4RF1A

Crystal structure of the middle-east respiratory syndrome coronavirus papain-like protease in complex with ubiquitin (space group p63)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
321
structure length
319
Chain Sequence
LTIEVLVTVDGVNFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKELYGPVDPTFLHRFYSLKAAVHGWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFVIPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVWREWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQLVEHTTPWLLLSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKLILKFDSGTVSKTSDWKCKVTDVLFPGQKYSSDCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Middle East Respiratory Syndrome Coronavirus (MERS-CoV) Papain-like Protease Bound to Ubiquitin Facilitates Targeted Disruption of Deubiquitinating Activity to Demonstrate Its Role in Innate Immune Suppression.
pubmed doi rcsb
source organism Human betacoronavirus 2c jordan-n3/2012
molecule tags Protein binding
molecule keywords ORF1ab protein
total genus 86
structure length 319
sequence length 321
ec nomenclature
pdb deposition date 2014-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1190 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4rf1A02
3.10.20.540 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4rf1A01
3.90.70.90 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4rf1A03
2FE8A 4REZA 4P16A 4RF0A 4WURA 4RF1A 4R3DA 4RNAA 5E6JA 3MP2A 4OVZA 3MJ5A 4PT5A 4OVZB 4MM3B 3E9SA 4OW0A 4M0WA 5KO3A
chains in the Genus database with same CATH superfamily
3HVDA 1F77A 4TSSA 2W54A 4CHKA 4NL4H 2P86A 4XZXA 1NYQA 3KSJA 2IO1B 4GMVA 2EO2A 3TPZA 3V6EB 4FWDA 1NBFC 3HWSA 4GC5A 3VHTC 1E94E 2Y3AA 1EO6A 3PTFC 2KHHA 1I4QA 4IBEA 1V5TA 2JXNA 2MJ3A 1KFYB 1HTOA 1TY2A 3FUVA 4KIKA 1KHQA 4YYVA 4OHJA 2B3TA 2DZKA 2XH9A 5IOIA 2LHDA 2HL7A 4ZTBA 2KHWB 4S0RA 2BWBA 2JWZA 2LUMA 3OF8A 2WXNA 1ZMWA 1MJDA 1WJUA 3AOGA 1KF6B 1G41A 3PREA 4AWJA 2MQJA 3SYLA 3TUOA 4ZDVA 2UWQA 4GSWA 3MTNA 2C0YA 1E7VA 1J7BA 2ONQA 4L2YA 2KJRA 2L05A 3M0EA 3MC9A 3ZTCA 4RCOA 3IEJA 1KFXL 3M7GA 3JVZX 3Q3JA 2E3TA 1D6EC 1FNWA 4L8RC 1GL7A 1D3ZA 3DBRB 4YSXB 1S1QB 2BPSA 3EA6A 3CTWB 2LWPA 2XU5A 3K92A 4C56C 5CTRC 1T6BX 2KO3A 1L2DA 1O0EA 2BYTA 2KC1A 3H7PB 4PS8A 2QBYA 1QT9A 3DOAA 1HR0M 4EIWA 2QBYB 4E71A 2Y6EA 3GP1A 4XDCA 5E6PA 1UGJA 4GDLA 1IQPA 3N3KB 2MBEA 4LF5M 1RRBA 2K8CA 2DAEA 1BY8A 5J17A 4BFRA 2KZRA 1TU6A 1UF0A 4CO7A 1XLQA 2J53A 1V86A 1UWMA 2QHOA 1SF0A 2J5YA 5H37D 4LF4M 3GE3C 2BKFA 1QLBB 1VJKA 4JWSC 3UF8A 1LQBA 4LNKA 2LVQD 1WGNA 4LFCM 4GH9A 1NSFA 3S3QA 2K0BX 3IVFA 2FH0A 4XDDA 2WXMA 2AGAA 2FCQA 4AG5A 3QQ8B 1NPZA 3QIJA 2KOXA 3I4VA 1ATKA 4MGIE 3Q3OC 3U2SC 2MROB 4DUYM 1DGHB 2ZNVC 3KWLA 4BKSD 2QDFA 1MHXA 1RLFA 2PE9A 4LLGM 4LK0M 5CHVA 2BTWA 5EZSA 3DVNU 3I5JC 1PDXA 4HDQA 1E9SA 3BWKA 4FHKA 4LG2A 3TMPA 3RNGC 4LFAM 1EM7A 1A6RA 1CS8A 4W9IA 4WURA 3KFUG 3PDFA 3KWZA 3PFIA 3U6MA 4A6QA 3J7BA 2R0IA 4GKKM 1Q39A 4S12A 5JHBA 2DC7A 3U6CA 3MP2A 1N75A 3OTOM 2KVZA 3R2IA 3C3DA 4JXJA 3VDUA 3U6LA 2VIIA 2ZVNA 2CV0A 3PHXB 2F5NA 1V1OA 4YXDB 2KLGA 2MWSB 2RMMA 3EHVA 3LB8C 1EU4A 2LFIA 4BS6A 1UGMA 1GECE 1QOFA 4LJPB 2ERCA 4PCZA 2L2DA 4N8WA 2MA9B 1FJGM 2C9WB 3V76A 4YYRA 4B9KA 1PJSA 3BZDB 5AEKB 4BOSA 4IIWA 1WY8A 1GC7A 4GIPA 2K0PA 1NHGC 2D7HA 1IGDA 1WF9A 2XEWA 3PHWB 4LNOA 3RYTA 4YTNB 4DR2M 4OW0A 3TL4X 5EXSA 1C77A 2V4LA 3ZO5B 4MSMB 2NMQA 5ITXE 3M3JA 2DZLA 1OAIA 1WZ0A 4HPPA 1AECA 3N1XC 4CDCB 1PJQA 4NOOB 4HJGE 2MCNB 4IBBA 3R8FA 3W1SA 2INNE 4WH4A 1NNJA 3GLGA 3OLMD 2IBIA 4KHPM 3W5VB 4MB7A 1TGUA 3RPFC 3VXWA 1F1HA 3RVVA 2D07B 4GKJM 3NJTA 1ZMVA 4XGIA 2LNHC 4JN6A 2V9HA 1KYIA 3BY4B 4D81A 4KDIC 3H7SA 4MH8A 1LM8B 4QRGA 2E01A 4JV5M 2KFJA 2MSED 2TSSA 3KWVA 2BTEA 1P7FA 1QQRA 5ITYA 2WU5B 2CJNA 1THEA 1SNKA 1QOAA 2JXTA 4BBNF 1R4NB 4GDKA 1GVNA 3DF0A 5L8RF 3VVWB 4FW9A 4J3OD 1F52A 1ZDXA 3LQRA 3JYUA 4A20A 3U6SA 3Q6BA 1E7UA 3RNVA 3NHEA 1UBQA 4CISA 1YVBA 4KZ0A 4HDOA 1AU2A 1ET6A 1PJIA 1JROA 2CE7A 4RNAA 2RDHA 4DR4M 4A9AA 3MHHA 1WR1B 3HHIA 4B0EA 5D94A 4JI3M 4HJKA 3IG5A 3VKHA 4MJSB 2WXHA 4II3B 2RPQA 2NBUA 5HI1A 4HCPB 1SE9A 1SBBB 3BBZA 1JQPA 4RGOS 2JQRB 2W82A 3TWMA 4CDEB 2M19A 1XEEA 3W0FA 3A4SC 3PSEB 3A45A 1AN8A 3IBEA 1PM5A 2JYTA 4CZWA 2CB5A 2C9CA 1XF5L 3R2TA 1AW7A 4DV5M 5C1BA 3KOXE 1XHBA 2KZSA 2R44A 4FCTA 4C4VB 1C4PA 4GIVA 4MACA 4C4VA 4KGSA 2DCCA 1RFAA 1WIAA 2HE7A 3HK0A 3T3OA 3AI8A 1XMQM 2KD0A 1EWLA 5J2RA 2MW5A 2K5PA 4LNIA 3ZJTA 3LQQA 2EUCA 4FK5A 1H6UA 2RGFA 4ZUXU 2LJ5A 1YT7A 2XSZD 4G4OA 1TY0A 2G8LA 4QHSA 3SAVA 4I5SA 2OJWA 4W9GA 3MHZA 2FT2A 4NQLB 2UU9M 4HVBA 2KYWA 2UUBM 1IY0A 4OVVA 3UJNA 3C19A 2FUDA 2R61A 3UQBA 1WM3A 4AXMA 3JSVB 1OIPA 3T1YM 3FTEA 1WJ7A 1WZ3A 4K7SA 4EUTA 1WWTA 2LUEA 2OO9A 2D10A 2HHHM 3K1JA 2WXLA 5C2TB 4DV3M 1NL6A 3NVVA 4ANVA 3P1MA 3Q3FA 2G4DB 1UKFA 3I4YA 3L08A 4DR3M 1Z5AA 3NOBA 3P5VA 2O5RA 3SARA 1E8YA 2LGYA 2DX5B 1YJJA 3MTNB 3D6SA 1R7RA 2MR9A 2FCSA 2X38A 3C9EA 2N7EA 1QOLA 2V3SA 2XEPA 1PIPA 4IBDA 3ZXRA 4W5WA 2K39A 2WX0A 4UN2B 3HHZA 1FCLA 2H89B 4BS5A 1R4NI 1Y8GA 4P6EA 2J7QB 4MZSA 4DV7M 4E3CA 3W2DA 1PJJA 1IBXB 1VZ8A 1L1ZA 4YY3M 2KDEB 2Q5WD 4BQVA 1ENFA 1TF0B 4DV0M 1C7YA 1STEA 1UH6A 3HM3A 1BP4A 3HKPA 1F9JA 1TS4A 2HCBA 1Z5BA 1BGOA 1L0VB 1Y8RC 1VZ6A 1YNTE 3A4RA 1PGBA 4G4NA 4FBJB 2VZKD 3KVFB 1N5XA 2L09A 3ZNHA 4KV2A 3VDZA 1JWUD 3P42A 5DPTA 5H92C 1T3TA 2XK5B 3A1QB 4E74A 4DHJB 2Z7JA 2N7JA 1J7AA 3GZNI 3ONSA 5LXHA 4MM3B 2LXAA 3AXCA 3FRHA 4D80A 4AKHA 4LJ4A 2NVUI 1V49A 2DZNB 1P0RA 1AU0A 3KX1A 2C7NB 2OHFA 3EUB2 4II7A 3ZNGC 4LJOB 1CPJA 1E8WA 1V97A 1Q5WB 3A42A 4P7IA 2KXJA 4JX1C 2WHIA 4IJFA 2MJEA 3FYDA 4JI7M 1VSNA 2LVOC 1B1ZA 5BMHA 3RNAC 2I2YA 3VR8B 2JWSA 2JA2A 2NQDB 2G45B 4K81A 3GLGE 1K51A 2Z8LA 3C8YA 3IT4B 2MX2A 3NVYA 3HD3A 3BWUD 2ZPYA 2IO0B 3N1ZC 3DHIC 4JI1M 4BB9A 4I8OA 4PDIA 1A5RA 3TIXA 2K6BA 1YZBA 2JZPA 4DR5M 1WX7A 3LJ3A 4I81A 5KHQA 2F5OA 1MG4A 3U8ZA 4FULA 5BR8M 5MPOA 3VRBB 4BKSA 3J27B 2X8AA 1T0QC 2OP3A 2P0RA 3H4JA 1J09A 2J7OA 4LZJA 1WE6A 2A5YB 3V05A 1YN4A 3HU2A 4DXGA 3RGSA 2PVOD 2R9CA 3W67A 4CGYB 4JI8M 1Q3CA 2PREA 3MTVA 4XE0A 3ZGZA 5AZFA 1ZQ9A 2JZZA 3B21A 1ZKHA 1FXAA 4A3OA 4EOYA 2Y5PA 2C98A 1ROEA 2LMCA 2KQSA 1QAQA 1MPEA 5IT9S 3SFDB 1G4AE 1I4WA 3AU4A 5JA7A 3A9KB 3PHWA 2JZ0A 4A90A 2DAJA 2G4SA 1JWMD 2Y0TA 1CUKA 1Q02A 1ZE3D 2L8JA 3PRPB 1G71A 3QCAA 9PAPA 1SE3A 2QCUA 2DZIA 3AMZA 4GRIA 1GC6A 1HXYD 3B2FA 4I4LA 5EF4A 1FFUA 2WWZA 4IKGA 1WRIA 2HTME 1F2AA 1V81A 1MX0A 4K3BA 2CR5A 2BU3A 1YIWA 4RGNA 2KRUA 1U9WA 4N4ZA 1OEYJ 3GRRA 1KRHA 1ZW7A 3KOWE 3ZNZB 1B9RA 3P63A 4AJYB 4YTMB 4B3SM 2KNZA 3ZTDA 5DCNA 3AULA 1V34A 4BBAA 2XU1A 2L0TA 2CUZA 3KS8A 3QC8B 3T8MA 2A5UA 2AQ1B 3DBRI 1SXJC 3UGJA 2DLBA 1IP9A 3CBKA 5KPRA 5KHOA 4JI2M 2QC8A 1N61A 1TBEA 4PS7A 3HWNA 3Q3NC 1X37A 4CHTB 1N32M 1P3QU 1OAOC 1ZP0B 1OFFA 3HX3A 2KN4A 2WSCF 2JQFR 3WXGA 4B7GA 2IDYA 4HPMB 3O1GA 1FXTB 4II2B 2UUCM 1D5XC 2DYMA 3Q8EA 1I35A 1QZMA 1U4AA 2AL3A 3THGA 2CKHB 1IYFA 2V4IB 2R18A 5EXTA 1L2BA 3PT2B 3U6OA 1OTRB 5EGWA 2CRUA 2CWBA 4ZYSA 5EDSA 1JB0F 2DWLA 2PTLA 1N78A 2K1FA 2KFKB 4QNMA 2RPVA 1W5TA 3U30A 4LJAA 1DF0A 3U8EA 3WXFA 1DGHA 4F8CB 1U5IA 4KGRA 3IXSA 2JVCA 3HHMA 3TNXA 3RNCC 1IXSB 4URKA 1WR1A 3L54A 3R3MA 3L29A 5FR3A 2PADA 5JHAA 4W9LA 1TLOA 3DOWA 2ON8A 2G6DA 4LJ7A 3TL5A 2JQGR 1LFDA 4B6WA 1VRAB 3KUCB 4IUMB 3GZNB 2MLBA 2CHQA 1T5XD 4B3RM 1EIJA 1GAQB 4ZRKA 1Y08A 3PNYA 3R66C 2OJRA 2INCC 1ZV1A 1YX5B 2F7DA 3L10B 4YL8A 2APLA 3J80S 3BOSA 3AECB 3KYCD 4NJ6A 1NLJA 1HJPA 1YQ4B 2DC8A 4A3PA 4PT5A 2DJFB 4MGKE 4IOIE 3C58A 2BWES 1HA5A 5D3DA 2CFOA 1DGJA 4OZBA 2QCZA 4LRTA 1TDHA 5GKNA 2YJ8A 3OISA 5DNYA 1VLBA 1R2ZA 4LNNA 3BK1A 2FCMA 2I38A 2SEBD 2VF7A 5CHFA 1F2CA 2H5XA 2PMVA 2AUXA 2LASA 4K1RB 1WGLA 3J9CA 1F2RI 4JPSA 4FVMA 3UK6A 1NY6A 4NPNA 4O1NA 4RF0A 5CHVC 4XZ4A 1MI0A 1NI3A 2CHZA 2JRHA 5I4DA 4M0DA 2D11A 3ZDMC 2BJVA 2VQEM 4XK8F 2LZ6A 3HHAA 3UQAA 2Y5BA 3ZJVA 5JI3E 2JY6A 3H6SA 3AE4B 4FD2A 1WHCA 4RY2A 4OX9M 3M99A 3WHLA 3JSVA 1L2NA 2KX0A 5C18A 1NO1A 3K9MA 5FK9C 3HHWA 1T6OA 2G7YA 3A9JA 1V80A 3FTCA 3SMSA 3B89A 4JI4M 5ITXA 4MZOA 1R4MI 3IAM1 1TL9A 2BB6A 1PE6A 2EMTA 3I57A 2REXA 3OVXA 4LJ9A 2P5TA 2GMIC 4DV2M 2HHNA 4JI5M 4PP2E 2IY0B 1WGYA 2KAJA 3PVSA 3U5ZA 1KLVA 3HJQA 2XU4A 2RKOA 4OZAA 1PPOA 3P2BA 3I51A 4R7GA 4HCNB 5G2NA 2Z0DB 1GJSA 1QOGA 2OULA 3GPPA 3MC8A 2M1MA 2L7RA 3BC3A 1LGRA 5EZQA 2GFOA 2ZBKB 2EA0A 1DOXA 5BYQA 1Z5SB 2J4XA 4ZRPA 3CH3X 3KXEC 1ET9A 3D32A 2KVRA 2BJWA 5BO4B 2G3QA 2KWUB 4KT0F 1WJ4A 4X6HA 1UZXB 2WYQA 3QWLA 4WA6A 2NR2A 2F5PA 1J19A 1WM2A 1XQQA 8PCHA 1YE9A 2N35A 2V3NA 3M62B 4GHLA 4IBIA 3SFZA 2FO5A 1JR3E 1EU3A 2JYEA 4UDUC 1RWSA 5JH3A 4M0WB 3LYYA 2KWDA 4PDGA 1WGGA 2DAGA 1LV7A 2LH0A 3DPDA 2G8EA 3PHUA 1BXTA 3QHTA 3F5VA 3RN9C 5KQDA 2J7NA 3HJ8A 3TCAA 4CYEA 4JGHB 2M4NA 2JXXA 4GLSC 3VTUA 2DBYA 1HEZE 5JZEB 2ZANA 4DHJD 2KACA 4I6PA 1WX9A 3AEEB 2J0KA 3K9OA 5JZEA 2XK5A 5L83A 1JALA 1TR8A 1PRBA 2MBBB 3ZNID 4DDGD 1IXRC 2Z84A 1ZXHA 2JU6X 8CATA 1ZOYB 1SXJB 4GC9A 2OPFA 3ILKA 5BMIA 4BOPA 1C1KA 2DWQA 2K47A 2UU7A 4GITA 3EIHA 4FLHA 4B3MM 3SYKA 3WANA 4IDIA 3HIZA 4OVUA 3SEBA 2LXCA 1I4GA 4HPLB 2L52A 3VKGA 2JRIA 2OQ4A 3GRYA 3U60B 2P7UA 1MHHE 3PZ8A 3NY5A 2DAIA 2Z3XA 1MHWA 4TQ0A 1V1PA 3DZDA 3NWLA 2DZMA 2R9OA 3AI5A 3VTVA 1ME3A 2LJIA 3RZFA 4HXDB 3FTDA 4AOFA 3VUWA 1JRUA 2KJHB 1D2NA 1JR3A 1Z2MA 2YEPB 3DCGA 1E8XA 5LMNM 3HRDD 3CBJA 3SASA 5F3WA 3AJIB 4HWIB 3U4EG 2AUZA 3AB5A 2QP9X 5EP3A 2ZW0A 5HFYA 1LXDA 1FXIA 3VK8A 3LW5F 1NEKB 2WXRA 4P1BC 4YSYB 4N6EB 3MC0B 1VQ1A 3J2PB 1IGCA 3MP9A 3FKEA 5E6NA 3VRAB 1D4BA 1WGDA 1AU3A 2DENB 5GXGB 3GRVA 3KQ4A 2AYNA 4R71A 3JAMS 2K9XA 4P6VF 