHS A;  2IBI A;  2DC8 A;  1CVZ A;  2F1G A;  4CZW A;  4X6H A;  1O0E A;  1FH0 A;  4BQV A;  3CH2 X;  1YT7 A;  2DZY A;  3F75 A;  1CPJ A;  4I07 A;  2F7D A;  3MTN A;  2AVW A;  1JQP A;  2FT2 A;  4MSX A;  2NQI A;  4QH6 A;  4N4Z A;  2E02 A;  2E00 A;  1QOL A;  5FPW A;  1AU0 A;  3WXE A;  1HUC B;  4I05 A;  4BS5 A;  4BSQ A;  4DMY A;  4YVA A;  2CIO A;  3MOR A;  2GFO A;  4FJC A;  3N4C A;  3CBJ A;  3GCB A;  2DC6 A;  4FK5 A;  2AS8 A;  1ME3 A;  1Q6K A;  3H7D A;  3KFQ A;  2JQG R;  2R9N A;  2DCB A;  1MEM A;  1XKG A;  1Y08 A;  5JA7 A;  2AYO A;  3H8B A;  3RVV A;  9PAP A;  3O0U A;  4MZO A;  2B1M A;  1QMY A;  3OF8 A;  1KXR A;  1S4V A;  1F2A A;  2DCD A;  5PAD A;  4HWY A;  1M6D A;  1AEC A;  4AXM A;  1ITO A;  2ACT A;  1PCI A;  1GMY A;  7PCK A;  1BGO A;  3QT4 A;  4Q8H A;  3AI8 A;  3P5U A;  4P6E A;  1GEC E;  2OUL A;  2YJC A;  1YK8 A;  4N79 A;  4OEL A;  1POP A;  6PAD A;  4I04 A;  1U9W A;  1F2B A;  2GHU A;  2AIM A;  1TU6 A;  2XU4 A;  2HHN A;  5CVO B;  1GCB A;  3IMA A;  2DJG B;  1Y4H A;  2JQF R;  2R9O A;  1QXP A;  4QRG A;  1NB5 A;  3WXG A;  3P5V A;  2PNS A;  1YAL A;  1KFX L;  1KFU L;  1EWP A;  3KWZ A;  3PNR A;  3I06 A;  3S3Q A;  3N3G A;  4BPV A;  2FRA A;  1U9X A;  1EF7 A;  3PBH A;  3D6S A;  1AU3 A;  1MDW A;  1PXV A;  2BDZ A;  3BWK A;  2DC7 A;  1AU2 A;  1TLO A;  3ZUA A;  4YYS A;  2FRQ A;  1PPO A;  2DCC A;  4K7C A;  4WA6 A;  1AYV A;  1PPN A;  1U9Q X;  3B79 A;  4W5B A;  4PAD A;  2PRE A;  2HH5 A;  1PE6 A;  3O1G A;  3CBK A;  1AU4 A;  1NL6 A;  5CHV A;  2XU1 A;  1CB5 A;  2B1N A;  1AYW A;  3HHI A;  4Q8G A;  1NB3 A;  1NPZ A;  2G8E A;  1K3B B;  4CDD B;  4YV8 A;  3F5V A;  1VSN A;  3HHA A;  3C9E A;  2IPP B;  3LFY A;  1PPP A;  4PI3 A;  4KLB A;  2FTD A;  3K8U A;  3BPF A;  3CH3 X;  3K9M A;  2PAD A;  3HD3 A;  4YYV A;  3PDF A;  3H6S A;  3P5W A;  2AU1 A;  3M99 A;  4G54 A;  2DC9 A;  4QBB A;  2G7Y A;  4BS6 A;  2R9C A;  2BDL A;  1NQC A;  1EWL A;  2NQG A;  3QJ3 A;  1A6R A;  1PPD A;  4W5C A;  3IHP A;  1MEG A;  3WXF A;  2P7U A;  1EWO A;  1BY8 A;  3USV A;  1PAD A;  3IV2 A;  4MZS A;  3H8C A;  3N3K A;  1X9Y A;  1BP4 A;  3V6E A;  3KWB X;  3P5X A;  5CVN B;  3TNX A;  2DJF B;  2AYN A;  3BOW A;  5CVM A;  1CV8 A;  2FO5 A;  2AUX A;  2YJB A;  