4QRXA

Crystal structure of pro-papain mutant at ph 4.0
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
304
structure length
292
Chain Sequence
ERLIQLFESWMLKHNKIYKNIDEKIYRFEIFKDNLKYIDETNKKNNSYWLGLNVFADMSNDEFKEKYTGSIAGNLSYDVNIPEYVDWRQKGAVTPVKNQGSCGSAWAFSAVSTIESIIKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIRNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pro-peptide regulates the substrate specificity and zymogen activation process of papain: A structural and mechanistic insight
rcsb
source organism Carica papaya
molecule tags Hydrolase
molecule keywords pro-papain
total genus 95
structure length 292
sequence length 304
chains with identical sequence C
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 2014-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
A PF08246 Inhibitor_I29 Cathepsin propeptide inhibitor domain (I29)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4qrxA00
4P6EA 2AIMA 4P6GA 2JQGR 1YVBA 2OP3A 3QSDA 4AXLA 3ZUAA 1NB3A 1PBHA 2WBFX 4RY2A 1NLJA 1HUCB 2GHUA 4X6JA 1QXPA 1CJLA 5EF4A 1AYVA 3H7DA 1DF0A 2P86A 3GCBA 2XU4A 3U8EA 3QT4A 3RVWA 1GLOA 3BC3A 2YJ9A 2GFOA 1Y08A 4I04A 1CTEA 5K16A 2OULA 3KWBX 2E02A 3N3KA 2AYOA 3CH2X 7PCKA 2NQAA 1YK8A 2FT2A 3RVVA 1PE6A 2DC6A 4Q8GA 1TLOA 1ATKA 1U5IA 3AI8A 5JH3A 3OISA 5CVMA 1KFXL 2FO5A 3NHEA 3OVZA 1DEUA 3D6SA 2R9NA 2NQDB 4X6IA 4PI3A 2G6DA 2R9OA 1GECE 2DCCA 3TNXA 2H7JA 8PCHA 3WXFA 3KKUA 5CVOB 3F5VA 1O0EA 3N3GA 1TL9A 3IEJA 5EGWA 1CS8A 4FK5A 4QRGA 4XUIA 3N4CA 3IV2A 3S3QA 2VHSA 1KHQA 5JA7A 3MHSA 2HH5A 1PADA 2DZYA 4CZWA 1QMYA 3IOQA 3LFYA 3HHIA 4BS6A 4YVAA 2O6XA 1ICFA 1PPDA 4PADA 2XU1A 2AYNA 2BDZA 1EWOA 1MEGA 2P0RA 5CHTA 1CB5A 3DF0A 1PIPA 2C0YA 2FRQA 2ARYA 1AIMA 2OZ2A 2XU3A 3S3RA 2FTDA 2AU1A 4HWYA 3PNRA 2B1MA 2AVWA 4BSQA 2G8JA 1F2CA 4FIPA 2DCAA 1AU4A 2PADA 4YV8A 4W4UA 2YJBA 2BDLA 3BOWA 2DCBA 1FH0A 3KSEA 1YT7A 1BY8A 3KX1A 1EWLA 1MDWA 3P5UA 3O0UA 1TU6A 2FRAA 4MZOA 4I07A 1NB5A 1CSBB 3USVA 4BS5A 3B79A 1JQPA 1KFUL 2G7YA 1ZIVA 2DZZA 1EF7A 4N79A 1MS6A 2FUDA 4OELA 2DC7A 3P5VA 1AU3A 1THEA 1K3BB 3V6CA 2IPPB 1ZCMA 2F1GA 1PPNA 1CPJA 1AECA 4YYQA 3ERVA 3CBKA 3V6EA 4AXMA 4PP2E 4I05A 1F2AA 2HHNA 4CDCB 2ATOA 2AUXA 2P7UA 4N8WA 3K24A 2XU5A 4KLBA 1NQCA 1EWMA 3PDFA 1BGOA 4QH6A 3BWKA 3QJ3A 3F75A 4YYRA 5CHVA 3I06A 1YK7A 2DCDA 4X6HA 3P5XA 1EWPA 1VJVA 2CB5A 4K7CA 2R6NA 2YJCA 9PAPA 1AU0A 2AS8A 3PBHA 3OF8A 3M99A 4OEMA 1ITOA 4YYVA 1STFE 5J94A 3WXGA 3O1GA 2JQFR 5F02A 1SNKA 2B1NA 1IWDA 2YJ2A 4W5BA 1MHWA 3KW9A 2DC9A 1GCBA 3OF9A 3BPFA 3MHHA 1PPPA 4N4ZA 3CBJA 2HXZA 