4US9A 2GNOA 1K3BB 3DVNV 4FJYA 5JI2E 2XBBC 3U5ZB 1WH3A 2VHFA 1IXZA 1I94M 4WAFA 1P9DU 2Z4RA 2N9LA 4N59A 2MBOA 3WALA 1XLOA 4BAXA 2X49A 4JL9A 5EP2A 3R9XB 1OFHA 5DPRA 3JR4A 1MG8A 2WGSA 2FNAA 4DR1M 3PW3A 1KHPA 1TH2A 3EC8A 1BUIC 1WX8A 3F75A 5CHTA 5DFLA 1IBXA 4I05A 3ZQ4A 1JW9D 4Z6YA 2HTHA 4M02A 4LF6M 2DCAA 2MH8A 3DBSA 4DDID 2G1EA 3NZSA 4NZLB 1F4IA 3L13A 5CVNB 1F0ZA 3IUTA 3ZW3A 3AEDB 1AIMA 3O65B 4M9SA 1GJZA 3RUIB 3TJPA 2LGSA 3APCA 4B7FA 3AE5B 2R62A 1TKYA 3B9PA 1ZPSA 4G54A 2KNBA 1YK7A 2DHZA 2UZJA 2C99A 5FPWA 2L7HA 2UYZB 2PJHA 1JWBD 4MGYE 4ZRIA 3N3GA 5IP4D 4OEMA 2L7IA 4B7HA 1R7SA 4LY6A 3V60A 2OEDA 3RE8A 1NV9A 1XCTL 3HUIA 2VH1A 2DZJA 3GLIB 4IJEA 2BBCA 3KDSE 4GGQA 3N1YC 4G11A 2J7QA 3CMMB 3QSDA 3PZ7A 3QK0A 3VLFB 1Z59A 3DBHB 5ITTA 2NQIA 1UWXA 3SHFA 2C7HA 3FUTA 2O6VA 2LVQA 5CVOB 4YYSA 2YNMD 4YHHM 2J7QC 2LWXA 2JF5A 2BS4B 4KKIA 4D8BA 2EELA 4GEWA 2BTWB 2BW2A 1VDVA 2HAKA 3KYDD 3DBLB 4GDLB 2N7DA 2K25A 5KQ8A 4YVAA 3WHKA 2WS3B 3RCZA 2CP8A 3NHEB 3E4RA 1PCIA 1XLNA 1GUAB 3O0UA 1AUAA 3E56A 4W9FA 1IWDA 1G6JA 5EE3A 1DGBA 2YFQA 4DXAB 4MSXA 4OU7A 4KKJA 1SE4A 2PKOA 3BPFA 5FLXS 1I7HA 3IHPC 3TEXA 1ZIVA 4X6IA 3TWKA 1VCBA 3SD5A 4NAWB 3CF2A 1GJTA 4M00A 4C7ZA 3H8BA 2WDVB 3AEAB 3CSFA 2FYEA 1AIPC 4JIOU 2N9KA 2Y5CA 3IMAA 4FCWA 3AFHA 3PSEA 1TH3A 2FTDA 4FADA 3UZUA 4LF8M 1ESFA 3MJ5A 1NYRA 2L32A 2PW9A 1GB1A 1PADA 4HRSA 4IWPA 2DI0A 2CV2A 1DGFA 4DHZE 4YYWA 2LGDA 1IUEA 1JWAD 1SGHA 2WU2B 5IAAC 3KOYE 5L95C 3NS8A 2JT4B 3PXGA 1V1PB 2FFJA 3MK6A 1KXRA 3TSSA 2D3CA 4QNRA 1MS6A 1IPGA 3VQIA 2QNJA 3KKUA 3U52E 2PE6B 3UI3A 1UFZA 3RFWA 3W5UB 1OGWA 2BT6A 2LI5A 4DUZM 3IHPA 2AYOB 4GXBA 2MBHA 1ZGUB 2KDFB 2CEAA 1JRPA 3ECIA 4ICUA 1SJED 3PRMA 4QRXA 2UXCM 1TDZA 1WFYA 2L3ZA 3K2LA 2ZCBA 5LXIB 4QHTA 4MSQB 4EZLA 3AEGB 4IBFA 3ZVVA 2KDMA 1HNZM 3MFGA 4MH0E 1YLAA 2GBMA 4C80A 3N9YC 2BWEA 4AZFA 2YLMA 2YJBA 1SIFA 2KDBA 2M0AA 2NCNA 1QF6A 2BKRB 4MGHA 2GBRA 3PVLA 5E6OA 3ZJUA 1KTKA 3SR6A 4DQOC 4XUIA 1CJEA 3LXSA 2KDIA 2C9OA 1C76A 3DWMA 4DMXA 5A24A 4FIPA 2ZAMA 2H88B 1VD2A 1TTEA 2DHRA 2GI9A 3B0AA 1HQRD 1QDTA 2QSFX 2BVCA 5LNK1 4PI3A 1Q3BA 1N6ZA 1FEHA 1PPPA 2DCDA 2AWTA 1GLNA 2CHVA 5TSSA 5EQTA 4A3VB 1PFDA 4XWTA 2EMSA 2AX5A 4B3TM 2ZAOA 2R2OA 3OJ4B 3QAQA 2H1RA 1UNSA 2FNJB 4LF9M 2L00B 2R4JA 4EKUA 3K9OB 1OFIA 3BY4A 1ZCMA 2KT7A 3HGIA 1V33A 2KNAA 4DR7M 1V8CA 4IBCA 4W9EA 2KW0A 3B7ZA 2CU1A 2L0FA 2W9NA 4K7UA 3QYBA 4LDTB 3NUHB 2KK8A 3URYA 2RGOA 2PIAA 5IREB 4P16A 1C1YB 3GLHE 4AUQC 4Q7JA 2XFTA 2IO2B 2CU3A 2O2VA 2UUAM 3X0WA 4BKGA 4NAWA 1IFYA 2WXFA 2GBNA 2C7MB 2SAKA 1EWYC 1SIJA 2IZVB 2L6OA 3RT3B 4AS1A 3ZLZA 4DHZB 1CMXB 4ZHOA 1PYWD 2JWUA 3VTWA 3FILA 1YMHE 2C5LC 3UMMA 1WGHA 2V6ZM 4KZCA 2N1VA 2M60A 2R46A 1F2RC 1U9VA 1QDRA 2DC6A 4D8IA 1EUVB 2RGHA 1I4XA 2GBKA 3LFYA 2BNKA 4ITQA 4IW0A 2QJLA 1Z5CA 2KKCA 4JI6M 4LDTD 4DBGB 1RAXA 3NBXX 5E6JA 1IY1A 3N32A 3E9SA 5A2QS 2WXIA 4F2LA 2WSFF 2WNMA 2KXEA 2ZCCA 3ZUNA 1C4AA 2O01F 1AU4A 1OQRA 4KODA 1XXHB 4N79A 1MFWA 1X1MA 3QAUA 2K6QA 1C4CA 2I1KA 1RU3A 5EXXA 4F1IA 1ZUD2 3P4QB 3K9PA 4ICVA 1GL6A 1FRDA 3AOEA 2YEPF 2KA6B 3FKYA 1TS5A 4XGAB 1MN3A 3C9PA 1HZ6A 4KGTA 5G5GA 1WMHB 3BINA 1DEUA 3RD2A 3AV8A 2QIEB 3BVMA 1P1AA 2B76B 1N33M 4DV4M 5J94A 5JH5C 2D3GA 2GLSA 1XXHE 3FUWA 1AYUA 1DKIA 5C1ZA 2DC9A 1G8PA 4KSLC 4P6GA 1V92A 4MI7A 3KP0E 1SEBD 3AE7B 2V1UA 3L28A 4L78A 4ANUA 1NJGA 3H1UA 5DYGA 3FUUA 4G3OA 2R65A 2JY7A 4L4UA 3NVWA 1TJEA 1XCQL 4BOQA 4IG7B 3BYTB 2BDZA 3TBLD 3HU3A 3C0RA 3GE8C 2HKJA 3HU1A 3D8BA 1FFVA 4ANXA 3BB7A 2BF8B 1Y56A 4GMQA 4RM8A 2JY5A 4KVGB 3PS6A 4PS3A 1KSFX 4DMYA 1L0YB 3B7QA 1I4HA 1RYJA 2OZ2A 3RNBC 4NXMM 4BLCA 2D3BA 3CGWA 5FSWA 3GLHB 2QILA 1R2YA 2ICIA 4WJPA 1OTRA 2HXZA 4PYZA 4DV1M 3U7DA 1M4VA 4LJ5A 3IFWB 2BYVE 4C00A 3UIOB 3Q8FA 3EECA 1P3QQ 1GOZA 5K16A 4NSOB 2Z8YM 3V3XA 2IO3B 1QDQA 1L7YA 2N1WA 3DHHC 1XB2B 2K22A 1E8ZA 2E03A 3U60A 1L6VA 2KX3A 3M63B 1ZXIA 2HJ8A 2O6VB 1NDDA 4HLQA 1NQCA 3J81S 4CIZA 3P4SB 1D0MA 3RGPA 1XC8A 2KTRA 3ZRCA 4JYAM 3A98B 3N30A 1L8QA 3B74A 1C78A 4WW0A 2KANA 2KTRB 1PGAA 2WXKA 5IA7A 2LGXA 2QHOB 5KPZA 1I4PA 2LTUA 1UD7A 3B08A 5ITUA 1WJ6A 3ML9A 2MRPA 1M6DA 2NQ8C 3GPXA 3TQSA 1J5EM 3AE6B 3TWLA 1QANA 2JUOA 1YQ3B 5LMUM 4OVZB 4X57B 5FTJA 3ZYYX 1Q0WB 4PP1A 4NNJB 1QYRA 3LDZE 4NXNM 2WXQA 3Q3MC 1U9XA 1SXTA 1ISNA 4YYQA 2JZ1A 1E10A 3KWBX 1ACCA 5ITQA 2W3RA 2LRUA 3BVGA 1S4VA 3WXEA 2DAFA 1IBLM 2RDGA 1M94A 3R8BA 3GRUA 1AYVA 4ZYNA 1V2YA 3MORA 4LF7M 5BYSA 4ANWA 5EXPA 3PNRA 3SATA 5EE1A 1VJVA 2HWKA 2BYFA 1L4DB 4IM2A 3LXFA 1E9MA 4JLCA 1WR6E 1J0GA 1CV8A 1NVMA 1MJGM 3M6AA 3GB1A 3O13A 4GOCA 4X64M 1DV0A 1VDDA 2XN9C 2DAKA 4RH6A 3RI7C 3RNFC 4B08A 4NRWA 1VG5A 3T9LA 4TKNA 1GNUA 3B7NA 2IPKD 3BK2A 2N9EB 2G5GX 5LLIA 3U7ZA 4PADA 4KO8A 5D3IB 5KPTA 1BQIA 4CDDB 3WA0A 3NZ3A 2OOAA 4K7WA 3V61A 2WDRB 5D2MB 2V1CA 3AE8B 3AE3B 3BPMA 5CVMA 4L16A 2QEJC 2JUJA 3SFEB 5FTLA 4OELA 3R7QA 1QZEA 2ZM6M 3KLSX 3ZUAA 2HDEA 2GBJA 2D3AA 3ZRFA 1GB4A 3N3KA 4K7CA 3JW0X 5G55A 2MHJA 2QPAA 1TTNA 3W0LB 2WXGA 4NAMA 1OQYA 4G4QA 4YSZB 4ASWC 3GPUA 1WI0A 1KM7A 4GDKB 1PVJA 3AM9A 1IM2A 4RMAA 2B1MA 3N4CA 3WAOA 1WXAA 2R2QA 1I42A 1QAOA 1E6EB 2PVGC 3GLIA 2CJOA 3B1LX 3L26A 3DQVA 5JXVA 2VQFM 1KFVA 1VEGA 3GOEA 2GRIA 1V5OA 4HROA 3Q8CA 3LVVA 3QARA 4ARIA 3OQCA 2WDTB 6PADA 3WIMA 4EEWA 1SXJE 3FRIA 1K52A 4IM3A 3OAWA 3SAWA 4JE3B 2DWNA 1JQ4A 3ZQJA 2MEKA 2VH2A 3VAWA 4L1BA 4C7YA 3TRKA 1HE8A 3PRZA 2OOBB 3MMPA 5KO3A 2ZNVB 1TKGA 4TV3A 4FA6A 3H7DA 2W3SA 2FQ9A 2HD5A 4LCBA 2F4VM 2VF8A 3ZNHB 1XWIA 2G8JA 1NENB 4XC2A 4AP4C 4IUMA 1NI2A 2JNHA 1K53A 2MP2A 1V9JA 2PLPA 3GCBA 3FYCA 2LHCA 4HL4A 1HUCB 1ME4A 2MP2B 3AOEC 1DOIA 2R9NA 1N77A 3ZCBB 3GLFA 2M17A 3VR9B 2F5QA 3PLUA 3NZUA 3RULA 2I1JA 3KUDB 3W1SC 2NTTA 3WCQA 1TYGB 1YK8A 4AKGA 2K9DA 1SE2A 2DVWB 1ZAEA 4EZKA 3GLIE 2Z0EB 4MM3A 3P5XA 3H4MA 3KW6A 1L1TA 1HNWM 1EWOA 1YX6B 1EF7A 2DNAA 2XGNA 3EFUA 3Q14C 4B95A 1FD6A 5AZHA 1TS2A 4FJVB 5HG2A 2C96A 4LRSA 3VK7A 2MH7A 3FC4A 3P4RB 2MBQA 4G6ZA 3DVGY 1E0ZA 2Z4SA 4W9JA 3QA8A 3VH4B 4FWHA 1F29A 4TQ1A 1R6BX 3FILB 2NS5A 3HVZA 1MU5A 3V6CB 1FNVA 4MJSA 4TUWA 1J8CA 3S2AA 2C60A 4BBNC 4DBGA 3L27A 1XNRM 2YVCA 3TEZA 4LZZA 4N9F4 1PQSA 3K24A 3R7RA 3ML8A 2NQAA 1TS3A 4NJCA 2YJ9A 3ZIMA 2O6VD 2G9HD 4CDFB 3ETRA 1IN8A 2LVAA 5AUKA 3DBLI 3IV2A 3W9CB 2MJ5B 2LGIA 3DA1A 2V3PA 4HKZE 3B9JA 1BVSA 3L2AA 3PPAA 3AL0C 2FRQA 3RZWC 3NG0A 2DNFA 4W9KA 2DHYA 2AYOA 1DGGA 3NS1A 3V6EA 2R45A 3CSTA 3DBHI 1UBIA 4ZHPA 3FAHA 2F5SA 5TR5A 4G3XB 3MHSD 1XD3B 4OZCA 4IBGA 1TZ1A 3DFZA 1YALA 2LVNC 3LMMA 3GPYA 1K82A 4KDLB 4XYCA 1WXMA 4BOUA 2CS4A 4ITKA 3HHYA 1QQWA 1PJTA 2CV1A 4Q2JA 3ENEA 3CIRB 4WQOB 2XNAC 4M8NA 3N20C 4H2AA 4G50A 1S3SA 1KJTA 2KN5A 3A9KA 4JWUC 3Q8AA 4LFBM 1EF1A 4W9HA 3K8UA 3EFCA 3AH7A 5IN7A 3W1YA 2R9MA 2LEKA 3HY5A 1EWCA 1DO2A 4G4RA 3PT2A 5D7GA 5FKAC 2LRWA 4W5BA 3C0RB 3V62A 3ZH9B 1ITOA 2KFKA 4YV8A 2DXIA 3P5WA 2DKLA 3GQ4A 4DXFA 3VH3B 3ZC7B 3PNVA 1A5TA 3EGRA 2KMCA 3U61B 1N63A 4FXCA 2IBIB 1J7CA 1S3SG 2F1GA 2UXDM 1WIVA 3A46A 2X4AA 3AEFB 2KNVA 3ABVB 2I7NA 2HH5A 3VFKA 4Q8HA 2IJ0A 1FNUA 1MDWA 4WIPA 2Y21A 4IBKA 2INDC 2IGGA 1GABA 4ZOHC 5EJCA 1W5SA 1TGZB 2KWCA 2D7GA 2AIMA 5IWAM 4X6JA 2YJ2A 4CQNA 1VZ7A 4G0NB 5IKCM 1Q6KA 4ACFA 2R6NA 4DWFA 2EKKA 2KQ4X 2O2VB 4DK5A 1JWSD 3JR5A 2LVPC 2ZTCA 4RF1A 1YN5A 2JRIB 4MT5A 5GMVA 3H89A 2XFSA 1K3WA 2R4EA 2FRAA 2W55A 2IPPB 2BS3B 2C5RA 4ZRJA 5DYIA 3SU8X 1SSNA 5DPSA 1XNQM 3WAMA 4GB9A 3LCUA 2D2QA 3DVGX 1PGXA 3GO8A 1KLGD 4EFOA 1L0XB 1UUPA 3KUZA 1HZ5A 4YYUA 2XF3A 3BIID 4K3CA 3AEBB 3TEYA 2ASQA 4I6NB 3B2GA 4ZRQA 4NRVA 2BDLA 4XX5A 4WP2A 2KLCA 4R3DA 3PLVA 1FH0A 4OVZA 3TE6A 3RVXA 2RRUA 4HEOA 1AWDA 1GO5A 4BOZA 3LCVB 1Y4HA 1NNUC 4MGZE 1H8CA 1WYWB 3T6PA 4B0MA 3AE2B 3BCNA 3PZDA 3PBHA 4W9DA 4DV6M 1IN5A 3QWZB 5DPWA 2YQZA 1DOYA 2IGHA 4FJZA 1G59A 1SXJD 3VDPA 2FUG1 3K9PB 4KX6B 4IP3A 4XR7A 1YUBA 4X66M 1PXVA 1CTEA 2VRRB 2E02A 2XU3A 1IBMM 4PYUA 1TZOA 2V1YA 1T0SC 5F02A 3PRPA 1OKSA 5EP1A 4FWGA 1WSPA 3A33B 1KH0A 3I3TA 3IG3A 4QOZC 3GLGB 4FN2A 1YJIA 2RDBC 3Q8XA 1CJLA 3SHGB 2LVOA 2ZZPB 2JY6B 1T0RC 2DWZB 1JQJC 2FCNA 4XBOA 5BMGA 3SAUA 1FCCC 1WGRA 1FMAD 1UM8A 4LNFA 1CB5A 2X8XX 3O65A 4EE2A 2KEBA 4QH6A 3A9JB 3HJSA 3KW5B 4A55A 1SG9A 1YN3A 3QX1A 1ZDVA 3BBAA 4AXLA 2YR0A 2EKFA 3T38A 1POPA 1X9YA 1YD8U 2ZW1A 3CF0A 2ZVOA 5IZ7D 4AJWA 4F1SA 1XO3A 2XZUA 3RMKC 3H9DA 2UXBM 2BQQA 2JTCA 2XSZA 3NRZA 1N34M 1WXVA 1QOBA 3I04M 5CHWA 2MJDA 2QENA 2IY1B 4KSKC 1XKGA 1N60A 1WE7A 1SJHD 3E21A 4HWYA 3OF9A 3RVWA 2WZJA 3FD9A 4P17A 1F2BA 3WAPA 3GQ3A 4YWGG 2AQ3B 4PK1A 2D7EA 1D5ZC 1EF5A 1NY5A 3LVWA 4LCDE 3U6EA 4I07A 2AVWA 4TMAB 1XLPA 2WP9B 2JX5A 4FJCA 3AKZA 4RKXA 2J52A 2WSEF 3U61A 1YQBA 4BOSC 3L4PA 1VR9A 1LTMA 1KOTA 2R9FA 1T0YA 3E46A 4GHAA 1CVZA 2L4EA 4AKIA 3U6DA 4BSQA 1NJFA 2KDLA 2VHSA 1N62A 1STFE 3W31A 3RFZB 4IWOA 2QSDA 3PHXA 1Q1OA 2Z59B 3L25A 4IC7B 2BS2B 4M8MA 1IY2A 1VDLA 4BOZB 2L1AA 3I01M 5C3JB 2IGDA 3P4PB 3PO0A 3UGBB 5PADA 1TKEA 2B3AA 4M9XA 1EWPA 2LHEA 2M8SA 1IBKM 1QILA 3IG8A 1IN6A 1FNNA 3QYEA 1WRDB 1MVKA 4LJ8A 3SBJA 3KP1E 2BYEA 1FIQA 1CQVA 2M56B 2LXEA 2FIDA 1OIZA 3OG5A 4WWNA 2FBWB 3UIPB 4NSRA 2ATOA 3KVWA 2WLBA 1BT0A 1OJLA 1Z6TA 1SB3C 1IN4A 3K8ZA 4K0KM 4AI6A 2BGFA 4D82A 1HT1E 2EJSA 2FE8A 3KOZE 1WXQA 1WYGA 2GB1A 4MELA 3M95A 3I3TB 1TIFA 2DZYA 1XMOM 4HEA1 1YOVB 2HJ1A 2VDBB 3PGEA 4KIKB 2FAZA 4BKTA 1KFUL 2QQ8A 4USAA 2DOSA 2K8HA 3U6PA 3OWEB 2GHUA 1K8RB 2N9XA 1E32A 2VZKB 1U9QX 5FTMA 4IM0A 2CHWA 2LD9A 2YJCA 1BMLC 1FRRA 5EE0A 3QJZA 2WX1A 2WXJA 2IYDB 1XXHA 4MEMA 4REZA 3W68A 3FUXA 3TEWA 4ARCA 4DR6M 1A70A 1NB5A 3CH2X 1MIRA 3VUYA 4RKUF 1AARA 1E5WA 4L6V6 7CATA 1L6UA 1TT5B 2FOIC 2G3QB 1GLOA 4D8EA 3FE3A 1WXSA 4AG6A 4W4UA 1C79A 5ITRA 3S3RA 3I9V1 