4RF1A

Crystal structure of the middle-east respiratory syndrome coronavirus papain-like protease in complex with ubiquitin (space group p63)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
321
structure length
319
Chain Sequence
b'LTIEVLVTVDGVNFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKELYGPVDPTFLHRFYSLKAAVHGWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFVIPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVWREWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQLVEHTTPWLLLSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKLILKFDSGTVSKTSDWKCKVTDVLFPGQKYSSDCN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ORF1ab protein
publication title Crystal Structure of the Middle East Respiratory Syndrome Coronavirus (MERS-CoV) Papain-like Protease Bound to Ubiquitin Facilitates Targeted Disruption of Deubiquitinating Activity to Demonstrate Its Role in Innate Immune Suppression.
pubmed doi rcsb
source organism Human betacoronavirus 2c jordan-n3/2012
molecule tags Protein binding
total genus 86
structure length 319
sequence length 321
ec nomenclature
pdb deposition date 2014-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1190 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4rf1A02
3.10.20.540 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4rf1A01
3.90.70.90 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4rf1A03
3MJ5A 4PT5A 4RNAA 3E9SA 4P16A 4MM3B 5KO3A 4REZA 4R3DA 4OVZA 4RF1A 3MP2A 2FE8A 4WURA 4M0WA 4OVZB 4OW0A 5E6JA 4RF0A
chains in the Genus database with same CATH superfamily
1E7UA 3HJQA 2BU3A 4KX6B 4K7WA 3V6CB 2KOXA 2GRIA 3PZ7A 5AZFA 5EZQA 3CMMB 3ZTCA 5D3DA 4RGNA 3U7ZA 3TWMA 4FULA 4TV3A 1H4RA 4NXMM 5J18A 2EA0A 1U9VA 4XZ4A 2FRQA 4KDLB 1QZEA 1IN6A 3C0RB 5JHAA 3KS8A 3GLHE 4ANRA 3ZJTA 4JQWC 4S12A 3AI5A 2M4NA 5BYRA 1AYUA 1CJEA 1HZ5A 3V05A 2ZPNA 1YLAA 5EP1A 2C7HA 4NPNA 4XE0A 1IY1A 2A5YB 2RSUA 4ANXA 1QYRA 2JWUA 3K1JA 4YY3M 1EF5A 2CJNA 3J27B 2J53A 2W3RA 