2Y6EA 4FJCA 3BPMA 3MORA 1PCIA 4W5CA 4BQVA 1BQIA 1QOLA 2PBHA 2PNSA 2G8EA 2Y5BA 4MSXA 4XR7A 4MZSA 3H89A 3P5WA 1CVZA 5PADA 1U9VA 4DMYA 1U9WA 3PW3A 2NQIA 3OVXA 1NL6A 3K8UA 3RVXA 4Q8HA 1KHPA 1PPOA 1AYWA 1U9XA 2YJ8A 4QRXA 4CDDB 1F29A 2HD5A 2R9CA 5CVNB 2IBIA 3HD3A 3IUTA 2PREA 1KXRA 4WA6A 4QRVA 1AU2A 4CDFB 1PXVA 1MEMA 6PADA 1POPA 2FYEA 1YALA 2VHFA 4G54A 1CQDA 4QBBA 1ME3A 2R9FA 2E03A 3HWNA 3LXSA 1MIRA 1A6RA 1GMYA 1X9YA 2DC8A 1M6DA 4CDEB 2DJGB 2AUZA 3H6SA 2FQ9A 1QDQA 1XKGA 3E1ZB 3KWZA 1VSNA 1ME4A 3MTNA 3H8BA 1Q6KA 1SP4B 2DJFB 4BPVA 2ACTA 3IMAA 1CV8A 4YYWA 3HHAA 2F7DA 3CH3X 4PP1A 4YYSA 2R9MA 1AYUA 1F2BA 2CIOA 1BP4A 1S4VA 2NQGA 1NPZA 3I3TA 5A24A 3K9MA 4YYUA 3H8CA 3WXEA 4ZUXU 1U9QX 3BCNA 1Y4HA 3C9EA 4DMXA 5FPWA 3IHPA 2E01A 3KFQA 2E00A
chains in the Genus database with same CATH superfamily
4P6EA 1YZBA 2AIMA 4P6GA 2JQGR 1YVBA 2OP3A 3BBAA 3QSDA 4AXLA 3ZUAA 1NB3A 1PBHA 2WBFX 4RY2A 1NLJA 1HUCB 2GHUA 4X6JA 1QXPA 1CJLA 4P16A 5EF4A 1AYVA 3H7DA 1DF0A 3IFUA 2P86A 4RF1A 3GCBA 2XU4A 3U8EA 3QT4A 3RVWA 4RF0A 1GLOA 3BC3A 2YJ9A 2GFOA 1Y08A 4I04A 1CTEA 5K16A 2JRIA 2OULA 3KWBX 2E02A 3N3KA 2AYOA 3CH2X 4M0WA 3PRMA 7PCKA 2NQAA 1YK8A 2FT2A 3RVVA 1PE6A 2DC6A 4Q8GA 1TLOA 3PHUA 4D8EA 1ATKA 1U5IA 2AGAA 3AI8A 5JZEA 5JH3A 3OISA 5CVMA 1KFXL 2FO5A 4RNAA 3NHEA 3OVZA 1DEUA 3D6SA 2R9NA 2NQDB 4X6IA 4PI3A 2G6DA 2R9OA 1GECE 2DCCA 4MI7A 3TNXA 2H7JA 8PCHA 3WXFA 3KKUA 5CVOB 3F5VA 1O0EA 3N3GA 1TL9A 3BB7A 3IEJA 5EGWA 1CS8A 4FK5A 4QRGA 4XUIA 3N4CA 3IV2A 3S3QA 2VHSA 3MJ5A 4REZA 1KHQA 5JA7A 3MHSA 3TRKA 2HH5A 1PADA 2DZYA 4CZWA 1QMYA 3IOQA 3LFYA 3HHIA 4BS6A 4YVAA 2O6XA 1ICFA 2HWKA 1PPDA 4PADA 2XU1A 2AYNA 2BDZA 1EWOA 1MEGA 2P0RA 3TMPA 5CHTA 1CB5A 3DF0A 1PIPA 2C0YA 2FRQA 2ARYA 1UKFA 1AIMA 2OZ2A 2XU3A 3S3RA 2FTDA 2AU1A 4HWYA 3E9SA 3W30A 1PVJA 3PNRA 2DOSA 2B1MA 2AVWA 4BSQA 2G8JA 1F2CA 4FIPA 2DCAA 1AU4A 2PADA 4YV8A 4W4UA 2YJBA 2BDLA 3BOWA 2DCBA 1FH0A 3KSEA 1YT7A 1BY8A 4RKXA 4IUMA 3KX1A 1EWLA 1MDWA 3P5UA 3O0UA 1TU6A 2FRAA 4MZOA 4I07A 1NB5A 1CSBB 3USVA 4BS5A 5KO3A 3B79A 4PT5A 3PRPA 1JQPA 1KFUL 2JTCA 2G7YA 1ZIVA 2DZZA 4GUAA 1EF7A 4N79A 1MS6A 2J7QC 2FUDA 4D8IA 4OELA 4BOQA 3PT2A 2DC7A 3P5VA 1AU3A 1THEA 3RNVA 1K3BB 3V6CA 2IPPB 1ZCMA 3OQCA 2F1GA 1PPNA 4BOSA 1CPJA 1AECA 4YYQA 3ERVA 3CBKA 4IP3A 3V6EA 4AXMA 4PP2E 4I05A 1F2AA 2HHNA 4OVZA 4CDCB 2ATOA 2AUXA 2P7UA 4N8WA 3K24A 2XU5A 4KLBA 1NQCA 4D8BA 1EWMA 2FE8A 4XZXA 2BTWA 3PDFA 3MP2A 1BGOA 4QH6A 3BWKA 3QJ3A 3PHXA 3F75A 4YYRA 5CHVA 5EZQA 3I06A 4BOZA 1YK7A 2DCDA 4X6HA 3P5XA 1EWPA 1VJVA 2CB5A 4K7CA 2R6NA 2YJCA 9PAPA 1AU0A 2AS8A 