4AW4A 2LBCA 1CK1A 3P5UA 1E9RA 5D6JB 3AU5A 4AQ7A 4S17A 3L0WB 2QMTA 1E7PB 1P7EA 4RFBA 1D5MC 3IAS1 1PGYA 1K50A 1PPNA 2V0GA 4N58A 3KW9A 1HT2E 2BWFA 2KC2A 4BPVA 5FTKA 2LVPA 1VEJA 4AQYM 2N4FA 1GKIA 1K3XA 2WDQB 3DHGC 2WXPA 5C23A 1HNXM 5BYRA 1GCBA 2DYBA 3NBIA 1C3TA 2E00A 2KMMA 4HLEA 1YJ1A 2NBWB 5HHDG 1GG3A 4M9ZA 5AZGA 2DZOB 1ICFA 1MEGA 3H8CA 4KLBA 1QKZA 5FR6A 2GQFA 2N9PC 3GLFB 2DZZA 2NBVB 2HWJA 3A1QA 4ANRA 1QAMA 3GLHA 1EWMA 2H7JA 1FPYA 2KQ7A 4M0WA 1J7KA 4ZPXA 3Q69A 2CHXA 3DWGC 3I06A 2WQYB 2AU1A 3UINB 1T43A 1ZMUA 3OVZA 3ALBA 2ZTDA 4HKQA 5IO9A 4J6IA 4L23A 2O6XA 2MGWA 2RR9A 2JP7A 4IWQA 4P1CC 3V6CA 2CIOA 1IXSA 4JQWC 1G3IA 4FHJA 1VEKA 1QUTA 4KLNA 2Y5BB 2O25A 2LHGA 3IECA 2ACTA 1AYWA 3TMPB 7PCKA 3BXWA 2RD0A 3EIEA 4WWOA 3W30A 4I6LB 2D5GA 2Y0QA 3BVZA 3MHVC 1CZPA 3KSXA 2M0XA 1NB3A 2WXOA 3SHQA 1EFUB 3PV1A 1JCKB 1E90A 2PPHA 2ZJDA 1DYQA 1YSYA 2PBHA 2KRKA 1PBHA 3SMPA 2AQ2B 2FIFA 2CHGA 1UELA 4QBBA 4QAYA 1C9FA 3PRMB 1HQCA 1Q10A 3USVA 4RGTA 2L4FA 1HTQA 3HM6X 1CQDA 4L15A 1WMHA 5J18A 2INPE 1JR3D 3L17A 2EKEC 4YT0B 3DDCB 2GOWA 4Y28F 5FTNA 3F92A 4WAAA 3ZXVA 1QXPA 4PD2A 1ORYB 4HXDA 4BZAA 5AUIA 3MJWA 4GUAA 1QUSA 1R4GA 1T3QA 3VUXA 2DWMA 4QRVA 3IFUA 1NV8A 4WJOA 3IOQA 2E5LM 3SC3A 2KTFA 1IN7A 3APFA 4HK2A 3Q8BA 2BB5A 3H7PA 4XWWA 3J7AS 3T1HM 2NQGA 5EP4A 2A4ZA 4QOSA 3NVZA 2DCBA 2JSVX 2M5ZA 3QJ3A 4LJ6A 4FCVA 3QT4A 1EE8A 4IBJA 2KZUA 3C3EA 2FUHB 4NY0A 2L76A 3Q2AC 2Y20A 2K3UA 2AEHA 2J0JA 3HHXA 1D0LA 2KJ6A 3E1ZB 1KLUD 2JPHA 3AN1A 1RFKA 4GU2A 5T8IA 4US8A 3KSEA 3VFDA 3H6NA 2Q2EB 1D0KA 3BYYB 2XLJA 3GP7A 3HZJA 2J42A 1AYFA 1OQQA 2L83A 2AHMA 5HKHA 2FS1A 1JMLA 2JY8A 5CX3A 3KFQA 2PEAA 4M01A 4F7ZA 1SXJA 4TUUA 4NC6A 4I04A 5E26A 1L4ZB 4RM9A 3GLFE 4YTPB 3ERVA 2ZEQA 1I4RA 2PNSA 1L2CA 3L16A 2RSUA 1PUTA 1QVRA 2ARYA 4W5CA 3CF6E 3KH0A 3I63C 2OOBA 4WJNA 4EZJA 4LGYA 1RM6C 2AL6A 3GS2A 1XT9B 1R4MB 3D8LA 3OJ3A 4RGMA 4BVUC 4WWMA 2EKIA 1MEMA 2HD5B 5EE9A 1SP4B 2K8BA 2DJGB 4JI0M 4Q8GA 2ZPNA 2JZ3B 1NHWC 2NTSA 2I7PA 3MHSA 2KMAA 4NJ7A 3SDLC 3AV0A 1N36M 4NQKE 3APDA 4LGMA 2WBFX 4Z8XA 1V6EA 2QZ4A 3T15A 5G5HA 4A8XC 3RNEC 1P98A 2NPTB 1DO0A 3H8HA 2E6XA 4WJQA 1GPXA 1N5WA 1R5LA 2AS8A 2DYOA 2NPTA 4GN1A 2B1NA 3Q8GA 3U6QA 1CSBB 2ACZB 3KS4A 3IT6B 1FO4A 1XXGA 4D2KA 2KWVB 1HQYE 4X62M 5BPVA 3X23A 3T3NA 3ZKJC 2DAMA 1PPDA 3ZDTA 1WGKA 2J0MA 2R6FA 4WWPA 1LO5D 5H8YE 1L5PA 1OEYA 2N0SB 4X65M 1NVID 3AE9B 2DENA 1QMYA 4W9CA 3CWIA 1H4RA 3FTFA 1TH4A 2K6DB 3GQ5A 4LTUA 3B79A 2XZFA 3BOWA 1GMYA 4MDKE 4WQMA 1FM0D 4A5UA 4CJ6A 1WJNA 3AE1B
chains in the Genus database with same CATH topology
3HVDA 1F77A 4TSSA 2W54A 4NL4H 4XZXA 1NYQA 3KSJA 2EO2A 3TPZA 4FWDA 3HWSA 4GC5A 1E94E 2Y3AA 1I4QA 4IBEA 2MJ3A 1KFYB 1TY2A 3FUVA 4OHJA 2XH9A 2LHDA 2HL7A 4ZTBA 2LUMA 2WXNA 3AOGA 1KF6B 1G41A 3SYLA 3TUOA 1J7BA 2ONQA 4L2YA 3M0EA 4RCOA 3M7GA 2E3TA 1D6EC 1FNWA 4L8RC 1GL7A 4YSXB 3EA6A 3CTWB 3K92A 4C56C 1T6BX 1L2DA 2BYTA 2QBYA 1QT9A 3DOAA 1HR0M 4EIWA 2QBYB 3GP1A 4XDCA 1UGJA 1IQPA 4LF5M 1XLQA 2J53A 1UWMA 1SF0A 5H37D 4LF4M 4JWSC 1QLBB 1VJKA 4LFCM 4GH9A 1NSFA 4XDDA 2WXMA 2AGAA 4AG5A 3I4VA 4MGIE 3U2SC 4DUYM 1DGHB 3KWLA 1MHXA 4LLGM 4LK0M 2BTWA 5EZSA 1PDXA 1E9SA 3TMPA 4LG2A 4LFAM 1EM7A 4WURA 3KFUG 3PFIA 3U6MA 4A6QA 3J7BA 4GKKM 1Q39A 4S12A 3U6CA 3MP2A 1N75A 3OTOM 3R2IA 4JXJA 3VDUA 3U6LA 2VIIA 2CV0A 2F5NA 1V1OA 4YXDB 2RMMA 3LB8C 1EU4A 2LFIA 1QOFA 2ERCA 4PCZA 1FJGM 3BZDB 4BOSA 4IIWA 4GIPA 2K0PA 1NHGC 2D7HA 1IGDA 4YTNB 4DR2M 4OW0A 3TL4X 5EXSA 1C77A 2NMQA 5ITXE 4NOOB 4HJGE 4IBBA 3R8FA 3W1SA 2INNE 4WH4A 1NNJA 3GLGA 4KHPM 3W5VB 4MB7A 1TGUA 3RPFC 4GKJM 4XGIA 2LNHC 4JN6A 1KYIA 4D81A 4MH8A 4JV5M 2TSSA 3KWVA 2BTEA 1P7FA 1QQRA 5ITYA 2WU5B 2CJNA 1QOAA 2JXTA 1GVNA 4FW9A 4J3OD 1ZDXA 3LQRA 3U6SA 3RNVA 4CISA 1ET6A 1PJIA 1JROA 2CE7A 4RNAA 2RDHA 4DR4M 4A9AA 4B0EA 4JI3M 3IG5A 3VKHA 2WXHA 5HI1A 1SBBB 4RGOS 2JQRB 2W82A 3TWMA 2M19A 1XEEA 3W0FA 3A45A 1AN8A 1PM5A 2JYTA 2C9CA 1XF5L 3R2TA 1AW7A 4DV5M 5C1BA 3KOXE 1XHBA 2KZSA 4FCTA 1C4PA 4MACA 4KGSA 3T3OA 1XMQM 2K5PA 3ZJTA 3LQQA 2EUCA 1H6UA 2XSZD 4G4OA 1TY0A 2G8LA 4QHSA 3SAVA 4I5SA 3MHZA 2UU9M 2UUBM 1IY0A 3UJNA 2R61A 3T1YM 3FTEA 1WWTA 2HHHM 3K1JA 2WXLA 5C2TB 4DV3M 3NVVA 3P1MA 1UKFA 3I4YA 4DR3M 1Z5AA 2O5RA 3SARA 1YJJA 1R7RA 2X38A 2XEPA 4IBDA 4W5WA 3HHZA 1FCLA 2H89B 4DV7M 3W2DA 1PJJA 1IBXB 1VZ8A 1L1ZA 4YY3M 2Q5WD 1ENFA 4DV0M 1STEA 3HKPA 1TS4A 2HCBA 1Z5BA 1L0VB 1VZ6A 1YNTE 1PGBA 4G4NA 3ZNHA 2VZKD 1N5XA 2L09A 1JWUD 3P42A 5H92C 1T3TA 2Z7JA 2N7JA 1J7AA 4MM3B 4D80A 4AKHA 4LJ4A 2DZNB 2OHFA 3EUB2 4II7A 1V97A 3A42A 4JX1C 4IJFA 2MJEA 3FYDA 4JI7M 1B1ZA 5BMHA 2I2YA 3VR8B 2JA2A 3IT4B 1K51A 2Z8LA 3C8YA 3NVYA 3BWUD 4JI1M 4BB9A 4I8OA 4PDIA 1YZBA 2JZPA 4DR5M 4I81A 2F5OA 5BR8M 5MPOA 3VRBB 3J27B 2X8AA 1J09A 2J7OA 4LZJA 2A5YB 3V05A 1YN4A 3HU2A 4DXGA 3RGSA 2PVOD 4CGYB 4JI8M 3MTVA 1Q3CA 4XE0A 3ZGZA 1ZQ9A 3B21A 1FXAA 2Y5PA 2C98A 1ROEA 2LMCA 1QAQA 1MPEA 5IT9S 3SFDB 1G4AE 1I4WA 3PHWA 4A90A 1JWMD 2Y0TA 1ZE3D 1SE3A 2QCUA 3AMZA 4GRIA 1HXYD 3B2FA 4I4LA 1FFUA 4IKGA 1WRIA 2HTME 1MX0A 2BU3A 4RGNA 2KRUA 3GRRA 1KRHA 1B9RA 3KOWE 3P63A 4YTMB 4B3SM 4BBAA 2CUZA 3KS8A 2AQ1B 1SXJC 3UGJA 2DLBA 5KPRA 4JI2M 1N61A 1X37A 4CHTB 1N32M 1ZP0B 1OFFA 2KN4A 4B7GA 2IDYA 2UUCM 1D5XC 2DYMA 3Q8EA 1QZMA 3THGA 2V4IB 2R18A 5EXTA 1L2BA 3U6OA 4ZYSA 2DWLA 2PTLA 1N78A 4QNMA 2RPVA 1W5TA 4LJAA 1DGHA 4KGRA 3IXSA 1IXSB 3L29A 5FR3A 2ON8A 4LJ7A 1VRAB 2CHQA 1T5XD 4B3RM 1GAQB 3PNYA 3J80S 3BOSA 3AECB 1YQ4B 4PT5A 4MGKE 4IOIE 3C58A 1HA5A 5D3DA 2CFOA 1DGJA 4OZBA 4LRTA 1TDHA 5GKNA 5DNYA 1VLBA 1R2ZA 3BK1A 2I38A 2SEBD 2PMVA 3J9CA 1F2RI 4JPSA 4FVMA 3UK6A 1NY6A 4O1NA 4RF0A 1MI0A 1NI3A 5I4DA 4M0DA 2BJVA 2VQEM 3ZJVA 5JI3E 3AE4B 4FD2A 4OX9M 3WHLA 5C18A 5FK9C 3HHWA 3FTCA 3SMSA 4JI4M 5ITXA 3IAM1 2BB6A 3I57A 4LJ9A 2P5TA 4DV2M 4JI5M 2KAJA 3PVSA 3U5ZA 3HJQA 2RKOA 4OZAA 3I51A 4R7GA 1QOGA 3GPPA 5EZQA 2ZBKB 2EA0A 1DOXA 5BYQA 2J4XA 4ZRPA 3KXEC 1ET9A 2BJWA 3QWLA 2F5PA 1YE9A 2V3NA 4GHLA 4IBIA 3SFZA 1EU3A 2JYEA 4UDUC 1RWSA 3LYYA 2KWDA 4PDGA 2LH0A 1LV7A 3PHUA 1BXTA 5KQDA 2J7NA 3HJ8A 4GLSC 2DBYA 1HEZE 2ZANA 2KACA 3AEEB 5JZEA 1JALA 1IXRC 2Z84A 1ZXHA 2JU6X 8CATA 1ZOYB 1SXJB 4GC9A 2OPFA 3ILKA 5BMIA 4BOPA 1C1KA 2DWQA 2K47A 4GITA 3EIHA 4B3MM 3SYKA 4IDIA 3SEBA 1I4GA 2L52A 3VKGA 2JRIA 2OQ4A 3GRYA 3U60B 1MHHE 3PZ8A 2Z3XA 4TQ0A 1V1PA 3DZDA 3NWLA 2LJIA 4HXDB 3FTDA 1D2NA 1JR3A 2YEPB 5LMNM 3HRDD 3SASA 5F3WA 3AJIB 3U4EG 3AB5A 2QP9X 5EP3A 2ZW0A 5HFYA 1FXIA 3VK8A 1NEKB 2WXRA 4YSYB 4N6EB 3MC0B 3J2PB 1IGCA 3MP9A 3FKEA 3VRAB 1D4BA 5GXGB 3GRVA 3KQ4A 3JAMS 2K9XA 4US9A 4P6VF 5JI2E 3U5ZB 1IXZA 1I94M 4WAFA 2Z4RA 2N9LA 4N59A 1XLOA 2X49A 5EP2A 3R9XB 1OFHA 3JR4A 2FNAA 4DR1M 1TH2A 1BUIC 1IBXA 3ZQ4A 1JW9D 4Z6YA 4LF6M 2G1EA 4NZLB 1F0ZA 3AEDB 4M9SA 4B7FA 3AE5B 2R62A 1TKYA 3B9PA 1ZPSA 2UZJA 2C99A 2L7HA 1JWBD 4MGYE 2L7IA 4B7HA 1R7SA 4LY6A 2OEDA 3RE8A 1XCTL 3HUIA 3GLIB 4IJEA 2BBCA 3KDSE 2J7QA 3PZ7A 3VLFB 1Z59A 5ITTA 1UWXA 3SHFA 3FUTA 2YNMD 4YHHM 2J7QC 2LWXA 2BS4B 4KKIA 4D8BA 2EELA 2BTWB 2BW2A 1VDVA 4GDLB 5KQ8A 3WHKA 2WS3B 3E4RA 1XLNA 3E56A 5EE3A 1DGBA 2YFQA 4OU7A 4KKJA 1SE4A 2PKOA 5FLXS 1I7HA 3TEXA 3TWKA 4NAWB 3CF2A 4C7ZA 2WDVB 3AEAB 2N9KA 2Y5CA 4FCWA 3AFHA 3PSEA 1TH3A 3UZUA 4LF8M 1ESFA 3MJ5A 1NYRA 2L32A 2PW9A 1GB1A 4HRSA 2CV2A 1DGFA 1IUEA 1JWAD 2WU2B 3KOYE 3PXGA 1V1PB 2FFJA 3MK6A 3TSSA 4QNRA 3VQIA 3U52E 3UI3A 3W5UB 3RFWA 2BT6A 4DUZM 2CEAA 1JRPA 1SJED 3PRMA 2UXCM 1TDZA 3K2LA 4QHTA 3AEGB 4IBFA 2KDMA 1HNZM 3MFGA 4MH0E 4C80A 3N9YC 4AZFA 2M0AA 1QF6A 4MGHA 3ZJUA 1KTKA 3SR6A 4DQOC 1CJEA 2C9OA 1C76A 3DWMA 2ZAMA 2H88B 2DHRA 2GI9A 1HQRD 5LNK1 1Q3BA 1FEHA 1GLNA 2CHVA 5TSSA 5EQTA 4A3VB 1PFDA 4XWTA 2AX5A 4B3TM 2ZAOA 2H1RA 1UNSA 4LF9M 2R4JA 1OFIA 3BY4A 3HGIA 4DR7M 1V8CA 4IBCA 2KW0A 3NUHB 3URYA 2RGOA 2PIAA 5IREB 4P16A 2XFTA 2CU3A 2UUAM 2WXFA 2SAKA 1EWYC 1SIJA 2L6OA 4AS1A 4ZHOA 1PYWD 2JWUA 3FILA 1YMHE 3UMMA 2V6ZM 2M60A 2R46A 1F2RC 4D8IA 2RGHA 1I4XA 2BNKA 4ITQA 2QJLA 1Z5CA 4JI6M 5E6JA 1IY1A 3E9SA 5A2QS 2WXIA 2WNMA 2KXEA 1C4AA 1OQRA 4KODA 1XXHB 3QAUA 1C4CA 5EXXA 1ZUD2 3P4QB 1GL6A 1FRDA 3AOEA 2YEPF 2KA6B 1TS5A 1HZ6A 4KGTA 5G5GA 3AV8A 2QIEB 3BVMA 2B76B 1N33M 4DV4M 3FUWA 1DKIA 1G8PA 4MI7A 3KP0E 1SEBD 3AE7B 2V1UA 3L28A 4L78A 1NJGA 5DYGA 3FUUA 2R65A 4L4UA 3NVWA 1TJEA 1XCQL 4BOQA 3BYTB 3C0RA 3HU3A 2HKJA 3HU1A 3D8BA 1FFVA 3BB7A 1Y56A 4GMQA 1KSFX 1L0YB 1I4HA 1RYJA 4NXMM 4BLCA 5FSWA 3GLHB 2QILA 1R2YA 2ICIA 4DV1M 1M4VA 4LJ5A 3Q8FA 1GOZA 4NSOB 3V3XA 2K22A 3U60A 1L6VA 1ZXIA 4HLQA 3J81S 3P4SB 3RGPA 1XC8A 4JYAM 3A98B 1L8QA 1C78A 4WW0A 1PGAA 2WXKA 5KPZA 1I4PA 5ITUA 2NQ8C 3GPXA 3TQSA 1J5EM 3AE6B 3TWLA 1QANA 1YQ3B 5LMUM 4OVZB 3ZYYX 5FTJA 1QYRA 4NXNM 2WXQA 1SXTA 1E10A 1ACCA 5ITQA 2W3RA 3BVGA 1IBLM 2RDGA 3R8BA 3GRUA 4LF7M 5BYSA 5EXPA 3SATA 5EE1A 2HWKA 1L4DB 3LXFA 1E9MA 1NVMA 3GB1A 3M6AA 3O13A 4RH6A 4X64M 1VDDA 2XN9C 4B08A 4NRWA 2IPKD 3BK2A 2G5GX 3U7ZA 4KO8A 5D3IB 5KPTA 3NZ3A 2WDRB 2V1CA 3AE8B 3AE3B 4L16A 2QEJC 3SFEB 5FTLA 2ZM6M 3KLSX 2HDEA 1GB4A 2QPAA 3W0LB 2WXGA 4NAMA 4G4QA 4YSZB 3GPUA 4GDKB 1PVJA 3AM9A 1IM2A 1QAOA 1E6EB 2PVGC 3GLIA 2CJOA 3L26A 5JXVA 2VQFM 1KFVA 2GRIA 4HROA 3Q8CA 3LVVA 4ARIA 3OQCA 1SXJE 1K52A 3SAWA 4JE3B 2DWNA 1JQ4A 2MEKA 3TRKA 4L1BA 4C7YA 5KO3A 1TKGA 2W3SA 4LCBA 2F4VM 1XWIA 1NENB 4IUMA 1K53A 2PLPA 3FYCA 4HL4A 3AOEC 1DOIA 1N77A 3ZCBB 3GLFA 3VR9B 2F5QA 2NTTA 3WCQA 1TYGB 4AKGA 1SE2A 2DVWB 1ZAEA 3H4MA 3KW6A 1L1TA 1HNWM 2XGNA 1FD6A 1TS2A 5HG2A 2C96A 4LRSA 3VK7A 2MH7A 3FC4A 3P4RB 4G6ZA 1E0ZA 2Z4SA 4FWHA 4TQ1A 1R6BX 3FILB 3HVZA 1MU5A 1FNVA 4TUWA 3L27A 1XNRM 3TEZA 4LZZA 1TS3A 4NJCA 2G9HD 3ETRA 1IN8A 5AUKA 3W9CB 2LGIA 3DA1A 2V3PA 