5IA7A 1L5PA 2MJ3A 2INNE 2KVZA 4CIZA 4KGSA 2F5OA 1AARA 2QCUA 4X64M 3LXFA 3U6DA 4BB9A 3SU8X 3GQ3A 2MJ5B 3VUYA 4M0DA 2RR9A 2GQFA 3PRZA 5MPOA 2KDLA 1KFXL 3TL5A 2KQSA 2RPVA 4ZRKA 2FTDA 4MB7A 1IBKM 4YYVA 3JR4A 5EXTA 2LXAA 1DGHB 4HJKA 3U6PA 3HIZA 3RVWA 3IG8A 4DV4M 3U6EA 2XU3A 1MG4A 1AIMA 1OQRA 1UF0A 2VH1A 2R45A 1LXDA 4NJ7A 5H8YE 3WCQA 3HKPA 3KSXA 1AWDA 1JQ4A 4KGRA 2YQZA 5D2MB 2KEBA 3HK0A 2V0GA 3KWBX 2DAEA 3K92A 1N63A 3IAM1 2BBCA 3FUXA 3EHVA 1NSFA 3K9PA 1R5LA 4P6EA 1E32A 1WJ7A 3ZNGC 1Q02A 3B74A 2J0MA 1EM7A 5DCNA 1PPDA 4LFBM 3LDZE 1CMXB 3T1HM 2QBYB 1E9MA 1JWAD 2XBBC 2K8HA 1ZMVA 3OTOM 4IUMB 3PV1A 2JY5A 4JLCA 2R65A 5ITTA 1C79A 1YJIA 2FUG1 1WM2A 3C9PA 2UUCM 3V61A 2PNSA 3W0LB 1UUPA 2WXHA 2AHMA 3SC3A 2WDQB 3GLHB 4A6QA 2MSED 3KWVA 4II2B 2B76B 3HHZA 4E74A 2FE8A 2RDHA 1WJUA 5GMVA 4F2LA 4PS8A 1Y4HA 1GLNA 1V33A 2QILA 4MGZE 4IWOA 2D7GA 4M9XA 3GQ4A 2X8XX 3ETRA 2GHUA 1QKZA 1H6UA 1F1HA 1WY8A 3R9XB 4Q7JA 1EO6A 1NNUC 1H8CA 1EE8A 1RRBA 2UUAM 3AULA 4DUYM 5KHOA 2KXEA 2Z7JA 1FO4A 4KT0F 3HHIA 3RMKC 3W31A 1VEGA 1C4CA 3RULA 4YYWA 1S1QB 1VCBA 2LRWA 2YVCA 3LFYA 2NQIA 5DFLA 1BUIC 3GLIB 4JI2M 4AUQC 2XZFA 4FCTA 3VVWB 4LJAA 2C9WB 3S3QA 4QOZC 2GBMA 3OG5A 2Y0QA 2LVAA 1DGJA 4RH6A 1XC8A 3FRHA 2AUZA 2F5SA 1XT9B 4TUWA 4RGMA 1IN5A 2I1JA 4LCDE 2KQ4X 3GPUA 1E8ZA 2RDBC 4DR5M 3QCAA 1TS2A 1UWMA 1KHQA 2MCNB 4BVUC 1I42A 3AE2B 2WXRA 1OFHA 3V6EA 4MELA 4NL4H 4LNNA 4YSZB 4X66M 1WGRA 3ZXRA 4BOSA 1XB2B 1Z5AA 2LTUA 3GCBA 4MGIE 3OJ3A 5DPTA 2H1RA 5JA7A 1JB0F 3SBJA 1WYGA 2J0JA 3CF0A 2JPHA 1XKGA 2G3QA 2I7NA 1VLBA 2KA6B 2DHYA 1O0EA 4FIPA 1GJTA 2WXFA 3GE3C 2LXEA 4I6PA 1X9YA 1SE4A 1WXSA 1I4RA 2XSZD 4IBEA 1XLQA 4AQ7A 2DHZA 1YSYA 3PHWA 4LCBA 1VG5A 2MGWA 3UJNA 4JXJA 2BQQA 1KJTA 2KWCA 1NI3A 1WJ6A 1WM3A 2N7EA 4KZ0A 2JWZA 3FAHA 1PDXA 3W5UB 2BWBA 2WDTB 1CQVA 2BWFA 3GPXA 1HZ6A 3OISA 1Z5CA 3ZW3A 1OAOC 2E02A 2QDFA 4XX5A 3I01M 3HHYA 1DGBA 2HD5B 4FD2A 2LUEA 2JXNA 4DR6M 2EJSA 3TWLA 1OQQA 2XNAC 5J17A 1ATKA 2KAJA 5ITUA 2Y5BB 2N9XA 4HEA1 3S3RA 3ZDMC 1PYWD 2KRUA 4FBJB 2BT6A 3MHSD 1GVNA 