3PBHA 3OF8A 3M99A 4OEMA 5EZSA 1ITOA 4YYVA 1STFE 5J94A 1DKIA 3WXGA 3O1GA 2JQFR 5F02A 1SNKA 2B1NA 1IWDA 2YJ2A 4W5BA 1MHWA 3KW9A 4HXDB 2DC9A 1GCBA 3OF9A 3BPFA 3MHHA 1PPPA 4R3DA 4N4ZA 3CBJA 2HXZA 2Y6EA 4FJCA 3BPMA 3MTVA 3MORA 1PCIA 4W5CA 4BQVA 1BQIA 1QOLA 2PBHA 3PHWA 2PNSA 3W31A 2G8EA 2Y5BA 4MSXA 4XR7A 4MZSA 3H89A 3P5WA 1CVZA 4OVZB 1U9VA 5PADA 4DMYA 2Z84A 1U9WA 3PW3A 2NQIA 3OVXA 1NL6A 3K8UA 3RVXA 4Q8HA 1KHPA 1PPOA 1AYWA 1U9XA 2YJ8A 4QRXA 4CDDB 1F29A 4ZTBA 2HD5A 2R9CA 5CVNB 2IBIA 3B21A 3HD3A 3IUTA 2PREA 2BU3A 1KXRA 4WA6A 4QRVA 1AU2A 4CDFB 1PXVA 1MEMA 6PADA 1POPA 2FYEA 1YALA 2VHFA 4G54A 1CQDA 4QBBA 1ME3A 2R9FA 2E03A 3HWNA 3LXSA 1MIRA 1A6RA 1GMYA 1X9YA 2BTWB 2DC8A 2J7QA 1M6DA 4CDEB 3C0RA 2DJGB 2AUZA 3H6SA 2FQ9A 1QDQA 4OW0A 1XKGA 3E1ZB 3KWZA 1VSNA 1ME4A 3ZNHA 3MTNA 3H8BA 1Q6KA 1SP4B 2DJFB 4BPVA 2ACTA 3IMAA 1CV8A 3O65A 4YYWA 3HHAA 2F7DA 3CH3X 4PP1A 4WURA 2UZJA 4BOPA 4YYSA 2R9MA 1AYUA 1F2BA 2CIOA 4A5UA 1BP4A 1S4VA 2NQGA 1NPZA 3BY4A 3I3TA 5A24A 3K9MA 4YYUA 3H8CA 3WXEA 4MM3B 4ZUXU 1U9QX 3BCNA 1Y4HA 3C9EA 4BOUA 4DMXA 5FPWA 3IHPA 2E01A 3KFQA 3PSEA 2E00A 5E6JA
chains in the Genus database with same CATH topology
4P6EA 2AIMA 4P6GA 2JQGR 1YVBA 2OP3A 3QSDA 4AXLA 3ZUAA 1NB3A 1PBHA 2WBFX 4RY2A 1NLJA 1HUCB 2GHUA 4X6JA 1QXPA 1CJLA 4GUZA 5EF4A 1AYVA 3H7DA 4NV8A 1DF0A 2P86A 3GCBA 2XU4A 3U8EA 3QT4A 3RVWA 1GLOA 3BC3A 2YJ9A 2GFOA 1Y08A 4I04A 1CTEA 5K16A 2OULA 3KWBX 3D9WA 2E02A 3N3KA 2AYOA 3CH2X 7PCKA 2NQAA 1YK8A 2FT2A 3RVVA 1PE6A 2DC6A 4Q8GA 1TLOA 1ATKA 1U5IA 3AI8A 5JH3A 3OISA 5CVMA 1GX3A 1KFXL 2FO5A 3NHEA 3OVZA 1DEUA 3D6SA 2R9NA 2NQDB 4X6IA 1W5RA 4PI3A 2G6DA 2R9OA 1GECE 2DCCA 3TNXA 2H7JA 8PCHA 3WXFA 3KKUA 5CVOB 3F5VA 1O0EA 3N3GA 1TL9A 3IEJA 5EGWA 1CS8A 4FK5A 4QRGA 4XUIA 3N4CA 3IV2A 3S3QA 2VHSA 1KHQA 5JA7A 3MHSA 2HH5A 1PADA 2DZYA 4CZWA 1QMYA 3IOQA 3LFYA 2VFCA 3HHIA 4BS6A 4YVAA 2O6XA 1ICFA 1PPDA 4PADA 2XU1A 2AYNA 2BDZA 1EWOA 1MEGA 2P0RA 5CHTA 1CB5A 3DF0A 1PIPA 2C0YA 2FRQA 2ARYA 1AIMA 2OZ2A 2XU3A 3S3RA 2FTDA 2AU1A 4HWYA 3PNRA 2B1MA 2AVWA 4BSQA 2G8JA 1F2CA 4FIPA 2DCAA 1AU4A 2PADA 4YV8A 4W4UA 2YJBA 2BDLA 3BOWA 2DCBA 1FH0A 3KSEA 1YT7A 1BY8A 3KX1A 1EWLA 1MDWA 3P5UA 3LTWA 3O0UA 1TU6A 2FRAA 4MZOA 4I07A 1NB5A 1CSBB 3USVA 4BS5A 3B79A 1JQPA 1KFUL 2G7YA 1ZIVA 2DZZA 1EF7A 4N79A 1MS6A 2FUDA 4OELA 2DC7A 3P5VA 1AU3A 1THEA 1K3BB 3V6CA 2IPPB 1ZCMA 2F1GA 1PPNA 1CPJA 1AECA 4YYQA 3ERVA 3CBKA 3V6EA 4AXMA 4PP2E 4I05A 1F2AA 2HHNA 4CDCB 2ATOA 2AUXA 1W4TA 2P7UA 4N8WA 3K24A 2XU5A 4KLBA 1NQCA 1EWMA 4NV7A 3PDFA 1BGOA 4QH6A 3BWKA 3QJ3A 3F75A 4YYRA 5CHVA 