4HKZE 3B9JA 3L2AA 3AL0C 1DGGA 3NS1A 2R45A 4ZHPA 3FAHA 2F5SA 4OZCA 4IBGA 3DFZA 3LMMA 3GPYA 1K82A 4BOUA 4ITKA 3HHYA 1QQWA 2CV1A 4Q2JA 3CIRB 2XNAC 4H2AA 1S3SA 4JWUC 3Q8AA 4LFBM 3AH7A 2LEKA 1EWCA 1DO2A 4G4RA 3PT2A 5D7GA 5FKAC 3ZH9B 2DXIA 3GQ4A 4DXFA 3ZC7B 3PNVA 3EGRA 3U61B 1N63A 4FXCA 1J7CA 2UXDM 3AEFB 2X4AA 3A46A 3ABVB 2I7NA 2IJ0A 1FNUA 4WIPA 2Y21A 4IBKA 2IGGA 4ZOHC 5EJCA 1W5SA 2D7GA 5IWAM 4CQNA 1VZ7A 2KQ4X 1JWSD 3JR5A 4RF1A 1YN5A 4MT5A 2XFSA 1K3WA 2R4EA 2W55A 2BS3B 2C5RA 5DYIA 1SSNA 1XNQM 1PGXA 3GO8A 1KLGD 1L0XB 1UUPA 1HZ5A 2XF3A 3BIID 3AEBB 3TEYA 3B2GA 4ZRQA 4NRVA 4R3DA 4OVZA 3TE6A 1AWDA 4BOZA 1NNUC 4MGZE 4B0MA 3AE2B 4DV6M 1IN5A 2YQZA 1DOYA 2IGHA 1G59A 1SXJD 3VDPA 2FUG1 4IP3A 4KX6B 1YUBA 4X66M 1IBMM 1TZOA 3PRPA 5EP1A 4FWGA 1WSPA 1KH0A 4QOZC 3GLGB 1YJIA 3Q8XA 3SHGB 2DWZB 1JQJC 4XBOA 5BMGA 3SAUA 1FCCC 1FMAD 1UM8A 3O65A 4EE2A 2KEBA 3HJSA 4A55A 1YN3A 3BBAA 1ZDVA 2YR0A 3T38A 2ZW1A 3CF0A 5IZ7D 1XO3A 2XZUA 2JTCA 2UXBM 2XSZA 3NRZA 1N34M 1QOBA 2MJDA 2QENA 1N60A 1SJHD 3FD9A 3GQ3A 4YWGG 2AQ3B 2D7EA 1D5ZC 1NY5A 3LVWA 3U6EA 4TMAB 1XLPA 2WP9B 2JX5A 3AKZA 4RKXA 2J52A 3U61A 3L4PA 1VR9A 4GHAA 4AKIA 3U6DA 1NJFA 1N62A 3W31A 3RFZB 2QSDA 3PHXA 3L25A 2BS2B 1IY2A 2L1AA 5C3JB 2IGDA 3P4PB 3PO0A 1TKEA 4M9XA 2LHEA 1IBKM 1QILA 3IG8A 1IN6A 1FNNA 1MVKA 4LJ8A 3SBJA 3KP1E 1FIQA 1CQVA 2M56B 2LXEA 2FBWB 4NSRA 3KVWA 2WLBA 1OJLA 1Z6TA 1SB3C 1IN4A 3K8ZA 4K0KM 4AI6A 4D82A 1HT1E 2FE8A 3KOZE 1WXQA 1WYGA 2GB1A 1XMOM 4HEA1 4USAA 2DOSA 3U6PA 3OWEB 1E32A 2VZKB 5FTMA 1BMLC 1FRRA 5EE0A 2WXJA 1XXHA 4REZA 3FUXA 3TEWA 4ARCA 4DR6M 1A70A 1L6UA 7CATA 2FOIC 4D8EA 4AG6A 1C79A 5ITRA 3I9V1 4AW4A 1CK1A 1E9RA 4AQ7A 2QMTA 1E7PB 1P7EA 4RFBA 1D5MC 3IAS1 1K50A 2V0GA 4N58A 1HT2E 5FTKA 4AQYM 1GKIA 1K3XA 2WDQB 2WXPA 1HNXM 5BYRA 3NBIA 2KMMA 5HHDG 4M9ZA 2DZOB 1QKZA 3GLFB 1QAMA 3GLHA 4M0WA 1J7KA 4ZPXA 3Q69A 3DWGC 2WQYB 4HKQA 4L23A 1G3IA 4KLNA 3EIEA 3W30A 2D5GA 2Y0QA 3BVZA 3MHVC 1CZPA 3KSXA 2WXOA 1JCKB 1DYQA 1YSYA 2KRKA 3SMPA 2AQ2B 2CHGA 1C9FA 1HQCA 1Q10A 4RGTA 4L15A 2INPE 1JR3D 4YT0B 5FTNA 4PD2A 1ORYB 5AUIA 4GUAA 1T3QA 2DWMA 3IFUA 2E5LM 3SC3A 1IN7A 3Q8BA 2BB5A 4XWWA 3J7AS 3T1HM 5EP4A 4QOSA 3NVZA 2JSVX 2M5ZA 4LJ6A 4FCVA 1EE8A 4IBJA 2KZUA 2Y20A 2K3UA 3HHXA 1KLUD 5T8IA 3AN1A 1RFKA 4US8A 3VFDA 2Q2EB 3BYYB 2XLJA 3GP7A 2J42A 1AYFA 1OQQA 2L83A 2AHMA 1JMLA 1SXJA 5E26A 1L4ZB 4YTPB 1I4RA 1L2CA 1PUTA 1QVRA 3CF6E 4LGYA 1RM6C 3GS2A 3D8LA 4RGMA 4WWMA 2EKIA 5EE9A 4JI0M 1NHWC 2NTSA 2I7PA 3AV0A 1N36M 4LGMA 4Z8XA 2QZ4A 3T15A 5G5HA 4A8XC 1DO0A 3H8HA 2E6XA 1GPXA 1N5WA 2DYOA 3U6QA 2ACZB 3KS4A 3IT6B 1FO4A 1XXGA 4D2KA 1HQYE 4X62M 5BPVA 3T3NA 1WGKA 1LO5D 5H8YE 1L5PA 2N0SB 4X65M 1NVID 3AE9B 3CWIA 3FTFA 1TH4A 3GQ5A 4LTUA 2XZFA 4WQMA 1FM0D 4A5UA 3AE1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FE8 A;  4REZ A;  4P16 A;  4RF0 A;  4WUR A;  4RF1 A;  4R3D A;  4RNA A;  5E6J A;  3MP2 A;  4OVZ A;  3MJ5 A;  4PT5 A;  4OVZ B;  4MM3 B;  3E9S A;  4OW0 A;  4M0W A;  5KO3 A; 
#chains in the Genus database with same CATH topology
 3HVD A;  1F77 A;  4TSS A;  2W54 A;  4CHK A;  4NL4 H;  2P86 A;  4XZX A;  1NYQ A;  3KSJ A;  2IO1 B;  4GMV A;  2EO2 A;  3TPZ A;  3V6E B;  4FWD A;  1NBF C;  3HWS A;  4GC5 A;  3VHT C;  1E94 E;  2Y3A A;  1EO6 A;  3PTF C;  2KHH A;  1I4Q A;  4IBE A;  1V5T A;  2JXN A;  2MJ3 A;  1KFY B;  1HTO A;  1TY2 A;  3FUV A;  4KIK A;  1KHQ A;  4YYV A;  4OHJ A;  2B3T A;  2DZK A;  2XH9 A;  5IOI A;  2LHD A;  2HL7 A;  4ZTB A;  2KHW B;  4S0R A;  2BWB A;  2JWZ A;  2LUM A;  3OF8 A;  2WXN A;  1ZMW A;  1MJD A;  1WJU A;  3AOG A;  1KF6 B;  1G41 A;  3PRE A;  4AWJ A;  2MQJ A;  3SYL A;  3TUO A;  4ZDV A;  2UWQ A;  4GSW A;  3MTN A;  2C0Y A;  1E7V A;  1J7B A;  2ONQ A;  4L2Y A;  2KJR A;  2L05 A;  3M0E A;  3MC9 A;  3ZTC A;  4RCO A;  3IEJ A;  1KFX L;  3M7G A;  3JVZ X;  3Q3J A;  2E3T A;  1D6E C;  1FNW A;  4L8R C;  1GL7 A;  1D3Z A;  3DBR B;  4YSX B;  1S1Q B;  2BPS A;  3EA6 A;  3CTW B;  2LWP A;  2XU5 A;  3K92 A;  4C56 C;  5CTR C;  1T6B X;  2KO3 A;  1L2D A;  1O0E A;  2BYT A;  2KC1 A;  3H7P B;  4PS8 A;  2QBY A;  1QT9 A;  3DOA A;  1HR0 M;  4EIW A;  2QBY B;  4E71 A;  2Y6E A;  3GP1 A;  4XDC A;  5E6P A;  1UGJ A;  4GDL A;  1IQP A;  3N3K B;  2MBE A;  4LF5 M;  1RRB A;  2K8C A;  2DAE A;  1BY8 A;  5J17 A;  4BFR A;  2KZR A;  1TU6 A;  1UF0 A;  4CO7 A;  1XLQ A;  2J53 A;  1V86 A;  1UWM A;  2QHO A;  1SF0 A;  2J5Y A;  5H37 D;  4LF4 M;  3GE3 C;  2BKF A;  1QLB B;  1VJK A;  4JWS C;  3UF8 A;  1LQB A;  4LNK A;  2LVQ D;  1WGN A;  4LFC M;  4GH9 A;  1NSF A;  3S3Q A;  2K0B X;  3IVF A;  2FH0 A;  4XDD A;  2WXM A;  2AGA A;  2FCQ A;  4AG5 A;  3QQ8 B;  1NPZ A;  3QIJ A;  2KOX A;  3I4V A;  1ATK A;  4MGI E;  3Q3O C;  3U2S C;  2MRO B;  4DUY M;  1DGH B;  2ZNV C;  3KWL A;  4BKS D;  2QDF A;  1MHX A;  1RLF A;  2PE9 A;  4LLG M;  4LK0 M;  5CHV A;  2BTW A;  5EZS A;  3DVN U;  3I5J C;  1PDX A;  4HDQ A;  1E9S A;  3BWK A;  4FHK A;  4LG2 A;  3TMP A;  3RNG C;  4LFA M;  1EM7 A;  1A6R A;  1CS8 A;  4W9I A;  4WUR A;  3KFU G;  3PDF A;  3KWZ A;  3PFI A;  3U6M A;  4A6Q A;  3J7B A;  2R0I A;  4GKK M;  1Q39 A;  4S12 A;  5JHB A;  2DC7 A;  3U6C A;  3MP2 A;  1N75 A;  3OTO M;  2KVZ A;  3R2I A;  3C3D A;  4JXJ A;  3VDU A;  3U6L A;  2VII A;  2ZVN A;  2CV0 A;  3PHX B;  2F5N A;  1V1O A;  4YXD B;  2KLG A;  2MWS B;  2RMM A;  3EHV A;  3LB8 C;  1EU4 A;  2LFI A;  4BS6 A;  1UGM A;  1GEC E;  1QOF A;  4LJP B;  2ERC A;  4PCZ A;  2L2D A;  4N8W A;  2MA9 B;  1FJG M;  2C9W B;  3V76 A;  4YYR A;  4B9K A;  1PJS A;  3BZD B;  5AEK B;  4BOS A;  4IIW A;  1WY8 A;  1GC7 A;  4GIP A;  2K0P A;  1NHG C;  2D7H A;  1IGD A;  1WF9 A;  2XEW A;  3PHW B;  4LNO A;  3RYT A;  4YTN B;  4DR2 M;  4OW0 A;  3TL4 X;  5EXS A;  1C77 A;  2V4L A;  3ZO5 B;  4MSM B;  2NMQ A;  5ITX E;  3M3J A;  2DZL A;  1OAI A;  1WZ0 A;  4HPP A;  1AEC A;  3N1X C;  4CDC B;  1PJQ A;  4NOO B;  4HJG E;  2MCN B;  4IBB A;  3R8F A;  3W1S A;  2INN E;  4WH4 A;  1NNJ A;  3GLG A;  3OLM D;  2IBI A;  4KHP M;  3W5V B;  4MB7 A;  1TGU A;  3RPF C;  3VXW A;  1F1H A;  3RVV A;  2D07 B;  4GKJ M;  3NJT A;  1ZMV A;  4XGI A;  2LNH C;  4JN6 A;  2V9H A;  1KYI A;  3BY4 B;  4D81 A;  4KDI C;  3H7S A;  4MH8 A;  1LM8 B;  4QRG A;  2E01 A;  4JV5 M;  2KFJ A;  2MSE D;  2TSS A;  3KWV A;  2BTE A;  1P7F A;  1QQR A;  5ITY A;  2WU5 B;  2CJN A;  1THE A;  1SNK A;  1QOA A;  2JXT A;  4BBN F;  1R4N B;  4GDK A;  1GVN A;  3DF0 A;  5L8R F;  3VVW B;  4FW9 A;  4J3O D;  1F52 A;  1ZDX A;  3LQR A;  3JYU A;  4A20 A;  3U6S A;  3Q6B A;  1E7U A;  3RNV A;  3NHE A;  1UBQ A;  4CIS A;  1YVB A;  4KZ0 A;  4HDO A;  1AU2 A;  1ET6 A;  1PJI A;  1JRO A;  2CE7 A;  4RNA A;  2RDH A;  4DR4 M;  4A9A A;  3MHH A;  1WR1 B;  3HHI A;  4B0E A;  5D94 A;  4JI3 M;  4HJK A;  3IG5 A;  3VKH A;  4MJS B;  2WXH A;  4II3 B;  2RPQ A;  2NBU A;  5HI1 A;  4HCP B;  1SE9 A;  1SBB B;  3BBZ A;  1JQP A;  4RGO S;  2JQR B;  2W82 A;  3TWM A;  4CDE B;  2M19 A;  1XEE A;  3W0F A;  3A4S C;  3PSE B;  3A45 A;  1AN8 A;  3IBE A;  1PM5 A;  2JYT A;  4CZW A;  2CB5 A;  2C9C A;  1XF5 L;  3R2T A;  1AW7 A;  4DV5 M;  5C1B A;  3KOX E;  1XHB A;  2KZS A;  2R44 A;  4FCT A;  4C4V B;  1C4P A;  4GIV A;  4MAC A;  4C4V A;  4KGS A;  2DCC A;  1RFA A;  1WIA A;  2HE7 A;  3HK0 A;  3T3O A;  3AI8 A;  1XMQ M;  2KD0 A;  1EWL A;  5J2R A;  2MW5 A;  2K5P A;  4LNI A;  3ZJT A;  3LQQ A;  2EUC A;  4FK5 A;  1H6U A;  2RGF A;  4ZUX U;  2LJ5 A;  1YT7 A;  2XSZ D;  4G4O A;  1TY0 A;  2G8L A;  4QHS A;  3SAV A;  4I5S A;  2OJW A;  4W9G A;  3MHZ A;  2FT2 A;  4NQL B;  2UU9 M;  4HVB A;  2KYW A;  2UUB M;  1IY0 A;  4OVV A;  3UJN A;  3C19 A;  2FUD A;  2R61 A;  3UQB A;  1WM3 A;  4AXM A;  3JSV B;  1OIP A;  3T1Y M;  3FTE A;  1WJ7 A;  1WZ3 A;  4K7S A;  4EUT A;  1WWT A;  2LUE A;  2OO9 A;  2D10 A;  2HHH M;  3K1J A;  2WXL A;  5C2T B;  4DV3 M;  1NL6 A;  3NVV A;  4ANV A;  3P1M A;  3Q3F A;  2G4D B;  1UKF A;  3I4Y A;  3L08 A;  4DR3 M;  1Z5A A;  3NOB A;  3P5V A;  2O5R A;  3SAR A;  1E8Y A;  2LGY A;  2DX5 B;  1YJJ A;  3MTN B;  3D6S A;  1R7R A;  2MR9 A;  2FCS A;  2X38 A;  3C9E A;  2N7E A;  1QOL A;  2V3S A;  2XEP A;  1PIP A;  4IBD A;  3ZXR A;  4W5W A;  2K39 A;  2WX0 A;  4UN2 B;  3HHZ A;  1FCL A;  2H89 B;  4BS5 A;  1R4N I;  1Y8G A;  4P6E A;  2J7Q B;  4MZS A;  4DV7 M;  4E3C A;  3W2D A;  1PJJ A;  1IBX B;  1VZ8 A;  1L1Z A;  4YY3 M;  2KDE B;  2Q5W D;  4BQV A;  1ENF A;  1TF0 B;  4DV0 M;  1C7Y A;  1STE A;  1UH6 A;  3HM3 A;  1BP4 A;  3HKP A;  1F9J A;  1TS4 A;  2HCB A;  1Z5B A;  1BGO A;  1L0V B;  1Y8R C;  1VZ6 A;  1YNT E;  3A4R A;  1PGB A;  4G4N A;  4FBJ B;  2VZK D;  3KVF B;  1N5X A;  2L09 A;  3ZNH A;  4KV2 A;  3VDZ A;  1JWU D;  3P42 A;  5DPT A;  5H92 C;  1T3T A;  2XK5 B;  3A1Q B;  4E74 A;  4DHJ B;  2Z7J A;  2N7J A;  1J7A A;  3GZN I;  3ONS A;  5LXH A;  4MM3 B;  2LXA A;  3AXC A;  3FRH A;  4D80 A;  4AKH A;  4LJ4 A;  2NVU I;  1V49 A;  2DZN B;  1P0R A;  1AU0 A;  3KX1 A;  2C7N B;  2OHF A;  3EUB 2;  4II7 A;  3ZNG C;  4LJO B;  1CPJ A;  1E8W A;  1V97 A;  1Q5W B;  3A42 A;  4P7I A;  2KXJ A;  4JX1 C;  2WHI A;  4IJF A;  2MJE A;  3FYD A;  4JI7 M;  1VSN A;  2LVO C;  1B1Z A;  5BMH A;  3RNA C;  2I2Y A;  3VR8 B;  2JWS A;  2JA2 A;  2NQD B;  2G45 B;  4K81 A;  3GLG E;  1K51 A;  2Z8L A;  3C8Y A;  3IT4 B;  2MX2 A;  3NVY A;  3HD3 A;  3BWU D;  2ZPY A;  2IO0 B;  3N1Z C;  3DHI C;  4JI1 M;  4BB9 A;  4I8O A;  4PDI A;  1A5R A;  3TIX A;  2K6B A;  1YZB A;  2JZP A;  4DR5 M;  1WX7 A;  3LJ3 A;  4I81 A;  5KHQ A;  2F5O A;  1MG4 A;  3U8Z A;  4FUL A;  5BR8 M;  5MPO A;  3VRB B;  4BKS A;  3J27 B;  2X8A A;  1T0Q C;  2OP3 A;  2P0R A;  3H4J