5TR5A 5EXPA 4FXCA 2D3AA 2O2VB 1QOFA 3L13A 2ZZPB 2H89B 4QHTA 3LB8C 4WJQA 2AX5A 4B7HA 3A1QA 3K8ZA 4X6HA 2WWZA 1AU0A 3FILA 1M94A 4GUAA 1TGZB 4GXBA 3TL4X 3RYTA 4WW0A 1SE3A 3DDCB 3PPAA 4G6ZA 3PZ8A 2KTRA 2G7YA 3A4RA 3RE8A 2QJLA 3PBHA 2INPE 3NBIA 4BLCA 2EKFA 2BYEA 1NVMA 1V5TA 3T38A 1JWBD 2ZEQA 4BFRA 3OWEB 3GPYA 3UINB 4LF4M 4W5WA 2CV1A 4RKUF 3IFWB 3H7PA 4X6JA 3MMPA 3LMMA 1RU3A 2KFJA 2MLBA 4IW0A 3K9OA 2R62A 3V60A 3F75A 2Z8LA 1IXSA 4UN2B 4B7GA 1IBLM 4GHAA 4MM3B 3DHGC 4RM8A 3PHUA 1E0ZA 1UFZA 4F7ZA 4L8RC 1PIPA 2BJWA 2OOAA 1SJED 2XK5A 1ME3A 3VFKA 2ZAMA 3USVA 3DVGX 4YWGG 2N9EB 1Q3BA 2G5GX 1UGJA 5LXIB 4QOSA 2BKRB 4NY0A 2CHXA 2FH0A 4CGYB 5JI3E 2R4EA 4KODA 5EE0A 2JY7A 2HE7A 2R44A 1YD8U 2OZ2A 3O65A 2P0RA 1TTEA 1TKGA 4YTNB 4JI8M 2JQRB 4F8CB 4URKA 3L26A 3QJZA 3QQ8B 3AOGA 3E56A 3HJ8A 1ET6A 1MG8A 3OVXA 4CHKA 3UGBB 3MORA 3VFDA 4M0WA 5J94A 5LLIA 3I4YA 3Q8FA 1DO0A 2K39A 3V6EB 1E94E 2WDRB 3C9EA 3BWKA 1QZMA 3WHLA 1TLOA 2QHOB 2L1AA 3DF0A 2LD9A 3FTCA 3V76A 2KN4A 3IV2A 4YXDB 3UGJA 3GE8C 4LY6A 4B9KA 4OX9M 3OAWA 2HHHM 2Y5PA 1YJ1A 3KDSE 4DUZM 4Y28F 1P3QQ 4JI4M 1UGMA 4TMAB 1QUSA 2YJBA 2HTME 4BAXA 1XLNA 3VQIA 1N60A 3MP2A 4KGTA 2KZUA 3AMZA 1L4DB 4B0EA 2WXMA 2KMMA 1DO2A 4GLSC 2DBYA 3RNAC 2K22A 4ANWA 1PUTA 2LHGA 4MSMB 1VSNA 3TEWA 1K3XA 1VZ6A 1WXMA 1E6EB 2JXXA 4G0NB 4A9AA 3PDFA 4P6GA 3WXEA 5BMHA 3KH0A 1MJGM 1TDHA 3PHWB 4ZRPA 1J7KA 4JI7M 3IFUA 1JWMD 3CTWB 2HXZA 3AN1A 2QMTA 1MI0A 4WJOA 1Z5BA 4AG6A 4KVGB 2KW0A 1UBQA 1WRIA 4KIKA 4HDQA 3VRAB 1NL6A 2L0FA 4HJGE 2BYFA 2ZANA 1D5ZC 1OGWA 4HPMB 1GOZA 3N3GA 1NVID 2O6VD 2X49A 2KJRA 2N4FA 4NSOB 2N1WA 1WXAA 3A46A 2Y5CA 3ZH9B 3BY4A 3P5UA 3U7DA 2K8CA 2FAZA 3W5VB 3QA8A 2QCZA 2N9LA 2IGDA 1XLOA 2UWQA 1ZCMA 1E8WA 2ON8A 3ZLZA 4D81A 1HQRD 2KDEB 3BPFA 1ZV1A 4G4NA 4ARIA 3N3KA 1DOIA 5LNK1 2Z8YM 2UXBM 4P1CC 1Q3CA 2M0AA 3KOZE 3IT6B 3VDPA 3A1QB 1XXHB 4R3DA 1F52A 2LVPC 3K2LA 4A90A 3TQSA 2DI0A 2C9CA 2JYEA 2KHHA 2BF8B 2KO3A 3ZCBB 1RFKA 3AEBB 3FILB 1N61A 4LNOA 3RFWA 3U61B 2EMTA 4GGQA 1NHWC 2UXDM 1JQPA 3DQVA 4LK0M 1CTEA 