4FIP A;  2YJ9 A;  1F29 A;  3MHH A;  2NQA A;  1CS8 A;  2C0Y A;  4CDC B;  3KW9 A;  1AYU A;  2OZ2 A;  2XU5 A;  2VHS A;  1PIP A;  1GLO A;  1YK7 A;  2G6D A;  2FQ9 A;  4P6G A;  1ZCM A;  1MHW A;  3QSD A;  4DMX A;  3OF9 A;  1U9V A;  5J94 A;  3BC3 A;  3IOQ A;  3BPM A;  2E01 A;  4QRV A;  1BQI A;  2G8J A;  2Y6E A;  1CJL A;  4YYW A;  2WBF X;  3H89 A;  2DZZ A;  2PBH A;  1STF E;  1EWM A;  3KX1 A;  2ATO A;  2NQD B;  1NLJ A;  4W4U A;  1YVB A;  3PW3 A;  3S3R A;  4X6I A;  1IWD A;  2P86 A;  1U5I A;  1ZIV A;  1ATK A;  1CSB B;  1CTE A;  3BCN A;  2DCA A;  3OVX A;  1TL9 A;  5K16 A;  4YYR A;  1KHP A;  3LXS A;  3IEJ A;  1AIM A;  3HWN A;  2VHF A;  1DF0 A;  2YJ2 A;  1KHQ A;  1CQD A;  3NHE A;  2R6N A;  4PP2 E; 
#chains in the Genus database with same CATH topology
 3KSE A;  3PHW A;  3OQC A;  4A5U A;  2P0R A;  2YJ8 A;  2HWK A;  3C0R A;  2HXZ A;  2Y5B A;  2R9F A;  5EGW A;  2J7Q C;  3ERV A;  3MP2 A;  2OP3 A;  4AXL A;  5A24 A;  4XUI A;  1QDQ A;  3DF0 A;  5F02 A;  4OEM A;  4RNA A;  2ARY A;  3KKU A;  2CB5 A;  3RVX A;  1MS6 A;  4ZUX U;  3I3T A;  4M0W A;  1F2C A;  1PBH A;  4CDE B;  4X6J A;  3RVW A;  2XU3 A;  2H7J A;  3E1Z B;  3IUT A;  5EZQ A;  5JH3 A;  1DEU A;  4QRX A;  2E03 A;  2R9M A;  4XR7 A;  2HD5 A;  4BOQ A;  3OVZ A;  4YYU A;  2AUZ A;  3V6C A;  2FUD A;  8PCH A;  4CDF B;  5EF4 A;  1ICF A;  1THE A;  4BOU A;  1VJV A;  1SP4 B;  4XZX A;  5CHT A;  3OIS A;  4RY2 A;  3K24 A;  4YYQ A;  4PP1 A;  1MIR A;  1SNK A;  1ME4 A;  4N8W A;  2O6X A;  4RF0 A;  3U8E A;  2FYE A;  3MHS A;  2IBI A;  2DC8 A;  1CVZ A;  2F1G A;  4CZW A;  2FE8 A;  1YZB A;  4X6H A;  1O0E A;  2JRI A;  1FH0 A;  4BQV A;  1UKF A;  3CH2 X;  1YT7 A;  2DZY A;  3F75 A;  1CPJ A;  4I07 A;  2F7D A;  3MTN A;  2AVW A;  4OVZ A;  3W31 A;  1JQP A;  2FT2 A;  4MSX A;  2NQI A;  2BTW A;  4QH6 A;  4N4Z A;  5EZS A;  3PRP A;  2E02 A;  2E00 A;  1QOL A;  5FPW A;  1AU0 A;  3WXE A;  1HUC B;  4I05 A;  4BS5 A;  4ZTB A;  4BSQ A;  4DMY A;  4YVA A;  4D8I A;  2CIO A;  3MOR A;  2GFO A;  4FJC A;  3N4C A;  3CBJ A;  3GCB A;  2DC6 A;  4FK5 A;  2AS8 A;  1ME3 A;  1Q6K A;  3H7D A;  3KFQ A;  4IUM A;  2JQG R;  2R9N A;  2DCB A;  1MEM A;  1XKG A;  1Y08 A;  5JA7 A;  2AYO A;  3H8B A;  4D8B A;  3RVV A;  