3I06A 1YK7A 2DCDA 4X6HA 3P5XA 1EWPA 2BSZA 1VJVA 2CB5A 4K7CA 2R6NA 2YJCA 9PAPA 1AU0A 2AS8A 3PBHA 1W6FA 3OF8A 3M99A 4OEMA 1ITOA 4YYVA 1STFE 5J94A 3WXGA 3O1GA 2JQFR 5F02A 1SNKA 2B1NA 1IWDA 2YJ2A 4W5BA 1MHWA 3KW9A 2DC9A 1GCBA 3OF9A 3BPFA 3MHHA 1PPPA 4N4ZA 3CBJA 2HXZA 2Y6EA 4FJCA 3BPMA 3MORA 1PCIA 4W5CA 4BQVA 1BQIA 1QOLA 2PBHA 2PNSA 2G8EA 2Y5BA 4MSXA 4XR7A 4MZSA 3H89A 3P5WA 1CVZA 5PADA 1U9VA 4DMYA 1U9WA 3PW3A 2NQIA 3OVXA 1NL6A 4BGFA 3K8UA 3RVXA 4Q8HA 1KHPA 1PPOA 1AYWA 1U9XA 2YJ8A 4QRXA 4CDDB 1F29A 2HD5A 2R9CA 5CVNB 2IBIA 3HD3A 3IUTA 2PREA 1KXRA 4WA6A 4QRVA 1AU2A 4CDFB 1PXVA 1MEMA 6PADA 1POPA 2FYEA 1YALA 2VHFA 4G54A 1CQDA 4QBBA 1ME3A 2R9FA 2E03A 3HWNA 3LXSA 1MIRA 1A6RA 1GMYA 1X9YA 2DC8A 1M6DA 4CDEB 2DJGB 2AUZA 3H6SA 2FQ9A 1QDQA 1XKGA 3E1ZB 3KWZA 1VSNA 1ME4A 4C5PA 3MTNA 3H8BA 1Q6KA 1SP4B 2DJFB 4BPVA 2ACTA 3IMAA 1CV8A 4YYWA 3HHAA 2F7DA 3CH3X 4PP1A 4YYSA 2R9MA 1AYUA 1E2TA 1F2BA 2CIOA 1BP4A 1S4VA 2NQGA 1NPZA 4B55A 3I3TA 5A24A 3K9MA 4YYUA 3H8CA 3WXEA 4ZUXU 1U9QX 3BCNA 1Y4HA 3C9EA 4DMXA 5FPWA 3IHPA 2E01A 2VFBA 3KFQA 2E00A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P6E A;  2AIM A;  4P6G A;  2JQG R;  1YVB A;  2OP3 A;  3QSD A;  4AXL A;  3ZUA A;  1NB3 A;  1PBH A;  2WBF X;  4RY2 A;  1NLJ A;  1HUC B;  2GHU A;  4X6J A;  1QXP A;  1CJL A;  5EF4 A;  1AYV A;  3H7D A;  1DF0 A;  2P86 A;  3GCB A;  2XU4 A;  3U8E A;  3QT4 A;  3RVW A;  1GLO A;  3BC3 A;  2YJ9 A;  2GFO A;  1Y08 A;  4I04 A;  1CTE A;  5K16 A;  2OUL A;  3KWB X;  2E02 A;  3N3K A;  2AYO A;  3CH2 X;  7PCK A;  2NQA A;  1YK8 A;  2FT2 A;  3RVV A;  1PE6 A;  2DC6 A;  4Q8G A;  1TLO A;  1ATK A;  1U5I A;  3AI8 A;  5JH3 A;  3OIS A;  5CVM A;  1KFX L;  2FO5 A;  3NHE A;  3OVZ A;  1DEU A;  3D6S A;  2R9N A;  2NQD B;  4X6I A;  4PI3 A;  2G6D A;  2R9O A;  1GEC E;  2DCC A;  3TNX A;  2H7J A;  8PCH A;  3WXF A;  3KKU A;  5CVO B;  3F5V A;  1O0E A;  3N3G A;  1TL9 A;  3IEJ A;  5EGW A;  1CS8 A;  4FK5 A;  4QRG A;  4XUI A;  3N4C A;  3IV2 A;  3S3Q A;  2VHS A;  1KHQ A;  5JA7 A;  3MHS A;  2HH5 A;  1PAD A;  2DZY A;  4CZW A;  1QMY A;  3IOQ A;  3LFY A;  3HHI A;  4BS6 A;  4YVA A;  2O6X A;  1ICF A;  1PPD A;  4PAD A;  2XU1 A;  2AYN A;  2BDZ A;  1EWO A;  1MEG A;  2P0R A;  5CHT A;  1CB5 A;  3DF0 A;  1PIP A;  2C0Y A;  2FRQ A;  2ARY A;  1AIM A;  2OZ2 A;  2XU3 A;  3S3R A;  2FTD A;  2AU1 A;  4HWY A;  3PNR A;  2B1M A;  2AVW A;  4BSQ A;  2G8J A;  1F2C A;  4FIP A;  2DCA A;  1AU4 A;  2PAD A;  4YV8 A;  4W4U A;  2YJB A;  2BDL A;  3BOW A;  2DCB A;  1FH0 A;  3KSE A;  1YT7 A;  1BY8 A;  3KX1 A;  1EWL A;  1MDW A;  3P5U