1IFYA 1OTRB 3ZUNA 1VZ8A 4DDID 4DR2M 1KLGD 3EC8A 3U8ZA 5EXSA 1N62A 3H6NA 2KX3A 2DZMA 4QAYA 4LZJA 2MP2A 2DZJA 3TE6A 2J7OA 1FRDA 3IUTA 2O5RA 1V1PA 2ZW0A 3WXGA 3KP0E 5IP4D 2DYBA 3R8FA 3PNRA 1MS6A 5FK9C 1POPA 3K9OB 1KRHA 1RYJA 4GDLB 1YVBA 3AECB 4DV1M 3PVSA 1L0XB 2XFSA 1HQYE 4W9KA 2KFKA 5AZHA 4LJ8A 4CJ6A 4W9JA 4QRXA 4D80A 3KP1E 2OULA 2Y21A 4HEOA 2WHIA 3VH4B 4QH6A 2LHEA 2PJHA 2VZKD 2UZJA 1HE8A 2HCBA 3PRPB 3VDUA 1V2YA 3RNFC 2N9KA 1UD7A 2IO0B 4JWUC 5HG2A 1OJLA 3H4JA 2FBWB 3BK2A 1EWMA 4A5UA 1WMHA 1GG3A 1VR9A 1MHWA 4YYUA 3BYYB 2WDVB 3QX1A 1N5XA 2JNHA 5FPWA 1NI2A 2PLPA 4N79A 1WYWB 1K51A 2MHJA 2NS5A 1GUAB 1NV9A 1C1KA 3L16A 4EUTA 2P5TA 1Q6KA 2IZVB 4M0WB 3Q14C 1T3TA 1TR8A 3VR9B 4BKSD 2JQGR 1N32M 2BTEA 1JMLA 4XDDA 2APLA 4HWIB 3D32A 1LGRA 2LGIA 3SFDB 2MBOA 4J3OD 4GMQA 1PGYA 3SYKA 4BOUA 4P16A 3P4RB 5FTMA 3NS8A 3C0RA 5BO4B 4LGMA 4REZA 3SFZA 4EFOA 1G6JA 1SGHA 3B7QA 4YYSA 5EE3A 2MJDA 3U6QA 3AV0A 5C18A 2AWTA 4HCPB 2G1EA 4BS6A 2AS8A 2XU5A 1ME4A 2JWSA 2G4DB 3P5WA 4PADA 5AEKB 1KFYB 4S0RA 1IQPA 4NOOB 1NPZA 1JCKB 1FXAA 1C3TA 3HD3A 2F4VM 2SAKA 1JQJC 3AJIB 1WIAA 2NQ8C 1DGGA 2ZNVB 2JVCA 3Q8BA 4ARCA 4X6IA 4ICUA 1WE6A 2QP9X 5C23A 1NB3A 3Q3OC 5G5GA 1DV0A 3EFUA 2B3AA 4WJNA 4AG5A 1E7PB 3QAQA 4AJWA 3A33B 4L16A 3PO0A 4LTUA 2DZKA 3B21A 3M95A 4GEWA 2FCQA 2WYQA 5IOIA 4QNMA 2AL3A 1IN4A 3BY4B 2IBIA 2LJ5A 3EFCA 1I4PA 4W9EA 1M4VA 1GPXA 1CUKA 1R6BX 1YQ3B 5EP4A 1AYWA 4JI6M 5KO3A 3B1LX 4JX1C 1QXPA 2DAFA 1G59A 2JTCA 3U6SA 3TJPA 4B08A 4HCNB 2NR2A 2L00B 1VDDA 3CH2X 3DCGA 3SHGB 2N35A 4PP2E 2QBYA 5EP2A 5EXXA 1P98A 2PW9A 4IUMA 3QHTA 4NAWA 4KSKC 4XBOA 1STEA 1F2RI 4IWPA 1KFVA 2OJWA 1QVRA 2DAMA 4YT0B 1L0VB 3HU3A 2D3CA 1UH6A 2BS2B 2O6VB 3IG3A 1V1PB 1HR0M 1N78A 2MBHA 2C9OA 2WXQA 1N36M 2IPPB 3ZC7B 1NJFA 4JL9A 3B08A 1Z59A 4RFBA 3A98B 1QOBA 2BJVA 4YV8A 2DZIA 3MHVC 2BS4B 2GMIC 2ZW1A 3B9PA 1PPNA 4YYQA 3TNXA 3W1SC 1JR3A 3FUTA 4IBIA 4BOQA 2M19A 2DAGA 1DF0A 4HKQA 4ZRJA 1QQWA 1V6EA 4HVBA 3KSEA 3GLIA 2CHWA 4DR7M 4D8IA 3W67A 1NJGA 1EF1A 2D3BA 4DV5M 2CU3A 2F7DA 2F5QA 1FJGM 