A;  1J09 A;  2J7O A;  4LZJ A;  1WE6 A;  2A5Y B;  3V05 A;  1YN4 A;  3HU2 A;  4DXG A;  3RGS A;  2PVO D;  2R9C A;  3W67 A;  4CGY B;  4JI8 M;  1Q3C A;  2PRE A;  3MTV A;  4XE0 A;  3ZGZ A;  5AZF A;  1ZQ9 A;  2JZZ A;  3B21 A;  1ZKH A;  1FXA A;  4A3O A;  4EOY A;  2Y5P A;  2C98 A;  1ROE A;  2LMC A;  2KQS A;  1QAQ A;  1MPE A;  5IT9 S;  3SFD B;  1G4A E;  1I4W A;  3AU4 A;  5JA7 A;  3A9K B;  3PHW A;  2JZ0 A;  4A90 A;  2DAJ A;  2G4S A;  1JWM D;  2Y0T A;  1CUK A;  1Q02 A;  1ZE3 D;  2L8J A;  3PRP B;  1G71 A;  3QCA A;  9PAP A;  1SE3 A;  2QCU A;  2DZI A;  3AMZ A;  4GRI A;  1GC6 A;  1HXY D;  3B2F A;  4I4L A;  5EF4 A;  1FFU A;  2WWZ A;  4IKG A;  1WRI A;  2HTM E;  1F2A A;  1V81 A;  1MX0 A;  4K3B A;  2CR5 A;  2BU3 A;  1YIW A;  4RGN A;  2KRU A;  1U9W A;  4N4Z A;  1OEY J;  3GRR A;  1KRH A;  1ZW7 A;  3KOW E;  3ZNZ B;  1B9R A;  3P63 A;  4AJY B;  4YTM B;  4B3S M;  2KNZ A;  3ZTD A;  5DCN A;  3AUL A;  1V34 A;  4BBA A;  2XU1 A;  2L0T A;  2CUZ A;  3KS8 A;  3QC8 B;  3T8M A;  2A5U A;  2AQ1 B;  3DBR I;  1SXJ C;  3UGJ A;  2DLB A;  1IP9 A;  3CBK A;  5KPR A;  5KHO A;  4JI2 M;  2QC8 A;  1N61 A;  1TBE A;  4PS7 A;  3HWN A;  3Q3N C;  1X37 A;  4CHT B;  1N32 M;  1P3Q U;  1OAO C;  1ZP0 B;  1OFF A;  3HX3 A;  2KN4 A;  2WSC F;  2JQF R;  3WXG A;  4B7G A;  2IDY A;  4HPM B;  3O1G A;  1FXT B;  4II2 B;  2UUC M;  1D5X C;  2DYM A;  3Q8E A;  1I35 A;  1QZM A;  1U4A A;  2AL3 A;  3THG A;  2CKH B;  1IYF A;  2V4I B;  2R18 A;  5EXT A;  1L2B A;  3PT2 B;  3U6O A;  1OTR B;  5EGW A;  2CRU A;  2CWB A;  4ZYS A;  5EDS A;  1JB0 F;  2DWL A;  2PTL A;  1N78 A;  2K1F A;  2KFK B;  4QNM A;  2RPV A;  1W5T A;  3U30 A;  4LJA A;  1DF0 A;  3U8E A;  3WXF A;  1DGH A;  4F8C B;  1U5I A;  4KGR A;  3IXS A;  2JVC A;  3HHM A;  3TNX A;  3RNC C;  1IXS B;  4URK A;  1WR1 A;  3L54 A;  3R3M A;  3L29 A;  5FR3 A;  2PAD A;  5JHA A;  4W9L A;  1TLO A;  3DOW A;  2ON8 A;  2G6D A;  4LJ7 A;  3TL5 A;  2JQG R;  1LFD A;  4B6W A;  1VRA B;  3KUC B;  4IUM B;  3GZN B;  2MLB A;  2CHQ A;  1T5X D;  4B3R M;  1EIJ A;  1GAQ B;  4ZRK A;  1Y08 A;  3PNY A;  3R66 C;  2OJR A;  2INC C;  1ZV1 A;  1YX5 B;  2F7D A;  3L10 B;  4YL8 A;  2APL A;  3J80 S;  3BOS A;  3AEC B;  3KYC D;  4NJ6 A;  1NLJ A;  1HJP A;  1YQ4 B;  2DC8 A;  4A3P A;  4PT5 A;  2DJF B;  4MGK E;  4IOI E;  3C58 A;  2BWE S;  1HA5 A;  5D3D A;  2CFO A;  1DGJ A;  4OZB A;  2QCZ A;  4LRT A;  1TDH A;  5GKN A;  2YJ8 A;  3OIS A;  5DNY A;  1VLB A;  1R2Z A;  4LNN A;  3BK1 A;  2FCM A;  2I38 A;  2SEB D;  2VF7 A;  5CHF A;  1F2C A;  2H5X A;  2PMV A;  2AUX A;  2LAS A;  4K1R B;  1WGL A;  3J9C A;  1F2R I;  4JPS A;  4FVM A;  3UK6 A;  1NY6 A;  4NPN A;  4O1N A;  4RF0 A;  5CHV C;  4XZ4 A;  1MI0 A;  1NI3 A;  2CHZ A;  2JRH A;  5I4D A;  4M0D A;  2D11 A;  3ZDM C;  2BJV A;  2VQE M;  4XK8 F;  2LZ6 A;  3HHA A;  3UQA A;  2Y5B A;  3ZJV A;  5JI3 E;  2JY6 A;  3H6S A;  3AE4 B;  4FD2 A;  1WHC A;  4RY2 A;  4OX9 M;  3M99 A;  3WHL A;  3JSV A;  1L2N A;  2KX0 A;  5C18 A;  1NO1 A;  3K9M A;  5FK9 C;  3HHW A;  1T6O A;  2G7Y A;  3A9J A;  1V80 A;  3FTC A;  3SMS A;  3B89 A;  4JI4 M;  5ITX A;  4MZO A;  1R4M I;  3IAM 1;  1TL9 A;  2BB6 A;  1PE6 A;  2EMT A;  3I57 A;  2REX A;  3OVX A;  4LJ9 A;  2P5T A;  2GMI C;  4DV2 M;  2HHN A;  4JI5 M;  4PP2 E;  2IY0 B;  1WGY A;  2KAJ A;  3PVS A;  3U5Z A;  1KLV A;  3HJQ A;  2XU4 A;  2RKO A;  4OZA A;  1PPO A;  3P2B A;  3I51 A;  4R7G A;  4HCN B;  5G2N A;  2Z0D B;  1GJS A;  1QOG A;  2OUL A;  3GPP A;  3MC8 A;  2M1M A;  2L7R A;  3BC3 A;  1LGR A;  5EZQ A;  2GFO A;  2ZBK B;  2EA0 A;  1DOX A;  5BYQ A;  1Z5S B;  2J4X A;  4ZRP A;  3CH3 X;  3KXE C;  1ET9 A;  3D32 A;  2KVR A;  2BJW A;  5BO4 B;  2G3Q A;  2KWU B;  4KT0 F;  1WJ4 A;  4X6H A;  1UZX B;  2WYQ A;  3QWL A;  4WA6 A;  2NR2 A;  2F5P A;  1J19 A;  1WM2 A;  1XQQ A;  8PCH A;  1YE9 A;  2N35 A;  2V3N A;  3M62 B;  4GHL A;  4IBI A;  3SFZ A;  2FO5 A;  1JR3 E;  1EU3 A;  2JYE A;  4UDU C;  1RWS A;  5JH3 A;  4M0W B;  3LYY A;  2KWD A;  4PDG A;  1WGG A;  2DAG A;  1LV7 A;  2LH0 A;  3DPD A;  2G8E A;  3PHU A;  1BXT A;  3QHT A;  3F5V A;  3RN9 C;  5KQD A;  2J7N A;  3HJ8 A;  3TCA A;  4CYE A;  4JGH B;  2M4N A;  2JXX A;  4GLS C;  3VTU A;  2DBY A;  1HEZ E;  5JZE B;  2ZAN A;  4DHJ D;  2KAC A;  4I6P A;  1WX9 A;  3AEE B;  2J0K A;  3K9O A;  5JZE A;  2XK5 A;  5L83 A;  1JAL A;  1TR8 A;  1PRB A;  2MBB B;  3ZNI D;  4DDG D;  1IXR C;  2Z84 A;  1ZXH A;  2JU6 X;  8CAT A;  1ZOY B;  1SXJ B;  4GC9 A;  2OPF A;  3ILK A;  5BMI A;  4BOP A;  1C1K A;  2DWQ A;  2K47 A;  2UU7 A;  4GIT A;  3EIH A;  4FLH A;  4B3M M;  3SYK A;  3WAN A;  4IDI A;  3HIZ A;  4OVU A;  3SEB A;  2LXC A;  1I4G A;  4HPL B;  2L52 A;  3VKG A;  2JRI A;  2OQ4 A;  3GRY A;  3U60 B;  2P7U A;  1MHH E;  3PZ8 A;  3NY5 A;  2DAI A;  2Z3X A;  1MHW A;  4TQ0 A;  1V1P A;  3DZD A;  3NWL A;  2DZM A;  2R9O A;  3AI5 A;  3VTV A;  1ME3 A;  2LJI A;  3RZF A;  4HXD B;  3FTD A;  4AOF A;  3VUW A;  1JRU A;  2KJH B;  1D2N A;  1JR3 A;  1Z2M A;  2YEP B;  3DCG A;  1E8X A;  5LMN M;  3HRD D;  3CBJ A;  3SAS A;  5F3W A;  3AJI B;  4HWI B;  3U4E G;  2AUZ A;  3AB5 A;  2QP9 X;  5EP3 A;  2ZW0 A;  5HFY A;  1LXD A;  1FXI A;  3VK8 A;  3LW5 F;  1NEK B;  2WXR A;  4P1B C;  4YSY B;  4N6E B;  3MC0 B;  1VQ1 A;  3J2P B;  1IGC A;  3MP9 A;  3FKE A;  5E6N A;  3VRA B;  1D4B A;  1WGD A;  1AU3 A;  2DEN B;  5GXG B;  3GRV A;  3KQ4 A;  2AYN A;  4R71 A;  3JAM S;  2K9X A;  4P6V F;  4US9 A;  2GNO A;  1K3B B;  3DVN V;  4FJY A;  5JI2 E;  2XBB C;  3U5Z B;  1WH3 A;  2VHF A;  1IXZ A;  1I94 M;  4WAF A;  1P9D U;  2Z4R A;  2N9L A;  4N59 A;  2MBO A;  3WAL A;  1XLO A;  4BAX A;  2X49 A;  4JL9 A;  5EP2 A;  3R9X B;  1OFH A;  5DPR A;  3JR4 A;  1MG8 A;  2WGS A;  2FNA A;  4DR1 M;  3PW3 A;  1KHP A;  1TH2 A;  3EC8 A;  1BUI C;  1WX8 A;  3F75 A;  5CHT A;  5DFL A;  1IBX A;  4I05 A;  3ZQ4 A;  1JW9 D;  4Z6Y A;  2HTH A;  4M02 A;  4LF6 M;  2DCA A;  2MH8 A;  3DBS A;  4DDI D;  2G1E A;  3NZS A;  4NZL B;  1F4I A;  3L13 A;  5CVN B;  1F0Z A;  3IUT A;  3ZW3 A;  3AED B;  1AIM A;  3O65 B;  4M9S A;  1GJZ A;  3RUI B;  3TJP A;  2LGS A;  3APC A;  4B7F A;  3AE5 B;  2R62 A;  1TKY A;  3B9P A;  1ZPS A;  4G54 A;  2KNB A;  1YK7 A;  2DHZ A;  2UZJ A;  2C99 A;  5FPW A;  2L7H A;  2UYZ B;  2PJH A;  1JWB D;  4MGY E;  4ZRI A;  3N3G A;  5IP4 D;  4OEM A;  2L7I A;  4B7H A;  1R7S A;  4LY6 A;  3V60 A;  2OED A;  3RE8 A;  1NV9 A;  1XCT L;  3HUI A;  2VH1 A;  2DZJ A;  3GLI B;  4IJE A;  2BBC A;  3KDS E;  4GGQ A;  3N1Y C;  4G11 A;  2J7Q A;  3CMM B;  3QSD A;  3PZ7 A;  3QK0 A;  3VLF B;  1Z59 A;  3DBH B;  5ITT A;  2NQI A;  1UWX A;  3SHF A;  2C7H A;  3FUT A;  2O6V A;  2LVQ A;  5CVO B;  4YYS A;  2YNM D;  4YHH M;  2J7Q C;  2LWX A;  2JF5 A;  2BS4 B;  4KKI A;  4D8B A;  2EEL A;  4GEW A;  2BTW B;  2BW2 A;  1VDV A;  2HAK A;  3KYD D;  3DBL B;  4GDL B;  2N7D A;  2K25 A;  5KQ8 A;  4YVA A;  3WHK A;  2WS3 B;  3RCZ A;  2CP8 A;  3NHE B;  3E4R A;  1PCI A;  1XLN A;  1GUA B;  3O0U A;  1AUA A;  3E56 A;  4W9F A;  1IWD A;  1G6J A;  5EE3 A;  1DGB A;  2YFQ A;  4DXA B;  4MSX A;  4OU7 A;  4KKJ A;  1SE4 A;  2PKO A;  3BPF A;  5FLX S;  1I7H A;  3IHP C;  3TEX A;  1ZIV A;  4X6I A;  3TWK A;  1VCB A;  3SD5 A;  4NAW B;  3CF2 A;  1GJT A;  4M00 A;  4C7Z A;  3H8B A;  2WDV B;  3AEA B;  3CSF A;  2FYE A;  1AIP C;  4JIO U;  2N9K A;  2Y5C A;  3IMA A;  4FCW A;  3AFH A;  3PSE A;  1TH3 A;  2FTD A;  4FAD A;  3UZU A;  4LF8 M;  1ESF A;  3MJ5 A;  1NYR A;  2L32 A;  2PW9 A;  1GB1 A;  1PAD A;  4HRS A;  4IWP A;  2DI0 A;  2CV2 A;  1DGF A;  4DHZ E;  4YYW A;  2LGD A;  1IUE A;  1JWA D;  1SGH A;  2WU2 B;  5IAA C;  3KOY E;  5L95 C;  3NS8 A;  2JT4 B;  3PXG A;  1V1P B;  2FFJ A;  3MK6 A;  1KXR A;  3TSS A;  2D3C A;  4QNR A;  1MS6 A;  1IPG A;  3VQI A;  2QNJ A;  3KKU A;  3U52 E;  2PE6 B;  3UI3 A;  1UFZ A;  3RFW A;  3W5U B;  1OGW A;  2BT6 A;  2LI5 A;  4DUZ M;  3IHP A;  2AYO B;  4GXB A;  2MBH A;  1ZGU B;  2KDF B;  2CEA A;  1JRP A;  3ECI A;  4ICU A;  1SJE D;  3PRM A;  4QRX A;  2UXC M;  1TDZ A;  1WFY A;  2L3Z A;  3K2L A;  2ZCB A;  5LXI B;  4QHT A;  4MSQ B;  4EZL A;  3AEG B;  4IBF A;  3ZVV A;  2KDM A;  1HNZ M;  3MFG A;  4MH0 E;  1YLA A;  2GBM A;  4C80 A;  3N9Y C;  2BWE A;  4AZF A;  2YLM A;  2YJB A;  1SIF A;  2KDB A;  2M0A A;  2NCN A;  1QF6 A;  2BKR B;  4MGH A;  2GBR A;  3PVL A;  5E6O A;  3ZJU A;  1KTK A;  3SR6 A;  4DQO C;  4XUI A;  1CJE A;  3LXS A;  2KDI A;  2C9O A;  1C76 A;  3DWM A;  4DMX A;  5A24 A;  4FIP A;  2ZAM A;  2H88 B;  1VD2 A;  1TTE A;  2DHR A;  2GI9 A;  3B0A A;  1HQR D;  1QDT A;  2QSF X;  2BVC A;  5LNK 1;  4PI3 A;  1Q3B A;  1N6Z A;  1FEH A;  1PPP A;  2DCD A;  2AWT A;  1GLN A;  2CHV A;  5TSS A;  5EQT A;  4A3V B;  1PFD A;  4XWT A;  2EMS A;  2AX5 A;  4B3T M;  2ZAO A;  2R2O A;  3OJ4 B;  3QAQ A;  2H1R A;  1UNS A;  2FNJ B;  4LF9 M;  2L00 B;  2R4J A;  4EKU A;  3K9O B;  1OFI A;  3BY4 A;  1ZCM A;  2KT7 A;  3HGI A;  1V33 A;  2KNA A;  4DR7 M;  1V8C A;  4IBC A;  4W9E A;  2KW0 A;  3B7Z A;  2CU1 A;  2L0F A;  2W9N A;  4K7U A;  3QYB A;  4LDT B;  3NUH B;  2KK8 A;  3URY A;  2RGO A;  2PIA A;  5IRE B;  4P16 A;  1C1Y B;  3GLH E;  4AUQ C;  4Q7J A;  2XFT A;  2IO2 B;  2CU3 A;  2O2V A;  2UUA M;  3X0W A;  4BKG A;  4NAW A;  1IFY A;  2WXF A;  2GBN A;  2C7M B;  2SAK A;  1EWY C;  1SIJ A;  2IZV B;  2L6O A;  3RT3 B;  4AS1 A;  3ZLZ A;  4DHZ B;  1CMX B;  4ZHO A;  1PYW D;  2JWU A;  3VTW A;  3FIL A;  1YMH E;  2C5L C;  3UMM A;  1WGH A;  2V6Z M;  4KZC A;  2N1V A;  2M60 A;  2R46 A;  1F2R C;  1U9V A;  1QDR A;  2DC6 A;  4D8I A;  1EUV B;  2RGH A;  1I4X A;  2GBK A;  3LFY A;  2BNK A;  4ITQ A;  4IW0 A;  