9PAP A;  3O0U A;  4MZO A;  2B1M A;  1QMY A;  3OF8 A;  1KXR A;  1S4V A;  1F2A A;  2DCD A;  5PAD A;  4HWY A;  4D8E A;  1M6D A;  1AEC A;  3PHX A;  4AXM A;  1ITO A;  2ACT A;  1PCI A;  1GMY A;  7PCK A;  1BGO A;  3QT4 A;  4Q8H A;  4IP3 A;  3AI8 A;  3P5U A;  4P6E A;  2J7Q A;  1GEC E;  4HXD B;  2OUL A;  2YJC A;  1YK8 A;  3B21 A;  4N79 A;  4OEL A;  1POP A;  6PAD A;  4I04 A;  2Z84 A;  1U9W A;  1F2B A;  2GHU A;  2AIM A;  4RKX A;  4BOZ A;  4REZ A;  1TU6 A;  2XU4 A;  2HHN A;  5CVO B;  1GCB A;  3IMA A;  2DJG B;  2BU3 A;  1Y4H A;  2JQF R;  2R9O A;  2JTC A;  1QXP A;  4R3D A;  4QRG A;  1NB5 A;  3WXG A;  3P5V A;  2PNS A;  1YAL A;  1KFX L;  1KFU L;  1EWP A;  2DOS A;  3KWZ A;  3PNR A;  4OVZ B;  2AGA A;  3I06 A;  3S3Q A;  3N3G A;  4BPV A;  2FRA A;  1U9X A;  1EF7 A;  4PT5 A;  3PBH A;  3W30 A;  3D6S A;  1AU3 A;  1MDW A;  1PXV A;  2BDZ A;  3BWK A;  2DC7 A;  1AU2 A;  1TLO A;  3ZUA A;  4YYS A;  2FRQ A;  1PPO A;  2DCC A;  4K7C A;  4WA6 A;  1AYV A;  1PPN A;  1U9Q X;  3B79 A;  4W5B A;  4PAD A;  2PRE A;  2HH5 A;  1PE6 A;  3O1G A;  3CBK A;  1AU4 A;  1DKI A;  1NL6 A;  5CHV A;  2XU1 A;  1CB5 A;  2B1N A;  5KO3 A;  1AYW A;  3HHI A;  4Q8G A;  1NB3 A;  1NPZ A;  2G8E A;  1K3B B;  4CDD B;  3ZNH A;  4YV8 A;  3F5V A;  1VSN A;  3HHA A;  3C9E A;  2IPP B;  3LFY A;  1PPP A;  4PI3 A;  3RNV A;  4KLB A;  2FTD A;  3K8U A;  3BPF A;  3CH3 X;  3K9M A;  2PAD A;  3HD3 A;  4YYV A;  3PDF A;  2UZJ A;  3H6S A;  3P5W A;  2AU1 A;  3M99 A;  4G54 A;  2DC9 A;  4QBB A;  2G7Y A;  4BS6 A;  5E6J A;  2R9C A;  4MM3 B;  2BDL A;  3E9S A;  3PT2 A;  1NQC A;  3TMP A;  1EWL A;  2NQG A;  3QJ3 A;  1A6R A;  1PPD A;  4MI7 A;  4W5C A;  3IHP A;  1MEG A;  3WXF A;  2P7U A;  1EWO A;  1BY8 A;  3USV A;  1PAD A;  3IV2 A;  4MZS A;  3H8C A;  3N3K A;  4BOP A;  1X9Y A;  1BP4 A;  3V6E A;  3KWB X;  3P5X A;  3PHU A;  5CVN B;  3TNX A;  2DJF B;  2AYN A;  3BOW A;  5CVM A;  1CV8 A;  2FO5 A;  2AUX A;  2YJB A;  4FIP A;  4RF1 A;  2YJ9 A;  1F29 A;  3MHH A;  2NQA A;  1CS8 A;  2C0Y A;  4WUR A;  4CDC B;  4BOS A;  3KW9 A;  1AYU A;  2OZ2 A;  2XU5 A;  2VHS A;  1PIP A;  1GLO A;  1YK7 A;  2G6D A;  2FQ9 A;  3BB7 A;  1PVJ A;  4P6G A;  1ZCM A;  1MHW A;  3QSD A;  3MTV A;  4DMX A;  3MJ5 A;  