3P1MA 1J5EM 1TZ1A 4GC9A 1N75A 4IBFA 2IGGA 4AP4C 1EU4A 1SBBB 5BR8M 2RD0A 4F1IA 3UQBA 1ZW7A 3AKZA 4AS1A 1OIZA 4TQ0A 2KANA 1F2CA 2CIOA 3BVZA 1XQQA 2XLJA 1D3ZA 2L83A 1ZKHA 2CFOA 5JH3A 1THEA 1SF0A 5EE1A 2RDGA 2AEHA 3GP7A 5EZSA 3KOXE 2LWXA 3N1ZC 3DA1A 1YQ4B 1YX6B 3RI7C 2F5PA 1E8YA 4Q8HA 3KW5B 4A8XC 4QRVA 2A4ZA 2OOBB 4B95A 3U5ZA 1PM5A 4IG7B 4OZBA 1E10A 1TF0B 3FRIA 2PIAA 1GL7A 4IBKA 1WSPA 4X62M 2MQJA 3FTDA 2CB5A 1I4HA 5DPWA 4CDCB 4ICVA 2XH9A 2DHRA 5D3IB 3NVWA 3RNCC 2QSDA 4LRSA 4DHJB 4L6V6 1BQIA 1YNTE 3V62A 3M7GA 2JYTA 2M17A 2YJCA 1JR3E 1OEYJ 3MTNB 4M8MA 3T3OA 3LYYA 1NY5A 1TH4A 4WQOB 1G8PA 3TEZA 2N7DA 3B7NA 3GLIE 2MW5A 2INDC 1R7RA 4I6LB 1L0YB 3JVZX 3ZNHB 2HD5A 5L8RF 2BYTA 1B1ZA 3RVXA 3O13A 4MACA 2OO9A 3UQAA 1TKYA 3J81S 3KXEC 1AYFA 2IBIB 2HJ8A 5ITXA 2K8BA 1KOTA 3PLUA 3ZJVA 2Y5BA 2YEPB 2WXLA 3PVLA 1F4IA 1QOLA 4PP1A 2EELA 2JRHA 3LW5F 1WI0A 2K5PA 1CV8A 4IOIE 4DMXA 5IO9A 2L7RA 2FNJB 2O2VA 1A5TA 4L1BA 3U2SC 3F5VA 3T6PA 1QT9A 1J0GA 1BGOA 1V80A 2MWSB 4OZCA 2ZTDA 5EP3A 4BBNC 4GDKA 4GIVA 4DWFA 2G9HD 3B0AA 1F2BA 2D11A 2JX5A 1QDQA 5JI2E 1Y8RC 3A9KB 4PT5A 4HWYA 1FMAD 4NJ6A 4NAWB 3AL0C 2CKHB 2OPFA 1JRUA 2P7UA 1MDWA 3SAUA 1VZ7A 3R66C 1LO5D 1FH0A 5KPTA 3SD5A 4IBGA 1YN5A 1UZXB 2BVCA 1Y08A 1TL9A 9PAPA 3DVNU 3TPZA 3QC8B 2N1VA 3J9CA 4NXNM 3HU1A 5E26A 2JSVX 2B1MA 1MVKA 2CJOA 4MSQB 4MM3A 2JF5A 1F9JA 3H8CA 3RZFA 1Q1OA 4IJFA 2L8JA 1IN7A 2V9HA 2FUHB 2ZNVC 2X38A 3KX1A 3FUVA 4XDCA 2UU9M 5EE9A 2WSFF 1V92A 2EKIA 3GRRA 3R2IA 3H7SA 2WXIA 3DOWA 4ZHPA 3H89A 5ITXE 1R4GA 4BKGA 3R3MA 4JI1M 3CWIA 3AEGB 1BMLC 1WXVA 2DWMA 1DYQA 2I38A 1U9QX 5A2QS 1JWSD 3OJ4B 3FYDA 4NQKE 1LFDA 2LHCA 2W3SA 1PADA 5JZEB 3P2BA 4GU2A 2MBEA 1E90A 2AYOA 1XLPA 3K8UA 3IVFA 2EO2A 4KZCA 4WAAA 1GJZA 4IP3A 2C5RA 4N58A 2ZCBA 3X23A 3SHFA 3B79A 3E1ZB 1F2RC 3H7DA 1Z5SB 3HGIA 2Z4RA 1FNNA 4G4OA 2O25A 2E01A 2GNOA 3GO8A 2K3UA 2O01F 3R8BA 2QHOA 1XD3B 2QNJA 3AB5A 3BBZA 4Z6YA 1V5OA 3APCA 3UI3A 1VJVA 5DNYA 4E3CA 2DZLA 3KYDD 2J52A 4EKUA 3IT4B 1I4GA 1I4QA 4EZLA 3BZDB 1XCQL 4DXAB 3LVWA 4L4UA 