A;  3O0U A;  1TU6 A;  2FRA A;  4MZO A;  4I07 A;  1NB5 A;  1CSB B;  3USV A;  4BS5 A;  3B79 A;  1JQP A;  1KFU L;  2G7Y A;  1ZIV A;  2DZZ A;  1EF7 A;  4N79 A;  1MS6 A;  2FUD A;  4OEL A;  2DC7 A;  3P5V A;  1AU3 A;  1THE A;  1K3B B;  3V6C A;  2IPP B;  1ZCM A;  2F1G A;  1PPN A;  1CPJ A;  1AEC A;  4YYQ A;  3ERV A;  3CBK A;  3V6E A;  4AXM A;  4PP2 E;  4I05 A;  1F2A A;  2HHN A;  4CDC B;  2ATO A;  2AUX A;  2P7U A;  4N8W A;  3K24 A;  2XU5 A;  4KLB A;  1NQC A;  1EWM A;  3PDF A;  1BGO A;  4QH6 A;  3BWK A;  3QJ3 A;  3F75 A;  4YYR A;  5CHV A;  3I06 A;  1YK7 A;  2DCD A;  4X6H A;  3P5X A;  1EWP A;  1VJV A;  2CB5 A;  4K7C A;  2R6N A;  2YJC A;  9PAP A;  1AU0 A;  2AS8 A;  3PBH A;  3OF8 A;  3M99 A;  4OEM A;  1ITO A;  4YYV A;  1STF E;  5J94 A;  3WXG A;  3O1G A;  2JQF R;  5F02 A;  1SNK A;  2B1N A;  1IWD A;  2YJ2 A;  4W5B A;  1MHW A;  3KW9 A;  2DC9 A;  1GCB A;  3OF9 A;  3BPF A;  3MHH A;  1PPP A;  4N4Z A;  3CBJ A;  2HXZ A;  2Y6E A;  4FJC A;  3BPM A;  3MOR A;  1PCI A;  4W5C A;  4BQV A;  1BQI A;  1QOL A;  2PBH A;  2PNS A;  2G8E A;  2Y5B A;  4MSX A;  4XR7 A;  4MZS A;  3H89 A;  3P5W A;  1CVZ A;  5PAD A;  1U9V A;  4DMY A;  1U9W A;  3PW3 A;  2NQI A;  3OVX A;  1NL6 A;  3K8U A;  3RVX A;  4Q8H A;  1KHP A;  1PPO A;  1AYW A;  1U9X A;  2YJ8 A;  4QRX A;  4CDD B;  1F29 A;  2HD5 A;  2R9C A;  5CVN B;  2IBI A;  3HD3 A;  3IUT A;  2PRE A;  1KXR A;  4WA6 A;  4QRV A;  1AU2 A;  4CDF B;  1PXV A;  1MEM A;  6PAD A;  1POP A;  2FYE A;  1YAL A;  2VHF A;  4G54 A;  1CQD A;  4QBB A;  1ME3 A;  2R9F A;  2E03 A;  3HWN A;  3LXS A;  1MIR A;  1A6R A;  1GMY A;  1X9Y A;  2DC8 A;  1M6D A;  4CDE B;  2DJG B;  2AUZ A;  3H6S A;  2FQ9 A;  1QDQ A;  1XKG A;  3E1Z B;  3KWZ A;  1VSN A;  1ME4 A;  3MTN A;  3H8B A;  1Q6K A;  1SP4 B;  2DJF B;  4BPV A;  2ACT A;  3IMA A;  1CV8 A;  4YYW A;  3HHA A;  2F7D A;  3CH3 X;  4PP1 A;  4YYS A;  2R9M A;  1AYU A;  1F2B A;  2CIO A;  1BP4 A;  1S4V A;  2NQG A;  1NPZ A;  3I3T A;  5A24 A;  3K9M A;  4YYU A;  3H8C A;  3WXE A;  4ZUX U;  1U9Q X;  3BCN A;  1Y4H A;  3C9E A;  4DMX A;  5FPW A;  3IHP A;  2E01 A;  3KFQ A;  2E00 A; 
#chains in the Genus database with same CATH topology
 4P6E A;  1YZB A;  2AIM A;  4P6G A;  2JQG R;  1YVB A;  2OP3 A;  3BBA A;  3QSD A;  4AXL A;  3ZUA A;  1NB3 A;  1PBH A;  2WBF X;  4RY2 A;  1NLJ A;  1HUC B;  2GHU A;  4X6J A;  1QXP A;  1CJL A;  4P16 A;  5EF4 A;  1AYV A;  3H7D A;  1DF0 A;  3IFU A;  2P86 A;  4RF1 A;  3GCB A;  2XU4 A;  3U8E A;  3QT4 A;  3RVW A;  4RF0 A;  1GLO A;  3BC3 A;  2YJ9 A;  2GFO A;  1Y08 A;  4I04 A;  1CTE A;  