2QJL A;  1Z5C A;  2KKC A;  4JI6 M;  4LDT D;  4DBG B;  1RAX A;  3NBX X;  5E6J A;  1IY1 A;  3N32 A;  3E9S A;  5A2Q S;  2WXI A;  4F2L A;  2WSF F;  2WNM A;  2KXE A;  2ZCC A;  3ZUN A;  1C4A A;  2O01 F;  1AU4 A;  1OQR A;  4KOD A;  1XXH B;  4N79 A;  1MFW A;  1X1M A;  3QAU A;  2K6Q A;  1C4C A;  2I1K A;  1RU3 A;  5EXX A;  4F1I A;  1ZUD 2;  3P4Q B;  3K9P A;  4ICV A;  1GL6 A;  1FRD A;  3AOE A;  2YEP F;  2KA6 B;  3FKY A;  1TS5 A;  4XGA B;  1MN3 A;  3C9P A;  1HZ6 A;  4KGT A;  5G5G A;  1WMH B;  3BIN A;  1DEU A;  3RD2 A;  3AV8 A;  2QIE B;  3BVM A;  1P1A A;  2B76 B;  1N33 M;  4DV4 M;  5J94 A;  5JH5 C;  2D3G A;  2GLS A;  1XXH E;  3FUW A;  1AYU A;  1DKI A;  5C1Z A;  2DC9 A;  1G8P A;  4KSL C;  4P6G A;  1V92 A;  4MI7 A;  3KP0 E;  1SEB D;  3AE7 B;  2V1U A;  3L28 A;  4L78 A;  4ANU A;  1NJG A;  3H1U A;  5DYG A;  3FUU A;  4G3O A;  2R65 A;  2JY7 A;  4L4U A;  3NVW A;  1TJE A;  1XCQ L;  4BOQ A;  4IG7 B;  3BYT B;  2BDZ A;  3TBL D;  3HU3 A;  3C0R A;  3GE8 C;  2HKJ A;  3HU1 A;  3D8B A;  1FFV A;  4ANX A;  3BB7 A;  2BF8 B;  1Y56 A;  4GMQ A;  4RM8 A;  2JY5 A;  4KVG B;  3PS6 A;  4PS3 A;  1KSF X;  4DMY A;  1L0Y B;  3B7Q A;  1I4H A;  1RYJ A;  2OZ2 A;  3RNB C;  4NXM M;  4BLC A;  2D3B A;  3CGW A;  5FSW A;  3GLH B;  2QIL A;  1R2Y A;  2ICI A;  4WJP A;  1OTR A;  2HXZ A;  4PYZ A;  4DV1 M;  3U7D A;  1M4V A;  4LJ5 A;  3IFW B;  2BYV E;  4C00 A;  3UIO B;  3Q8F A;  3EEC A;  1P3Q Q;  1GOZ A;  5K16 A;  4NSO B;  2Z8Y M;  3V3X A;  2IO3 B;  1QDQ A;  1L7Y A;  2N1W A;  3DHH C;  1XB2 B;  2K22 A;  1E8Z A;  2E03 A;  3U60 A;  1L6V A;  2KX3 A;  3M63 B;  1ZXI A;  2HJ8 A;  2O6V B;  1NDD A;  4HLQ A;  1NQC A;  3J81 S;  4CIZ A;  3P4S B;  1D0M A;  3RGP A;  1XC8 A;  2KTR A;  3ZRC A;  4JYA M;  3A98 B;  3N30 A;  1L8Q A;  3B74 A;  1C78 A;  4WW0 A;  2KAN A;  2KTR B;  1PGA A;  2WXK A;  5IA7 A;  2LGX A;  2QHO B;  5KPZ A;  1I4P A;  2LTU A;  1UD7 A;  3B08 A;  5ITU A;  1WJ6 A;  3ML9 A;  2MRP A;  1M6D A;  2NQ8 C;  3GPX A;  3TQS A;  1J5E M;  3AE6 B;  3TWL A;  1QAN A;  2JUO A;  1YQ3 B;  5LMU M;  4OVZ B;  4X57 B;  5FTJ A;  3ZYY X;  1Q0W B;  4PP1 A;  4NNJ B;  1QYR A;  3LDZ E;  4NXN M;  2WXQ A;  3Q3M C;  1U9X A;  1SXT A;  1ISN A;  4YYQ A;  2JZ1 A;  1E10 A;  3KWB X;  1ACC A;  5ITQ A;  2W3R A;  2LRU A;  3BVG A;  1S4V A;  3WXE A;  2DAF A;  1IBL M;  2RDG A;  1M94 A;  3R8B A;  3GRU A;  1AYV A;  4ZYN A;  1V2Y A;  3MOR A;  4LF7 M;  5BYS A;  4ANW A;  5EXP A;  3PNR A;  3SAT A;  5EE1 A;  1VJV A;  2HWK A;  2BYF A;  1L4D B;  4IM2 A;  3LXF A;  1E9M A;  4JLC A;  1WR6 E;  1J0G A;  1CV8 A;  1NVM A;  1MJG M;  3M6A A;  3GB1 A;  3O13 A;  4GOC A;  4X64 M;  1DV0 A;  1VDD A;  2XN9 C;  2DAK A;  4RH6 A;  3RI7 C;  3RNF C;  4B08 A;  4NRW A;  1VG5 A;  3T9L A;  4TKN A;  1GNU A;  3B7N A;  2IPK D;  3BK2 A;  2N9E B;  2G5G X;  5LLI A;  3U7Z A;  4PAD A;  4KO8 A;  5D3I B;  5KPT A;  1BQI A;  4CDD B;  3WA0 A;  3NZ3 A;  2OOA A;  4K7W A;  3V61 A;  2WDR B;  5D2M B;  2V1C A;  3AE8 B;  3AE3 B;  3BPM A;  5CVM A;  4L16 A;  2QEJ C;  2JUJ A;  3SFE B;  5FTL A;  4OEL A;  3R7Q A;  1QZE A;  2ZM6 M;  3KLS X;  3ZUA A;  2HDE A;  2GBJ A;  2D3A A;  3ZRF A;  1GB4 A;  3N3K A;  4K7C A;  3JW0 X;  5G55 A;  2MHJ A;  2QPA A;  1TTN A;  3W0L B;  2WXG A;  4NAM A;  1OQY A;  4G4Q A;  4YSZ B;  4ASW C;  3GPU A;  1WI0 A;  1KM7 A;  4GDK B;  1PVJ A;  3AM9 A;  1IM2 A;  4RMA A;  2B1M A;  3N4C A;  3WAO A;  1WXA A;  2R2Q A;  1I42 A;  1QAO A;  1E6E B;  2PVG C;  3GLI A;  2CJO A;  3B1L X;  3L26 A;  3DQV A;  5JXV A;  2VQF M;  1KFV A;  1VEG A;  3GOE A;  2GRI A;  1V5O A;  4HRO A;  3Q8C A;  3LVV A;  3QAR A;  4ARI A;  3OQC A;  2WDT B;  6PAD A;  3WIM A;  4EEW A;  1SXJ E;  3FRI A;  1K52 A;  4IM3 A;  3OAW A;  3SAW A;  4JE3 B;  2DWN A;  1JQ4 A;  3ZQJ A;  2MEK A;  2VH2 A;  3VAW A;  4L1B A;  4C7Y A;  3TRK A;  1HE8 A;  3PRZ A;  2OOB B;  3MMP A;  5KO3 A;  2ZNV B;  1TKG A;  4TV3 A;  4FA6 A;  3H7D A;  2W3S A;  2FQ9 A;  2HD5 A;  4LCB A;  2F4V M;  2VF8 A;  3ZNH B;  1XWI A;  2G8J A;  1NEN B;  4XC2 A;  4AP4 C;  4IUM A;  1NI2 A;  2JNH A;  1K53 A;  2MP2 A;  1V9J A;  2PLP A;  3GCB A;  3FYC A;  2LHC A;  4HL4 A;  1HUC B;  1ME4 A;  2MP2 B;  3AOE C;  1DOI A;  2R9N A;  1N77 A;  3ZCB B;  3GLF A;  2M17 A;  3VR9 B;  2F5Q A;  3PLU A;  3NZU A;  3RUL A;  2I1J A;  3KUD B;  3W1S C;  2NTT A;  3WCQ A;  1TYG B;  1YK8 A;  4AKG A;  2K9D A;  1SE2 A;  2DVW B;  1ZAE A;  4EZK A;  3GLI E;  2Z0E B;  4MM3 A;  3P5X A;  3H4M A;  3KW6 A;  1L1T A;  1HNW M;  1EWO A;  1YX6 B;  1EF7 A;  2DNA A;  2XGN A;  3EFU A;  3Q14 C;  4B95 A;  1FD6 A;  5AZH A;  1TS2 A;  4FJV B;  5HG2 A;  2C96 A;  4LRS A;  3VK7 A;  2MH7 A;  3FC4 A;  3P4R B;  2MBQ A;  4G6Z A;  3DVG Y;  1E0Z A;  2Z4S A;  4W9J A;  3QA8 A;  3VH4 B;  4FWH A;  1F29 A;  4TQ1 A;  1R6B X;  3FIL B;  2NS5 A;  3HVZ A;  1MU5 A;  3V6C B;  1FNV A;  4MJS A;  4TUW A;  1J8C A;  3S2A A;  2C60 A;  4BBN C;  4DBG A;  3L27 A;  1XNR M;  2YVC A;  3TEZ A;  4LZZ A;  4N9F 4;  1PQS A;  3K24 A;  3R7R A;  3ML8 A;  2NQA A;  1TS3 A;  4NJC A;  2YJ9 A;  3ZIM A;  2O6V D;  2G9H D;  4CDF B;  3ETR A;  1IN8 A;  2LVA A;  5AUK A;  3DBL I;  3IV2 A;  3W9C B;  2MJ5 B;  2LGI A;  3DA1 A;  2V3P A;  4HKZ E;  3B9J A;  1BVS A;  3L2A A;  3PPA A;  3AL0 C;  2FRQ A;  3RZW C;  3NG0 A;  2DNF A;  4W9K A;  2DHY A;  2AYO A;  1DGG A;  3NS1 A;  3V6E A;  2R45 A;  3CST A;  3DBH I;  1UBI A;  4ZHP A;  3FAH A;  2F5S A;  5TR5 A;  4G3X B;  3MHS D;  1XD3 B;  4OZC A;  4IBG A;  1TZ1 A;  3DFZ A;  1YAL A;  2LVN C;  3LMM A;  3GPY A;  1K82 A;  4KDL B;  4XYC A;  1WXM A;  4BOU A;  2CS4 A;  4ITK A;  3HHY A;  1QQW A;  1PJT A;  2CV1 A;  4Q2J A;  3ENE A;  3CIR B;  4WQO B;  2XNA C;  4M8N A;  3N20 C;  4H2A A;  4G50 A;  1S3S A;  1KJT A;  2KN5 A;  3A9K A;  4JWU C;  3Q8A A;  4LFB M;  1EF1 A;  4W9H A;  3K8U A;  3EFC A;  3AH7 A;  5IN7 A;  3W1Y A;  2R9M A;  2LEK A;  3HY5 A;  1EWC A;  1DO2 A;  4G4R A;  3PT2 A;  5D7G A;  5FKA C;  2LRW A;  4W5B A;  3C0R B;  3V62 A;  3ZH9 B;  1ITO A;  2KFK A;  4YV8 A;  2DXI A;  3P5W A;  2DKL A;  3GQ4 A;  4DXF A;  3VH3 B;  3ZC7 B;  3PNV A;  1A5T A;  3EGR A;  2KMC A;  3U61 B;  1N63 A;  4FXC A;  2IBI B;  1J7C A;  1S3S G;  2F1G A;  2UXD M;  1WIV A;  3A46 A;  2X4A A;  3AEF B;  2KNV A;  3ABV B;  2I7N A;  2HH5 A;  3VFK A;  4Q8H A;  2IJ0 A;  1FNU A;  1MDW A;  4WIP A;  2Y21 A;  4IBK A;  2IND C;  2IGG A;  1GAB A;  4ZOH C;  5EJC A;  1W5S A;  1TGZ B;  2KWC A;  2D7G A;  2AIM A;  5IWA M;  4X6J A;  2YJ2 A;  4CQN A;  1VZ7 A;  4G0N B;  5IKC M;  1Q6K A;  4ACF A;  2R6N A;  4DWF A;  2EKK A;  2KQ4 X;  2O2V B;  4DK5 A;  1JWS D;  3JR5 A;  2LVP C;  2ZTC A;  4RF1 A;  1YN5 A;  2JRI B;  4MT5 A;  5GMV A;  3H89 A;  2XFS A;  1K3W A;  2R4E A;  2FRA A;  2W55 A;  2IPP B;  2BS3 B;  2C5R A;  4ZRJ A;  5DYI A;  3SU8 X;  1SSN A;  5DPS A;  1XNQ M;  3WAM A;  4GB9 A;  3LCU A;  2D2Q A;  3DVG X;  1PGX A;  3GO8 A;  1KLG D;  4EFO A;  1L0X B;  1UUP A;  3KUZ A;  1HZ5 A;  4YYU A;  2XF3 A;  3BII D;  4K3C A;  3AEB B;  3TEY A;  2ASQ A;  4I6N B;  3B2G A;  4ZRQ A;  4NRV A;  2BDL A;  4XX5 A;  4WP2 A;  2KLC A;  4R3D A;  3PLV A;  1FH0 A;  4OVZ A;  3TE6 A;  3RVX A;  2RRU A;  4HEO A;  1AWD A;  1GO5 A;  4BOZ A;  3LCV B;  1Y4H A;  1NNU C;  4MGZ E;  1H8C A;  1WYW B;  3T6P A;  4B0M A;  3AE2 B;  3BCN A;  3PZD A;  3PBH A;  4W9D A;  4DV6 M;  1IN5 A;  3QWZ B;  5DPW A;  2YQZ A;  1DOY A;  2IGH A;  4FJZ A;  1G59 A;  1SXJ D;  3VDP A;  2FUG 1;  3K9P B;  4KX6 B;  4IP3 A;  4XR7 A;  1YUB A;  4X66 M;  1PXV A;  1CTE A;  2VRR B;  2E02 A;  2XU3 A;  1IBM M;  4PYU A;  1TZO A;  2V1Y A;  1T0S C;  5F02 A;  3PRP A;  1OKS A;  5EP1 A;  4FWG A;  1WSP A;  3A33 B;  1KH0 A;  3I3T A;  3IG3 A;  4QOZ C;  3GLG B;  4FN2 A;  1YJI A;  2RDB C;  3Q8X A;  1CJL A;  3SHG B;  2LVO A;  2ZZP B;  2JY6 B;  1T0R C;  2DWZ B;  1JQJ C;  2FCN A;  4XBO A;  5BMG A;  3SAU A;  1FCC C;  1WGR A;  1FMA D;  1UM8 A;  4LNF A;  1CB5 A;  2X8X X;  3O65 A;  4EE2 A;  2KEB A;  4QH6 A;  3A9J B;  3HJS A;  3KW5 B;  4A55 A;  1SG9 A;  1YN3 A;  3QX1 A;  1ZDV A;  3BBA A;  4AXL A;  2YR0 A;  2EKF A;  3T38 A;  1POP A;  1X9Y A;  1YD8 U;  2ZW1 A;  3CF0 A;  2ZVO A;  5IZ7 D;  4AJW A;  4F1S A;  1XO3 A;  2XZU A;  3RMK C;  3H9D A;  2UXB M;  2BQQ A;  2JTC A;  2XSZ A;  3NRZ A;  1N34 M;  1WXV A;  1QOB A;  3I04 M;  5CHW A;  2MJD A;  2QEN A;  2IY1 B;  4KSK C;  1XKG A;  1N60 A;  1WE7 A;  1SJH D;  3E21 A;  4HWY A;  3OF9 A;  3RVW A;  2WZJ A;  3FD9 A;  4P17 A;  1F2B A;  3WAP A;  3GQ3 A;  4YWG G;  2AQ3 B;  4PK1 A;  2D7E A;  1D5Z C;  1EF5 A;  1NY5 A;  3LVW A;  4LCD E;  3U6E A;  4I07 A;  2AVW A;  4TMA B;  1XLP A;  2WP9 B;  2JX5 A;  4FJC A;  3AKZ A;  4RKX A;  2J52 A;  2WSE F;  3U61 A;  1YQB A;  4BOS C;  3L4P A;  1VR9 A;  1LTM A;  1KOT A;  2R9F A;  1T0Y A;  3E46 A;  4GHA A;  1CVZ A;  2L4E A;  4AKI A;  3U6D A;  4BSQ A;  1NJF A;  2KDL A;  2VHS A;  1N62 A;  1STF E;  3W31 A;  3RFZ B;  4IWO A;  2QSD A;  3PHX A;  1Q1O A;  2Z59 B;  3L25 A;  4IC7 B;  2BS2 B;  4M8M A;  1IY2 A;  1VDL A;  4BOZ B;  2L1A A;  3I01 M;  5C3J B;  2IGD A;  3P4P B;  3PO0 A;  3UGB B;  5PAD A;  1TKE A;  2B3A A;  4M9X A;  1EWP A;  2LHE A;  2M8S A;  1IBK M;  1QIL A;  3IG8 A;  1IN6 A;  1FNN A;  3QYE A;  1WRD B;  1MVK A;  4LJ8 A;  3SBJ A;  3KP1 E;  2BYE A;  1FIQ A;  1CQV A;  2M56 B;  2LXE A;  2FID A;  1OIZ A;  3OG5 A;  4WWN A;  2FBW B;  3UIP B;  4NSR A;  2ATO A;  3KVW A;  2WLB A;  1BT0 A;  1OJL A;  1Z6T A;  1SB3 C;  1IN4 A;  3K8Z A;  4K0K M;  4AI6 A;  2BGF A;  4D82 A;  1HT1 E;  2EJS A;  2FE8 A;  3KOZ E;  1WXQ A;  1WYG A;  2GB1 A;  4MEL A;  3M95 A;  3I3T B;  1TIF A;  2DZY A;  