4P16 A;  3OF9 A;  1U9V A;  4OW0 A;  5J94 A;  3BC3 A;  3IOQ A;  3BPM A;  3PSE A;  5JZE A;  2E01 A;  4QRV A;  1BQI A;  3IFU A;  2G8J A;  2Y6E A;  1CJL A;  4YYW A;  2WBF X;  3H89 A;  3O65 A;  2DZZ A;  2PBH A;  1STF E;  1EWM A;  3KX1 A;  2ATO A;  2NQD B;  1NLJ A;  4W4U A;  3BBA A;  1YVB A;  3PW3 A;  3S3R A;  4X6I A;  1IWD A;  2P86 A;  1U5I A;  3BY4 A;  1ZIV A;  1ATK A;  1CSB B;  1CTE A;  2BTW B;  4GUA A;  3BCN A;  2DCA A;  3OVX A;  1TL9 A;  3TRK A;  5K16 A;  4YYR A;  1KHP A;  3LXS A;  3IEJ A;  1AIM A;  3HWN A;  2VHF A;  1DF0 A;  2YJ2 A;  3PRM A;  1KHQ A;  1CQD A;  3NHE A;  2R6N A;  4PP2 E; 
#chains in the Genus database with same CATH homology
 3KSE A;  2P0R A;  2YJ8 A;  2HXZ A;  2Y5B A;  2R9F A;  5EGW A;  3D9W A;  3ERV A;  2OP3 A;  4AXL A;  5A24 A;  4XUI A;  1QDQ A;  3DF0 A;  5F02 A;  4OEM A;  2ARY A;  3KKU A;  2CB5 A;  3RVX A;  1MS6 A;  4ZUX U;  3I3T A;  1F2C A;  1PBH A;  4CDE B;  4X6J A;  3RVW A;  2XU3 A;  2H7J A;  3E1Z B;  3IUT A;  5JH3 A;  1DEU A;  1W4T A;  4QRX A;  2E03 A;  2R9M A;  4XR7 A;  2HD5 A;  3OVZ A;  1W6F A;  4YYU A;  2AUZ A;  3V6C A;  2FUD A;  8PCH A;  4CDF B;  5EF4 A;  1ICF A;  1THE A;  1VJV A;  1SP4 B;  5CHT A;  3OIS A;  4RY2 A;  3K24 A;  4YYQ A;  4PP1 A;  1MIR A;  1SNK A;  1ME4 A;  4N8W A;  2O6X A;  3U8E A;  2FYE A;  3MHS A;  2IBI A;  2DC8 A;  1CVZ A;  2F1G A;  4CZW A;  4X6H A;  1O0E A;  1FH0 A;  4BQV A;  3CH2 X;  1YT7 A;  2DZY A;  3F75 A;  1CPJ A;  4I07 A;  2F7D A;  3MTN A;  2AVW A;  4C5P A;  4BGF A;  1JQP A;  2FT2 A;  4MSX A;  2NQI A;  4QH6 A;  4N4Z A;  2E02 A;  2E00 A;  1QOL A;  5FPW A;  1AU0 A;  1E2T A;  3WXE A;  1HUC B;  4I05 A;  4BS5 A;  4BSQ A;  4DMY A;  4YVA A;  2CIO A;  3MOR A;  2GFO A;  4FJC A;  3N4C A;  3CBJ A;  3GCB A;  2DC6 A;  4FK5 A;  2AS8 A;  1ME3 A;  2BSZ A;  1Q6K A;  3H7D A;  3KFQ A;  3LTW A;  2JQG R;  2R9N A;  2DCB A;  1MEM A;  1XKG A;  1Y08 A;  5JA7 A;  2AYO A;  3H8B A;  3RVV A;  9PAP A;  3O0U A;  4MZO A;  2B1M A;  1QMY A;  3OF8 A;  1KXR A;  1S4V A;  1F2A A;  2DCD A;  5PAD A;  4HWY A;  1M6D A;  1AEC A;  4AXM A;  1ITO A;  2ACT A;  1PCI A;  1GMY A;  7PCK A;  1BGO A;  3QT4 A;  4Q8H A;  3AI8 A;  3P5U A;  4P6E A;  1GEC E;  2OUL A;  2YJC A;  1YK8 A;  