5K16 A;  2JRI A;  2OUL A;  3KWB X;  2E02 A;  3N3K A;  2AYO A;  3CH2 X;  4M0W A;  3PRM A;  7PCK A;  2NQA A;  1YK8 A;  2FT2 A;  3RVV A;  1PE6 A;  2DC6 A;  4Q8G A;  1TLO A;  3PHU A;  4D8E A;  1ATK A;  1U5I A;  2AGA A;  3AI8 A;  5JZE A;  5JH3 A;  3OIS A;  5CVM A;  1KFX L;  2FO5 A;  4RNA A;  3NHE A;  3OVZ A;  1DEU A;  3D6S A;  2R9N A;  2NQD B;  4X6I A;  4PI3 A;  2G6D A;  2R9O A;  1GEC E;  2DCC A;  4MI7 A;  3TNX A;  2H7J A;  8PCH A;  3WXF A;  3KKU A;  5CVO B;  3F5V A;  1O0E A;  3N3G A;  1TL9 A;  3BB7 A;  3IEJ A;  5EGW A;  1CS8 A;  4FK5 A;  4QRG A;  4XUI A;  3N4C A;  3IV2 A;  3S3Q A;  2VHS A;  3MJ5 A;  4REZ A;  1KHQ A;  5JA7 A;  3MHS A;  3TRK A;  2HH5 A;  1PAD A;  2DZY A;  4CZW A;  1QMY A;  3IOQ A;  3LFY A;  3HHI A;  4BS6 A;  4YVA A;  2O6X A;  1ICF A;  2HWK A;  1PPD A;  4PAD A;  2XU1 A;  2AYN A;  2BDZ A;  1EWO A;  1MEG A;  2P0R A;  3TMP A;  5CHT A;  1CB5 A;  3DF0 A;  1PIP A;  2C0Y A;  2FRQ A;  2ARY A;  1UKF A;  1AIM A;  2OZ2 A;  2XU3 A;  3S3R A;  2FTD A;  2AU1 A;  4HWY A;  3E9S A;  3W30 A;  1PVJ A;  3PNR A;  2DOS A;  2B1M A;  2AVW A;  4BSQ A;  2G8J A;  1F2C A;  4FIP A;  2DCA A;  1AU4 A;  2PAD A;  4YV8 A;  4W4U A;  2YJB A;  2BDL A;  3BOW A;  2DCB A;  1FH0 A;  3KSE A;  1YT7 A;  1BY8 A;  4RKX A;  4IUM A;  3KX1 A;  1EWL A;  1MDW A;  3P5U A;  3O0U A;  1TU6 A;  2FRA A;  4MZO A;  4I07 A;  1NB5 A;  1CSB B;  3USV A;  4BS5 A;  5KO3 A;  3B79 A;  4PT5 A;  3PRP A;  1JQP A;  1KFU L;  2JTC A;  2G7Y A;  1ZIV A;  2DZZ A;  4GUA A;  1EF7 A;  4N79 A;  1MS6 A;  2J7Q C;  2FUD A;  4D8I A;  4OEL A;  4BOQ A;  3PT2 A;  2DC7 A;  3P5V A;  1AU3 A;  1THE A;  3RNV A;  1K3B B;  3V6C A;  2IPP B;  1ZCM A;  3OQC A;  2F1G A;  1PPN A;  4BOS A;  1CPJ A;  1AEC A;  4YYQ A;  3ERV A;  3CBK A;  4IP3 A;  3V6E A;  4AXM A;  4PP2 E;  4I05 A;  1F2A A;  2HHN A;  4OVZ A;  4CDC B;  2ATO A;  2AUX A;  2P7U A;  4N8W A;  3K24 A;  2XU5 A;  4KLB A;  1NQC A;  4D8B A;  1EWM A;  2FE8 A;  4XZX A;  2BTW A;  3PDF A;  3MP2 A;  1BGO A;  4QH6 A;  3BWK A;  3QJ3 A;  3PHX A;  3F75 A;  4YYR A;  5CHV A;  5EZQ A;  3I06 A;  4BOZ A;  1YK7 A;  2DCD A;  4X6H A;  3P5X A;  1EWP A;  1VJV A;  2CB5 A;  4K7C A;  2R6N A;  2YJC A;  9PAP A;  1AU0 A;  2AS8 A;  3PBH A;  3OF8 A;  3M99 A;  4OEM A;  5EZS A;  1ITO A;  4YYV A;  1STF E;  5J94 A;  1DKI A;  3WXG A;  3O1G A;  2JQF R;  5F02 A;  1SNK A;  2B1N A;  1IWD A;  2YJ2 A;  4W5B A;  1MHW A;  3KW9 A;  4HXD B;  2DC9 A;  1GCB A;  3OF9 A;  3BPF A;  3MHH A;  1PPP A;  4R3D A;  4N4Z A;  3CBJ A;  2HXZ A;  2Y6E A;  4FJC A;  3BPM A;  3MTV A;  3MOR A;  1PCI