1XMO M;  4HEA 1;  1YOV B;  2HJ1 A;  2VDB B;  3PGE A;  4KIK B;  2FAZ A;  4BKT A;  1KFU L;  2QQ8 A;  4USA A;  2DOS A;  2K8H A;  3U6P A;  3OWE B;  2GHU A;  1K8R B;  2N9X A;  1E32 A;  2VZK B;  1U9Q X;  5FTM A;  4IM0 A;  2CHW A;  2LD9 A;  2YJC A;  1BML C;  1FRR A;  5EE0 A;  3QJZ A;  2WX1 A;  2WXJ A;  2IYD B;  1XXH A;  4MEM A;  4REZ A;  3W68 A;  3FUX A;  3TEW A;  4ARC A;  4DR6 M;  1A70 A;  1NB5 A;  3CH2 X;  1MIR A;  3VUY A;  4RKU F;  1AAR A;  1E5W A;  4L6V 6;  7CAT A;  1L6U A;  1TT5 B;  2FOI C;  2G3Q B;  1GLO A;  4D8E A;  3FE3 A;  1WXS A;  4AG6 A;  4W4U A;  1C79 A;  5ITR A;  3S3R A;  3I9V 1;  4AW4 A;  2LBC A;  1CK1 A;  3P5U A;  1E9R A;  5D6J B;  3AU5 A;  4AQ7 A;  4S17 A;  3L0W B;  2QMT A;  1E7P B;  1P7E A;  4RFB A;  1D5M C;  3IAS 1;  1PGY A;  1K50 A;  1PPN A;  2V0G A;  4N58 A;  3KW9 A;  1HT2 E;  2BWF A;  2KC2 A;  4BPV A;  5FTK A;  2LVP A;  1VEJ A;  4AQY M;  2N4F A;  1GKI A;  1K3X A;  2WDQ B;  3DHG C;  2WXP A;  5C23 A;  1HNX M;  5BYR A;  1GCB A;  2DYB A;  3NBI A;  1C3T A;  2E00 A;  2KMM A;  4HLE A;  1YJ1 A;  2NBW B;  5HHD G;  1GG3 A;  4M9Z A;  5AZG A;  2DZO B;  1ICF A;  1MEG A;  3H8C A;  4KLB A;  1QKZ A;  5FR6 A;  2GQF A;  2N9P C;  3GLF B;  2DZZ A;  2NBV B;  2HWJ A;  3A1Q A;  4ANR A;  1QAM A;  3GLH A;  1EWM A;  2H7J A;  1FPY A;  2KQ7 A;  4M0W A;  1J7K A;  4ZPX A;  3Q69 A;  2CHX A;  3DWG C;  3I06 A;  2WQY B;  2AU1 A;  3UIN B;  1T43 A;  1ZMU A;  3OVZ A;  3ALB A;  2ZTD A;  4HKQ A;  5IO9 A;  4J6I A;  4L23 A;  2O6X A;  2MGW A;  2RR9 A;  2JP7 A;  4IWQ A;  4P1C C;  3V6C A;  2CIO A;  1IXS A;  4JQW C;  1G3I A;  4FHJ A;  1VEK A;  1QUT A;  4KLN A;  2Y5B B;  2O25 A;  2LHG A;  3IEC A;  2ACT A;  1AYW A;  3TMP B;  7PCK A;  3BXW A;  2RD0 A;  3EIE A;  4WWO A;  3W30 A;  4I6L B;  2D5G A;  2Y0Q A;  3BVZ A;  3MHV C;  1CZP A;  3KSX A;  2M0X A;  1NB3 A;  2WXO A;  3SHQ A;  1EFU B;  3PV1 A;  1JCK B;  1E90 A;  2PPH A;  2ZJD A;  1DYQ A;  1YSY A;  2PBH A;  2KRK A;  1PBH A;  3SMP A;  2AQ2 B;  2FIF A;  2CHG A;  1UEL A;  4QBB A;  4QAY A;  1C9F A;  3PRM B;  1HQC A;  1Q10 A;  3USV A;  4RGT A;  2L4F A;  1HTQ A;  3HM6 X;  1CQD A;  4L15 A;  1WMH A;  5J18 A;  2INP E;  1JR3 D;  3L17 A;  2EKE C;  4YT0 B;  3DDC B;  2GOW A;  4Y28 F;  5FTN A;  3F92 A;  4WAA A;  3ZXV A;  1QXP A;  4PD2 A;  1ORY B;  4HXD A;  4BZA A;  5AUI A;  3MJW A;  4GUA A;  1QUS A;  1R4G A;  1T3Q A;  3VUX A;  2DWM A;  4QRV A;  3IFU A;  1NV8 A;  4WJO A;  3IOQ A;  2E5L M;  3SC3 A;  2KTF A;  1IN7 A;  3APF A;  4HK2 A;  3Q8B A;  2BB5 A;  3H7P A;  4XWW A;  3J7A S;  3T1H M;  2NQG A;  5EP4 A;  2A4Z A;  4QOS A;  3NVZ A;  2DCB A;  2JSV X;  2M5Z A;  3QJ3 A;  4LJ6 A;  4FCV A;  3QT4 A;  1EE8 A;  4IBJ A;  2KZU A;  3C3E A;  2FUH B;  4NY0 A;  2L76 A;  3Q2A C;  2Y20 A;  2K3U A;  2AEH A;  2J0J A;  3HHX A;  1D0L A;  2KJ6 A;  3E1Z B;  1KLU D;  2JPH A;  3AN1 A;  1RFK A;  4GU2 A;  5T8I A;  4US8 A;  3KSE A;  3VFD A;  3H6N A;  2Q2E B;  1D0K A;  3BYY B;  2XLJ A;  3GP7 A;  3HZJ A;  2J42 A;  1AYF A;  1OQQ A;  2L83 A;  2AHM A;  5HKH A;  2FS1 A;  1JML A;  2JY8 A;  5CX3 A;  3KFQ A;  2PEA A;  4M01 A;  4F7Z A;  1SXJ A;  4TUU A;  4NC6 A;  4I04 A;  5E26 A;  1L4Z B;  4RM9 A;  3GLF E;  4YTP B;  3ERV A;  2ZEQ A;  1I4R A;  2PNS A;  1L2C A;  3L16 A;  2RSU A;  1PUT A;  1QVR A;  2ARY A;  4W5C A;  3CF6 E;  3KH0 A;  3I63 C;  2OOB A;  4WJN A;  4EZJ A;  4LGY A;  1RM6 C;  2AL6 A;  3GS2 A;  1XT9 B;  1R4M B;  3D8L A;  3OJ3 A;  4RGM A;  4BVU C;  4WWM A;  2EKI A;  1MEM A;  2HD5 B;  5EE9 A;  1SP4 B;  2K8B A;  2DJG B;  4JI0 M;  4Q8G A;  2ZPN A;  2JZ3 B;  1NHW C;  2NTS A;  2I7P A;  3MHS A;  2KMA A;  4NJ7 A;  3SDL C;  3AV0 A;  1N36 M;  4NQK E;  3APD A;  4LGM A;  2WBF X;  4Z8X A;  1V6E A;  2QZ4 A;  3T15 A;  5G5H A;  4A8X C;  3RNE C;  1P98 A;  2NPT B;  1DO0 A;  3H8H A;  2E6X A;  4WJQ A;  1GPX A;  1N5W A;  1R5L A;  2AS8 A;  2DYO A;  2NPT A;  4GN1 A;  2B1N A;  3Q8G A;  3U6Q A;  1CSB B;  2ACZ B;  3KS4 A;  3IT6 B;  1FO4 A;  1XXG A;  4D2K A;  2KWV B;  1HQY E;  4X62 M;  5BPV A;  3X23 A;  3T3N A;  3ZKJ C;  2DAM A;  1PPD A;  3ZDT A;  1WGK A;  2J0M A;  2R6F A;  4WWP A;  1LO5 D;  5H8Y E;  1L5P A;  1OEY A;  2N0S B;  4X65 M;  1NVI D;  3AE9 B;  2DEN A;  1QMY A;  4W9C A;  3CWI A;  1H4R A;  3FTF A;  1TH4 A;  2K6D B;  3GQ5 A;  4LTU A;  3B79 A;  2XZF A;  3BOW A;  1GMY A;  4MDK E;  4WQM A;  1FM0 D;  4A5U A;  4CJ6 A;  1WJN A;  3AE1 B; 
#chains in the Genus database with same CATH homology
 3HVD A;  1F77 A;  4TSS A;  2W54 A;  4NL4 H;  4XZX A;  1NYQ A;  3KSJ A;  2EO2 A;  3TPZ A;  4FWD A;  3HWS A;  4GC5 A;  1E94 E;  2Y3A A;  1I4Q A;  4IBE A;  2MJ3 A;  1KFY B;  1TY2 A;  3FUV A;  4OHJ A;  2XH9 A;  2LHD A;  2HL7 A;  4ZTB A;  2LUM A;  2WXN A;  3AOG A;  1KF6 B;  1G41 A;  3SYL A;  3TUO A;  1J7B A;  2ONQ A;  4L2Y A;  3M0E A;  4RCO A;  3M7G A;  2E3T A;  1D6E C;  1FNW A;  4L8R C;  1GL7 A;  4YSX B;  3EA6 A;  3CTW B;  3K92 A;  4C56 C;  1T6B X;  1L2D A;  2BYT A;  2QBY A;  1QT9 A;  3DOA A;  1HR0 M;  4EIW A;  2QBY B;  3GP1 A;  4XDC A;  1UGJ A;  1IQP A;  4LF5 M;  1XLQ A;  2J53 A;  1UWM A;  1SF0 A;  5H37 D;  4LF4 M;  4JWS C;  1QLB B;  1VJK A;  4LFC M;  4GH9 A;  1NSF A;  4XDD A;  2WXM A;  2AGA A;  4AG5 A;  3I4V A;  4MGI E;  3U2S C;  4DUY M;  1DGH B;  3KWL A;  1MHX A;  4LLG M;  4LK0 M;  2BTW A;  5EZS A;  1PDX A;  1E9S A;  3TMP A;  4LG2 A;  4LFA M;  1EM7 A;  4WUR A;  3KFU G;  3PFI A;  3U6M A;  4A6Q A;  3J7B A;  4GKK M;  1Q39 A;  4S12 A;  3U6C A;  3MP2 A;  1N75 A;  3OTO M;  3R2I A;  4JXJ A;  3VDU A;  3U6L A;  2VII A;  2CV0 A;  2F5N A;  1V1O A;  4YXD B;  2RMM A;  3LB8 C;  1EU4 A;  2LFI A;  1QOF A;  2ERC A;  4PCZ A;  1FJG M;  3BZD B;  4BOS A;  4IIW A;  4GIP A;  2K0P A;  1NHG C;  2D7H A;  1IGD A;  4YTN B;  4DR2 M;  4OW0 A;  3TL4 X;  5EXS A;  1C77 A;  2NMQ A;  5ITX E;  4NOO B;  4HJG E;  4IBB A;  3R8F A;  3W1S A;  2INN E;  4WH4 A;  1NNJ A;  3GLG A;  4KHP M;  3W5V B;  4MB7 A;  1TGU A;  3RPF C;  4GKJ M;  4XGI A;  2LNH C;  4JN6 A;  1KYI A;  4D81 A;  4MH8 A;  4JV5 M;  2TSS A;  3KWV A;  2BTE A;  1P7F A;  1QQR A;  5ITY A;  2WU5 B;  2CJN A;  1QOA A;  2JXT A;  1GVN A;  4FW9 A;  4J3O D;  1ZDX A;  3LQR A;  3U6S A;  3RNV A;  4CIS A;  1ET6 A;  1PJI A;  1JRO A;  2CE7 A;  4RNA A;  2RDH A;  4DR4 M;  4A9A A;  4B0E A;  4JI3 M;  3IG5 A;  3VKH A;  2WXH A;  5HI1 A;  1SBB B;  4RGO S;  2JQR B;  2W82 A;  3TWM A;  2M19 A;  1XEE A;  3W0F A;  3A45 A;  1AN8 A;  1PM5 A;  2JYT A;  2C9C A;  1XF5 L;  3R2T A;  1AW7 A;  4DV5 M;  5C1B A;  3KOX E;  1XHB A;  2KZS A;  4FCT A;  1C4P A;  4MAC A;  4KGS A;  3T3O A;  1XMQ M;  2K5P A;  3ZJT A;  3LQQ A;  2EUC A;  1H6U A;  2XSZ D;  4G4O A;  1TY0 A;  2G8L A;  4QHS A;  3SAV A;  4I5S A;  3MHZ A;  2UU9 M;  2UUB M;  1IY0 A;  3UJN A;  2R61 A;  3T1Y M;  3FTE A;  1WWT A;  2HHH M;  3K1J A;  2WXL A;  5C2T B;  4DV3 M;  3NVV A;  3P1M A;  1UKF A;  3I4Y A;  4DR3 M;  1Z5A A;  2O5R A;  3SAR A;  1YJJ A;  1R7R A;  2X38 A;  2XEP A;  4IBD A;  4W5W A;  3HHZ A;  1FCL A;  2H89 B;  4DV7 M;  3W2D A;  1PJJ A;  1IBX B;  1VZ8 A;  1L1Z A;  4YY3 M;  2Q5W D;  1ENF A;  4DV0 M;  1STE A;  3HKP A;  1TS4 A;  2HCB A;  1Z5B A;  1L0V B;  1VZ6 A;  1YNT E;  1PGB A;  4G4N A;  3ZNH A;  2VZK D;  1N5X A;  2L09 A;  1JWU D;  3P42 A;  5H92 C;  1T3T A;  2Z7J A;  2N7J A;  1J7A A;  4MM3 B;  4D80 A;  4AKH A;  4LJ4 A;  2DZN B;  2OHF A;  3EUB 2;  4II7 A;  1V97 A;  3A42 A;  4JX1 C;  4IJF A;  2MJE A;  3FYD A;  4JI7 M;  1B1Z A;  5BMH A;  2I2Y A;  3VR8 B;  2JA2 A;  3IT4 B;  1K51 A;  2Z8L A;  3C8Y A;  3NVY A;  3BWU D;  4JI1 M;  4BB9 A;  4I8O A;  4PDI A;  1YZB A;  2JZP A;  4DR5 M;  4I81 A;  2F5O A;  5BR8 M;  5MPO A;  3VRB B;  3J27 B;  2X8A A;  1J09 A;  2J7O A;  4LZJ A;  2A5Y B;  3V05 A;  1YN4 A;  3HU2 A;  4DXG A;  3RGS A;  2PVO D;  4CGY B;  4JI8 M;  3MTV A;  1Q3C A;  4XE0 A;  3ZGZ A;  1ZQ9 A;  3B21 A;  1FXA A;  2Y5P A;  2C98 A;  1ROE A;  2LMC A;  1QAQ A;  1MPE A;  5IT9 S;  3SFD B;  1G4A E;  1I4W A;  3PHW A;  4A90 A;  1JWM D;  2Y0T A;  1ZE3 D;  1SE3 A;  2QCU A;  3AMZ A;  4GRI A;  1HXY D;  3B2F A;  4I4L A;  1FFU A;  4IKG A;  1WRI A;  2HTM E;  1MX0 A;  2BU3 A;  4RGN A;  2KRU A;  3GRR A;  1KRH A;  1B9R A;  3KOW E;  3P63 A;  4YTM B;  4B3S M;  4BBA A;  2CUZ A;  3KS8 A;  2AQ1 B;  1SXJ C;  3UGJ A;  2DLB A;  5KPR A;  4JI2 M;  1N61 A;  1X37 A;  4CHT B;  1N32 M;  1ZP0 B;  1OFF A;  2KN4 A;  4B7G A;  2IDY A;  2UUC M;  1D5X C;  2DYM A;  3Q8E A;  1QZM A;  3THG A;  2V4I B;  2R18 A;  5EXT A;  1L2B A;  3U6O A;  4ZYS A;  2DWL A;  2PTL A;  1N78 A;  4QNM A;  2RPV A;  1W5T A;  4LJA A;  1DGH A;  4KGR A;  3IXS A;  1IXS B;  3L29 A;  5FR3 A;  2ON8 A;  4LJ7 A;  1VRA B;  2CHQ A;  1T5X D;  4B3R M;  1GAQ B;  3PNY A;  3J80 S;  3BOS A;  3AEC B;  1YQ4 B;  4PT5 A;  4MGK E;  4IOI E;  3C58 A;  1HA5 A;  5D3D A;  2CFO A;  1DGJ A;  4OZB A;  4LRT A;  1TDH A;  5GKN A;  5DNY A;  1VLB A;  1R2Z A;  3BK1 A;  2I38 A;  2SEB D;  2PMV A;  3J9C A;  1F2R I;  4JPS A;  4FVM A;  3UK6 A;  1NY6 A;  4O1N A;  4RF0 A;  1MI0 A;  1NI3 A;  5I4D A;  4M0D A;  2BJV A;  2VQE M;  3ZJV A;  5JI3 E;  3AE4 B;  4FD2 A;  4OX9 M;  3WHL A;  5C18 A;  5FK9 C;  3HHW A;  3FTC A;  3SMS A;  4JI4 M;  5ITX A;  3IAM 1;  2BB6 A;  3I57 A;  4LJ9 A;  2P5T A;  4DV2 M;  4JI5 M;  2KAJ A;  3PVS A;  3U5Z A;  3HJQ A;  2RKO A;  4OZA A;  3I51 A;  4R7G A;  1QOG A;  3GPP A;  5EZQ A;  2ZBK B;  2EA0 A;  1DOX A;  5BYQ A;  2J4X A;  4ZRP A;  3KXE C;  1ET9 A;  2BJW A;  3QWL A;  2F5P A;  1YE9 A;  2V3N A;  4GHL A;  4IBI A;  3SFZ A;  1EU3 A;  2JYE A;  4UDU C;  1RWS A;  3LYY A;  2KWD A;  4PDG A;  2LH0 A;  1LV7 