4N79 A;  4NV8 A;  4OEL A;  1POP A;  6PAD A;  4I04 A;  1U9W A;  1F2B A;  2GHU A;  2AIM A;  1TU6 A;  2XU4 A;  2HHN A;  5CVO B;  1GCB A;  3IMA A;  2DJG B;  1Y4H A;  2JQF R;  2R9O A;  1QXP A;  4QRG A;  1NB5 A;  3WXG A;  3P5V A;  2PNS A;  1YAL A;  1KFX L;  1KFU L;  1W5R A;  1EWP A;  3KWZ A;  3PNR A;  3I06 A;  3S3Q A;  3N3G A;  4BPV A;  2FRA A;  1U9X A;  1EF7 A;  3PBH A;  3D6S A;  1AU3 A;  1MDW A;  1PXV A;  2BDZ A;  3BWK A;  2DC7 A;  1AU2 A;  1TLO A;  3ZUA A;  4YYS A;  4WA6 A;  2FRQ A;  1PPO A;  2DCC A;  4K7C A;  1AYV A;  1PPN A;  1U9Q X;  3B79 A;  4W5B A;  4PAD A;  2PRE A;  2HH5 A;  1PE6 A;  3O1G A;  3CBK A;  1AU4 A;  1NL6 A;  5CHV A;  2VFB A;  2XU1 A;  1CB5 A;  2B1N A;  1AYW A;  3HHI A;  4Q8G A;  1NB3 A;  1NPZ A;  2G8E A;  1GX3 A;  1K3B B;  4CDD B;  4YV8 A;  3F5V A;  1VSN A;  3HHA A;  4NV7 A;  3C9E A;  2IPP B;  3LFY A;  1PPP A;  4PI3 A;  4KLB A;  2FTD A;  3K8U A;  3BPF A;  3CH3 X;  3K9M A;  2PAD A;  3HD3 A;  4YYV A;  3PDF A;  3H6S A;  3P5W A;  2AU1 A;  3M99 A;  4G54 A;  2DC9 A;  4QBB A;  2G7Y A;  4BS6 A;  2R9C A;  2BDL A;  1NQC A;  1EWL A;  2NQG A;  3QJ3 A;  1A6R A;  1PPD A;  4W5C A;  3IHP A;  1MEG A;  3WXF A;  2P7U A;  1EWO A;  1BY8 A;  3USV A;  1PAD A;  3IV2 A;  4MZS A;  3H8C A;  3N3K A;  1X9Y A;  1BP4 A;  3V6E A;  3KWB X;  3P5X A;  5CVN B;  3TNX A;  2DJF B;  2AYN A;  3BOW A;  5CVM A;  1CV8 A;  4B55 A;  2FO5 A;  2AUX A;  2YJB A;  4FIP A;  2YJ9 A;  1F29 A;  3MHH A;  2NQA A;  1CS8 A;  2C0Y A;  4CDC B;  3KW9 A;  1AYU A;  2OZ2 A;  2XU5 A;  2VHS A;  1PIP A;  1GLO A;  1YK7 A;  2G6D A;  2FQ9 A;  4P6G A;  1ZCM A;  1MHW A;  3QSD A;  4DMX A;  3OF9 A;  1U9V A;  5J94 A;  3BC3 A;  3IOQ A;  3BPM A;  2E01 A;  4QRV A;  1BQI A;  2G8J A;  2Y6E A;  1CJL A;  4YYW A;  2WBF X;  3H89 A;  2DZZ A;  2PBH A;  1STF E;  1EWM A;  3KX1 A;  2ATO A;  2NQD B;  1NLJ A;  4W4U A;  1YVB A;  3PW3 A;  3S3R A;  4X6I A;  1IWD A;  2P86 A;  1U5I A;  1ZIV A;  1ATK A;  1CSB B;  1CTE A;  2VFC A;  3BCN A;  2DCA A;  4GUZ A;  3OVX A;  1TL9 A;  5K16 A;  4YYR A;  1KHP A;  3LXS A;  3IEJ A;  1AIM A;  3HWN A;  2VHF A;  1DF0 A;  2YJ2 A;  1KHQ A;  1CQD A;  3NHE A;  2R6N A;  4PP2 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...