A;  4W5C A;  4BQV A;  1BQI A;  1QOL A;  2PBH A;  3PHW A;  2PNS A;  3W31 A;  2G8E A;  2Y5B A;  4MSX A;  4XR7 A;  4MZS A;  3H89 A;  3P5W A;  1CVZ A;  4OVZ B;  1U9V A;  5PAD A;  4DMY A;  2Z84 A;  1U9W A;  3PW3 A;  2NQI A;  3OVX A;  1NL6 A;  3K8U A;  3RVX A;  4Q8H A;  1KHP A;  1PPO A;  1AYW A;  1U9X A;  2YJ8 A;  4QRX A;  4CDD B;  1F29 A;  4ZTB A;  2HD5 A;  2R9C A;  5CVN B;  2IBI A;  3B21 A;  3HD3 A;  3IUT A;  2PRE A;  2BU3 A;  1KXR A;  4WA6 A;  4QRV A;  1AU2 A;  4CDF B;  1PXV A;  1MEM A;  6PAD A;  1POP A;  2FYE A;  1YAL A;  2VHF A;  4G54 A;  1CQD A;  4QBB A;  1ME3 A;  2R9F A;  2E03 A;  3HWN A;  3LXS A;  1MIR A;  1A6R A;  1GMY A;  1X9Y A;  2BTW B;  2DC8 A;  2J7Q A;  1M6D A;  4CDE B;  3C0R A;  2DJG B;  2AUZ A;  3H6S A;  2FQ9 A;  1QDQ A;  4OW0 A;  1XKG A;  3E1Z B;  3KWZ A;  1VSN A;  1ME4 A;  3ZNH A;  3MTN A;  3H8B A;  1Q6K A;  1SP4 B;  2DJF B;  4BPV A;  2ACT A;  3IMA A;  1CV8 A;  3O65 A;  4YYW A;  3HHA A;  2F7D A;  3CH3 X;  4PP1 A;  4WUR A;  2UZJ A;  4BOP A;  4YYS A;  2R9M A;  1AYU A;  1F2B A;  2CIO A;  4A5U A;  1BP4 A;  1S4V A;  2NQG A;  1NPZ A;  3BY4 A;  3I3T A;  5A24 A;  3K9M A;  4YYU A;  3H8C A;  3WXE A;  4MM3 B;  4ZUX U;  1U9Q X;  3BCN A;  1Y4H A;  3C9E A;  4BOU A;  4DMX A;  5FPW A;  3IHP A;  2E01 A;  3KFQ A;  3PSE A;  2E00 A;  5E6J A; 
#chains in the Genus database with same CATH homology
 4P6E A;  2AIM A;  4P6G A;  2JQG R;  1YVB A;  2OP3 A;  3QSD A;  4AXL A;  3ZUA A;  1NB3 A;  1PBH A;  2WBF X;  4RY2 A;  1NLJ A;  1HUC B;  2GHU A;  4X6J A;  1QXP A;  1CJL A;  4GUZ A;  5EF4 A;  1AYV A;  3H7D A;  4NV8 A;  1DF0 A;  2P86 A;  3GCB A;  2XU4 A;  3U8E A;  3QT4 A;  3RVW A;  1GLO A;  3BC3 A;  2YJ9 A;  2GFO A;  1Y08 A;  4I04 A;  1CTE A;  5K16 A;  2OUL A;  3KWB X;  3D9W A;  2E02 A;  3N3K A;  2AYO A;  3CH2 X;  7PCK A;  2NQA A;  1YK8 A;  2FT2 A;  3RVV A;  1PE6 A;  2DC6 A;  4Q8G A;  1TLO A;  1ATK A;  1U5I A;  3AI8 A;  5JH3 A;  3OIS A;  5CVM A;  1GX3 A;  1KFX L;  2FO5 A;  3NHE A;  3OVZ A;  1DEU A;  3D6S A;  2R9N A;  2NQD B;  4X6I A;  1W5R A;  4PI3 A;  2G6D A;  2R9O A;  1GEC E;  2DCC A;  3TNX A;  2H7J A;  8PCH A;  3WXF A;  3KKU A;  5CVO B;  3F5V A;  1O0E A;  3N3G A;  1TL9 A;  3IEJ A;  5EGW A;  1CS8 A;  4FK5 A;  4QRG A;  4XUI A;  3N4C A;  3IV2 A;  3S3Q A;  2VHS A;  1KHQ A;  5JA7 A;  3MHS A;  2HH5 A;  1PAD A;  2DZY A;  4CZW A;  1QMY A;  3IOQ A;  3LFY A;  2VFC A;  3HHI A;  4BS6 A;  4YVA A;  2O6X A;  1ICF A;  1PPD A;  4PAD A;  2XU1 A;  2AYN A;  2BDZ A;  1EWO A;  1MEG A;  2P0R A;  5CHT A;  1CB5 A;  3DF0 A;  1PIP A;  2C0Y A;  