A;  3PHU A;  1BXT A;  5KQD A;  2J7N A;  3HJ8 A;  4GLS C;  2DBY A;  1HEZ E;  2ZAN A;  2KAC A;  3AEE B;  5JZE A;  1JAL A;  1IXR C;  2Z84 A;  1ZXH A;  2JU6 X;  8CAT A;  1ZOY B;  1SXJ B;  4GC9 A;  2OPF A;  3ILK A;  5BMI A;  4BOP A;  1C1K A;  2DWQ A;  2K47 A;  4GIT A;  3EIH A;  4B3M M;  3SYK A;  4IDI A;  3SEB A;  1I4G A;  2L52 A;  3VKG A;  2JRI A;  2OQ4 A;  3GRY A;  3U60 B;  1MHH E;  3PZ8 A;  2Z3X A;  4TQ0 A;  1V1P A;  3DZD A;  3NWL A;  2LJI A;  4HXD B;  3FTD A;  1D2N A;  1JR3 A;  2YEP B;  5LMN M;  3HRD D;  3SAS A;  5F3W A;  3AJI B;  3U4E G;  3AB5 A;  2QP9 X;  5EP3 A;  2ZW0 A;  5HFY A;  1FXI A;  3VK8 A;  1NEK B;  2WXR A;  4YSY B;  4N6E B;  3MC0 B;  3J2P B;  1IGC A;  3MP9 A;  3FKE A;  3VRA B;  1D4B A;  5GXG B;  3GRV A;  3KQ4 A;  3JAM S;  2K9X A;  4US9 A;  4P6V F;  5JI2 E;  3U5Z B;  1IXZ A;  1I94 M;  4WAF A;  2Z4R A;  2N9L A;  4N59 A;  1XLO A;  2X49 A;  5EP2 A;  3R9X B;  1OFH A;  3JR4 A;  2FNA A;  4DR1 M;  1TH2 A;  1BUI C;  1IBX A;  3ZQ4 A;  1JW9 D;  4Z6Y A;  4LF6 M;  2G1E A;  4NZL B;  1F0Z A;  3AED B;  4M9S A;  4B7F A;  3AE5 B;  2R62 A;  1TKY A;  3B9P A;  1ZPS A;  2UZJ A;  2C99 A;  2L7H A;  1JWB D;  4MGY E;  2L7I A;  4B7H A;  1R7S A;  4LY6 A;  2OED A;  3RE8 A;  1XCT L;  3HUI A;  3GLI B;  4IJE A;  2BBC A;  3KDS E;  2J7Q A;  3PZ7 A;  3VLF B;  1Z59 A;  5ITT A;  1UWX A;  3SHF A;  3FUT A;  2YNM D;  4YHH M;  2J7Q C;  2LWX A;  2BS4 B;  4KKI A;  4D8B A;  2EEL A;  2BTW B;  2BW2 A;  1VDV A;  4GDL B;  5KQ8 A;  3WHK A;  2WS3 B;  3E4R A;  1XLN A;  3E56 A;  5EE3 A;  1DGB A;  2YFQ A;  4OU7 A;  4KKJ A;  1SE4 A;  2PKO A;  5FLX S;  1I7H A;  3TEX A;  3TWK A;  4NAW B;  3CF2 A;  4C7Z A;  2WDV B;  3AEA B;  2N9K A;  2Y5C A;  4FCW A;  3AFH A;  3PSE A;  1TH3 A;  3UZU A;  4LF8 M;  1ESF A;  3MJ5 A;  1NYR A;  2L32 A;  2PW9 A;  1GB1 A;  4HRS A;  2CV2 A;  1DGF A;  1IUE A;  1JWA D;  2WU2 B;  3KOY E;  3PXG A;  1V1P B;  2FFJ A;  3MK6 A;  3TSS A;  4QNR A;  3VQI A;  3U52 E;  3UI3 A;  3W5U B;  3RFW A;  2BT6 A;  4DUZ M;  2CEA A;  1JRP A;  1SJE D;  3PRM A;  2UXC M;  1TDZ A;  3K2L A;  4QHT A;  3AEG B;  4IBF A;  2KDM A;  1HNZ M;  3MFG A;  4MH0 E;  4C80 A;  3N9Y C;  4AZF A;  2M0A A;  1QF6 A;  4MGH A;  3ZJU A;  1KTK A;  3SR6 A;  4DQO C;  1CJE A;  2C9O A;  1C76 A;  3DWM A;  2ZAM A;  2H88 B;  2DHR A;  2GI9 A;  1HQR D;  5LNK 1;  1Q3B A;  1FEH A;  1GLN A;  2CHV A;  5TSS A;  5EQT A;  4A3V B;  1PFD A;  4XWT A;  2AX5 A;  4B3T M;  2ZAO A;  2H1R A;  1UNS A;  4LF9 M;  2R4J A;  1OFI A;  3BY4 A;  3HGI A;  4DR7 M;  1V8C A;  4IBC A;  2KW0 A;  3NUH B;  3URY A;  2RGO A;  2PIA A;  5IRE B;  4P16 A;  2XFT A;  2CU3 A;  2UUA M;  2WXF A;  2SAK A;  1EWY C;  1SIJ A;  2L6O A;  4AS1 A;  4ZHO A;  1PYW D;  2JWU A;  3FIL A;  1YMH E;  3UMM A;  2V6Z M;  2M60 A;  2R46 A;  1F2R C;  4D8I A;  2RGH A;  1I4X A;  2BNK A;  4ITQ A;  2QJL A;  1Z5C A;  4JI6 M;  5E6J A;  1IY1 A;  3E9S A;  5A2Q S;  2WXI A;  2WNM A;  2KXE A;  1C4A A;  1OQR A;  4KOD A;  1XXH B;  3QAU A;  1C4C A;  5EXX A;  1ZUD 2;  3P4Q B;  1GL6 A;  1FRD A;  3AOE A;  2YEP F;  2KA6 B;  1TS5 A;  1HZ6 A;  4KGT A;  5G5G A;  3AV8 A;  2QIE B;  3BVM A;  2B76 B;  1N33 M;  4DV4 M;  3FUW A;  1DKI A;  1G8P A;  4MI7 A;  3KP0 E;  1SEB D;  3AE7 B;  2V1U A;  3L28 A;  4L78 A;  1NJG A;  5DYG A;  3FUU A;  2R65 A;  4L4U A;  3NVW A;  1TJE A;  1XCQ L;  4BOQ A;  3BYT B;  3C0R A;  3HU3 A;  2HKJ A;  3HU1 A;  3D8B A;  1FFV A;  3BB7 A;  1Y56 A;  4GMQ A;  1KSF X;  1L0Y B;  1I4H A;  1RYJ A;  4NXM M;  4BLC A;  5FSW A;  3GLH B;  2QIL A;  1R2Y A;  2ICI A;  4DV1 M;  1M4V A;  4LJ5 A;  3Q8F A;  1GOZ A;  4NSO B;  3V3X A;  2K22 A;  3U60 A;  1L6V A;  1ZXI A;  4HLQ A;  3J81 S;  3P4S B;  3RGP A;  1XC8 A;  4JYA M;  3A98 B;  1L8Q A;  1C78 A;  4WW0 A;  1PGA A;  2WXK A;  5KPZ A;  1I4P A;  5ITU A;  2NQ8 C;  3GPX A;  3TQS A;  1J5E M;  3AE6 B;  3TWL A;  1QAN A;  1YQ3 B;  5LMU M;  4OVZ B;  3ZYY X;  5FTJ A;  1QYR A;  4NXN M;  2WXQ A;  1SXT A;  1E10 A;  1ACC A;  5ITQ A;  2W3R A;  3BVG A;  1IBL M;  2RDG A;  3R8B A;  3GRU A;  4LF7 M;  5BYS A;  5EXP A;  3SAT A;  5EE1 A;  2HWK A;  1L4D B;  3LXF A;  1E9M A;  1NVM A;  3GB1 A;  3M6A A;  3O13 A;  4RH6 A;  4X64 M;  1VDD A;  2XN9 C;  4B08 A;  4NRW A;  2IPK D;  3BK2 A;  2G5G X;  3U7Z A;  4KO8 A;  5D3I B;  5KPT A;  3NZ3 A;  2WDR B;  2V1C A;  3AE8 B;  3AE3 B;  4L16 A;  2QEJ C;  3SFE B;  5FTL A;  2ZM6 M;  3KLS X;  2HDE A;  1GB4 A;  2QPA A;  3W0L B;  2WXG A;  4NAM A;  4G4Q A;  4YSZ B;  3GPU A;  4GDK B;  1PVJ A;  3AM9 A;  1IM2 A;  1QAO A;  1E6E B;  2PVG C;  3GLI A;  2CJO A;  3L26 A;  5JXV A;  2VQF M;  1KFV A;  2GRI A;  4HRO A;  3Q8C A;  3LVV A;  4ARI A;  3OQC A;  1SXJ E;  1K52 A;  3SAW A;  4JE3 B;  2DWN A;  1JQ4 A;  2MEK A;  3TRK A;  4L1B A;  4C7Y A;  5KO3 A;  1TKG A;  2W3S A;  4LCB A;  2F4V M;  1XWI A;  1NEN B;  4IUM A;  1K53 A;  2PLP A;  3FYC A;  4HL4 A;  3AOE C;  1DOI A;  1N77 A;  3ZCB B;  3GLF A;  3VR9 B;  2F5Q A;  2NTT A;  3WCQ A;  1TYG B;  4AKG A;  1SE2 A;  2DVW B;  1ZAE A;  3H4M A;  3KW6 A;  1L1T A;  1HNW M;  2XGN A;  1FD6 A;  1TS2 A;  5HG2 A;  2C96 A;  4LRS A;  3VK7 A;  2MH7 A;  3FC4 A;  3P4R B;  4G6Z A;  1E0Z A;  2Z4S A;  4FWH A;  4TQ1 A;  1R6B X;  3FIL B;  3HVZ A;  1MU5 A;  1FNV A;  4TUW A;  3L27 A;  1XNR M;  3TEZ A;  4LZZ A;  1TS3 A;  4NJC A;  2G9H D;  3ETR A;  1IN8 A;  5AUK A;  3W9C B;  2LGI A;  3DA1 A;  2V3P A;  4HKZ E;  3B9J A;  3L2A A;  3AL0 C;  1DGG A;  3NS1 A;  2R45 A;  4ZHP A;  3FAH A;  2F5S A;  4OZC A;  4IBG A;  3DFZ A;  3LMM A;  3GPY A;  1K82 A;  4BOU A;  4ITK A;  3HHY A;  1QQW A;  2CV1 A;  4Q2J A;  3CIR B;  2XNA C;  4H2A A;  1S3S A;  4JWU C;  3Q8A A;  4LFB M;  3AH7 A;  2LEK A;  1EWC A;  1DO2 A;  4G4R A;  3PT2 A;  5D7G A;  5FKA C;  3ZH9 B;  2DXI A;  3GQ4 A;  4DXF A;  3ZC7 B;  3PNV A;  3EGR A;  3U61 B;  1N63 A;  4FXC A;  1J7C A;  2UXD M;  3AEF B;  2X4A A;  3A46 A;  3ABV B;  2I7N A;  2IJ0 A;  1FNU A;  4WIP A;  2Y21 A;  4IBK A;  2IGG A;  4ZOH C;  5EJC A;  1W5S A;  2D7G A;  5IWA M;  4CQN A;  1VZ7 A;  2KQ4 X;  1JWS D;  3JR5 A;  4RF1 A;  1YN5 A;  4MT5 A;  2XFS A;  1K3W A;  2R4E A;  2W55 A;  2BS3 B;  2C5R A;  5DYI A;  1SSN A;  1XNQ M;  1PGX A;  3GO8 A;  1KLG D;  1L0X B;  1UUP A;  1HZ5 A;  2XF3 A;  3BII D;  3AEB B;  3TEY A;  3B2G A;  4ZRQ A;  4NRV A;  4R3D A;  4OVZ A;  3TE6 A;  1AWD A;  4BOZ A;  1NNU C;  4MGZ E;  4B0M A;  3AE2 B;  4DV6 M;  1IN5 A;  2YQZ A;  1DOY A;  2IGH A;  1G59 A;  1SXJ D;  3VDP A;  2FUG 1;  4IP3 A;  4KX6 B;  1YUB A;  4X66 M;  1IBM M;  1TZO A;  3PRP A;  5EP1 A;  4FWG A;  1WSP A;  1KH0 A;  4QOZ C;  3GLG B;  1YJI A;  3Q8X A;  3SHG B;  2DWZ B;  1JQJ C;  4XBO A;  5BMG A;  3SAU A;  1FCC C;  1FMA D;  1UM8 A;  3O65 A;  4EE2 A;  2KEB A;  3HJS A;  4A55 A;  1YN3 A;  3BBA A;  1ZDV A;  2YR0 A;  3T38 A;  2ZW1 A;  3CF0 A;  5IZ7 D;  1XO3 A;  2XZU A;  2JTC A;  2UXB M;  2XSZ A;  3NRZ A;  1N34 M;  1QOB A;  2MJD A;  2QEN A;  1N60 A;  1SJH D;  3FD9 A;  3GQ3 A;  4YWG G;  2AQ3 B;  2D7E A;  1D5Z C;  1NY5 A;  3LVW A;  3U6E A;  4TMA B;  1XLP A;  2WP9 B;  2JX5 A;  3AKZ A;  4RKX A;  2J52 A;  3U61 A;  3L4P A;  1VR9 A;  4GHA A;  4AKI A;  3U6D A;  1NJF A;  1N62 A;  3W31 A;  3RFZ B;  2QSD A;  3PHX A;  3L25 A;  2BS2 B;  1IY2 A;  2L1A A;  5C3J B;  2IGD A;  3P4P B;  3PO0 A;  1TKE A;  4M9X A;  2LHE A;  1IBK M;  1QIL A;  3IG8 A;  1IN6 A;  1FNN A;  1MVK A;  4LJ8 A;  3SBJ A;  3KP1 E;  1FIQ A;  1CQV A;  2M56 B;  2LXE A;  2FBW B;  4NSR A;  3KVW A;  2WLB A;  1OJL A;  1Z6T A;  1SB3 C;  1IN4 A;  3K8Z A;  4K0K M;  4AI6 A;  4D82 A;  1HT1 E;  2FE8 A;  3KOZ E;  1WXQ A;  1WYG A;  2GB1 A;  1XMO M;  4HEA 1;  4USA A;  2DOS A;  3U6P A;  3OWE B;  1E32 A;  2VZK B;  5FTM A;  1BML C;  1FRR A;  5EE0 A;  2WXJ A;  1XXH A;  4REZ A;  3FUX A;  3TEW A;  4ARC A;  4DR6 M;  1A70 A;  1L6U A;  7CAT A;  2FOI C;  4D8E A;  4AG6 A;  1C79 A;  5ITR A;  3I9V 1;  4AW4 A;  1CK1 A;  1E9R A;  4AQ7 A;  2QMT A;  1E7P B;  1P7E A;  4RFB A;  1D5M C;  3IAS 1;  1K50 A;  2V0G A;  4N58 A;  1HT2 E;  5FTK A;  4AQY M;  1GKI A;  1K3X A;  2WDQ B;  2WXP A;  1HNX M;  5BYR A;  3NBI A;  2KMM A;  5HHD G;  4M9Z A;  2DZO B;  1QKZ A;  3GLF B;  1QAM A;  3GLH A;  4M0W A;  1J7K A;  4ZPX A;  3Q69 A;  3DWG C;  2WQY B;  4HKQ A;  4L23 A;  1G3I A;  4KLN A;  3EIE A;  3W30 A;  2D5G A;  2Y0Q A;  3BVZ A;  3MHV C;  1CZP A;  3KSX A;  2WXO A;  1JCK B;  1DYQ A;  1YSY A;  2KRK A;  3SMP A;  2AQ2 B;  2CHG A;  1C9F A;  1HQC A;  1Q10 A;  4RGT A;  4L15 A;  2INP E;  1JR3 D;  4YT0 B;  5FTN A;  4PD2 A;  1ORY B;  5AUI A;  4GUA A;  1T3Q A;  2DWM A;  3IFU A;  2E5L M;  3SC3 A;  1IN7 A;  3Q8B A;  2BB5 A;  4XWW A;  3J7A S;  3T1H M;  5EP4 A;  4QOS A;  3NVZ A;  2JSV X;  2M5Z A;  4LJ6 A;  4FCV A;  1EE8 A;  4IBJ A;  2KZU A;  2Y20 A;  2K3U A;  3HHX A;  1KLU D;  5T8I A;  3AN1 A;  1RFK A;  4US8 A;  3VFD A;  2Q2E B;  3BYY B;  2XLJ A;  3GP7 A;  2J42 A;  1AYF A;  1OQQ A;  2L83 A;  2AHM A;  1JML A;  1SXJ A;  5E26 A;  1L4Z B;  4YTP B;  1I4R A;  1L2C A;  1PUT A;  1QVR A;  3CF6 E;  4LGY A;  1RM6 C;  3GS2 A;  3D8L A;  4RGM A;  4WWM A;  2EKI A;  5EE9 A;  4JI0 M;  1NHW C;  2NTS A;  2I7P A;  3AV0 A;  1N36 M;  4LGM A;  4Z8X A;  2QZ4 A;  3T15 A;  5G5H A;  4A8X C;  1DO0 A;  3H8H A;  2E6X A;  1GPX A;  1N5W A;  2DYO A;  3U6Q A;  2ACZ B;  3KS4 A;  3IT6 B;  1FO4 A;  1XXG A;  4D2K A;  1HQY E;  4X62 M;  5BPV A;  3T3N A;  1WGK A;  1LO5 D;  5H8Y E;  1L5P A;  2N0S B;  4X65 M;  1NVI D;  3AE9 B;  3CWI A;  3FTF A;  1TH4 A;  3GQ5 A;  4LTU A;  2XZF A;  4WQM A;  1FM0 D;  4A5U A;  3AE1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...