2FRQ A;  2ARY A;  1AIM A;  2OZ2 A;  2XU3 A;  3S3R A;  2FTD A;  2AU1 A;  4HWY A;  3PNR A;  2B1M A;  2AVW A;  4BSQ A;  2G8J A;  1F2C A;  4FIP A;  2DCA A;  1AU4 A;  2PAD A;  4YV8 A;  4W4U A;  2YJB A;  2BDL A;  3BOW A;  2DCB A;  1FH0 A;  3KSE A;  1YT7 A;  1BY8 A;  3KX1 A;  1EWL A;  1MDW A;  3P5U A;  3LTW A;  3O0U A;  1TU6 A;  2FRA A;  4MZO A;  4I07 A;  1NB5 A;  1CSB B;  3USV A;  4BS5 A;  3B79 A;  1JQP A;  1KFU L;  2G7Y A;  1ZIV A;  2DZZ A;  1EF7 A;  4N79 A;  1MS6 A;  2FUD A;  4OEL A;  2DC7 A;  3P5V A;  1AU3 A;  1THE A;  1K3B B;  3V6C A;  2IPP B;  1ZCM A;  2F1G A;  1PPN A;  1CPJ A;  1AEC A;  4YYQ A;  3ERV A;  3CBK A;  3V6E A;  4AXM A;  4PP2 E;  4I05 A;  1F2A A;  2HHN A;  4CDC B;  2ATO A;  2AUX A;  1W4T A;  2P7U A;  4N8W A;  3K24 A;  2XU5 A;  4KLB A;  1NQC A;  1EWM A;  4NV7 A;  3PDF A;  1BGO A;  4QH6 A;  3BWK A;  3QJ3 A;  3F75 A;  4YYR A;  5CHV A;  3I06 A;  1YK7 A;  2DCD A;  4X6H A;  3P5X A;  1EWP A;  2BSZ A;  1VJV A;  2CB5 A;  4K7C A;  2R6N A;  2YJC A;  9PAP A;  1AU0 A;  2AS8 A;  3PBH A;  1W6F A;  3OF8 A;  3M99 A;  4OEM A;  1ITO A;  4YYV A;  1STF E;  5J94 A;  3WXG A;  3O1G A;  2JQF R;  5F02 A;  1SNK A;  2B1N A;  1IWD A;  2YJ2 A;  4W5B A;  1MHW A;  3KW9 A;  2DC9 A;  1GCB A;  3OF9 A;  3BPF A;  3MHH A;  1PPP A;  4N4Z A;  3CBJ A;  2HXZ A;  2Y6E A;  4FJC A;  3BPM A;  3MOR A;  1PCI A;  4W5C A;  4BQV A;  1BQI A;  1QOL A;  2PBH A;  2PNS A;  2G8E A;  2Y5B A;  4MSX A;  4XR7 A;  4MZS A;  3H89 A;  3P5W A;  1CVZ A;  5PAD A;  1U9V A;  4DMY A;  1U9W A;  3PW3 A;  2NQI A;  3OVX A;  1NL6 A;  4BGF A;  3K8U A;  3RVX A;  4Q8H A;  1KHP A;  1PPO A;  1AYW A;  1U9X A;  2YJ8 A;  4QRX A;  4CDD B;  1F29 A;  2HD5 A;  2R9C A;  5CVN B;  2IBI A;  3HD3 A;  3IUT A;  2PRE A;  1KXR A;  4WA6 A;  4QRV A;  1AU2 A;  4CDF B;  1PXV A;  1MEM A;  6PAD A;  1POP A;  2FYE A;  1YAL A;  2VHF A;  4G54 A;  1CQD A;  4QBB A;  1ME3 A;  2R9F A;  2E03 A;  3HWN A;  3LXS A;  1MIR A;  1A6R A;  1GMY A;  1X9Y A;  2DC8 A;  1M6D A;  4CDE B;  2DJG B;  2AUZ A;  3H6S A;  2FQ9 A;  1QDQ A;  1XKG A;  3E1Z B;  3KWZ A;  1VSN A;  1ME4 A;  4C5P A;  3MTN A;  3H8B A;  1Q6K A;  1SP4 B;  2DJF B;  4BPV A;  2ACT A;  3IMA A;  1CV8 A;  4YYW A;  3HHA A;  2F7D A;  3CH3 X;  4PP1 A;  4YYS A;  2R9M A;  1AYU A;  1E2T A;  1F2B A;  2CIO A;  1BP4 A;  1S4V A;  2NQG A;  1NPZ A;  4B55 A;  3I3T A;  5A24 A;  3K9M A;  4YYU A;  3H8C A;  3WXE A;  4ZUX U;  1U9Q X;  3BCN A;  1Y4H A;  3C9E A;  4DMX A;  5FPW A;  3IHP A;  2E01 A;  2VFB A;  3KFQ A;  2E00 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...