1P1AA 3N32A 4IM2A 1HUCB 2PREA 1SP4B 4YTPB 3TMPA 2DAKA 3U5ZB 4K1RB 1YMHE 1TY2A 3Q3MC 3SAVA 3SYLA 1YN4A 4P1BC 7PCKA 2KKCA 3SHQA 4DR1M 1C9FA 4OVUA 5H92C 2IO1B 2K47A 1R4MI 3AE1B 4X65M 4BOPA 3L25A 2J7QB 2NTTA 2R46A 2KJHB 4UDUC 1D6EC 2CHQA 1SIJA 4EOYA 4RF0A 3WA0A 2KZSA 2QZ4A 1ZUD2 2AUXA 2DNFA 3I57A 3AOEC 3AV8A 1HQCA 2W55A 3D8BA 2PVOD 3BBAA 2INCC 4R7GA 1L6VA 3H1UA 3NVVA 3A9JA 4LZZA 2XF3A 4MZOA 3N30A 1KXRA 4US8A 2GFOA 4BKTA 5CVOB 3TBLD 1SJHD 2DZZA 2L2DA 4HLQA 2MRPA 1HT2E 3QWZB 2M56B 4D82A 5E6JA 1WE7A 2Z59B 2H88B 1TY0A 2BPSA 4LDTD 1XWIA 2R18A 2GBJA 2TSSA 5G5HA 4IC7B 4PYUA 5EQTA 3PHXB 1RFAA 1ZDVA 2ICIA 1XXHA 3GS2A 3Q3NC 4GDKB 3VUWA 2XSZA 1SE2A 3ONSA 4JN6A 4OELA 2LBCA 1EUVB 4DV3M 2DENB 3U61A 1XNQM 2M60A 1I35A 1OTRA 3PNVA 4QHSA 2FCMA 1NY6A 2YNMD 5C1BA 3ENEA 2FQ9A 3ZNZB 3AE9B 3QYBA 2FYEA 1YX5B 4JI3M 2AL6A 2KN5A 2RGFA 3DBLI 4D8EA 1NENB 2IO3B 2KK8A 4B3SM 1PJQA 2E03A 3HVDA 3U30A 1BP4A 2GBRA 3DBRI 4AXLA 1PJJA 1GKIA 4KV2A 1SEBD 1WRDB 1PCIA 1J19A 3L29A 2CHGA 1WWTA 4JV5M 3ZVVA 5KHQA 3CF6E 3ZYYX 2KYWA 3MHHA 1Q10A 4S17A 4GDLA 1EFUB 2B3TA 3MHSA 2WBFX 1OEYA 1WFYA 2NVUI 3MC8A 1BT0A 1GABA 4L78A 4RMAA 2E00A 4FW9A 5KPZA 1ROEA 4XGAB 2JZ3B 1SXJD 5HFYA 3IMAA 2WXGA 3SDLC 2DCDA 3EA6A 3PRPA 1KM7A 3L10B 4PI3A 4GIPA 1KYIA 4FN2A 4M02A 2IJ0A 1LV7A 3ERVA 4CZWA 1JALA 2PPHA 4HK2A 4PYZA 1CS8A 4N4ZA 4YHHM 4NQLB 3TEYA 3PRMA 3N1XC 1YZBA 4M01A 3VK8A 3J7BA 2AU1A 4ZOHC 4B7FA 2AYOB 3Q8XA 5FTKA 1SIFA 3BC3A 1M6DA 4OW0A 3DBHB 4W5CA 2IY1B 4MGYE 1XXHE 2X8AA 3IEJA 3AEDB 2L32A 5BPVA 2K6QA 3PSEB 3RGPA 3J2PB 3WANA 1CSBB 1QOGA 4WWMA 1TU6A 4RKXA 2QSFX 2UXCM 5D94A 3BXWA 1ACCA 4JWSC 3RNBC 2XGNA 1C77A 4P17A 3W2DA 1QLBB 2PADA 3M0EA 3M6AA 3AE4B 4ZYSA 4RGOS 2PE9A 3H9DA 2R9MA 1NYQA 5BYQA 3AEFB 2WU5B 3EGRA 4DV2M 1LM8B 2J42A 3IBEA 3TMPB 3RNVA 3I51A 2JZ0A 1ZGUB 3PREA 3DBHI 3E4RA 3SFEB 1K82A 1HT1E 4C4VA 2VHSA 3OLMD 1PE6A 3PLVA 1NHGC 2JY6B 4HRSA 2DXIA 1K50A 3NWLA 4FWGA 2BNKA 2EUCA 2L4EA 2LUMA 5K16A 4CDEB 4J6IA 2V3NA 2YEPF 2N7JA 2JXTA 2WQYB 3HRDD 1TGUA 5IZ7D 1TH3A 3C3EA 2K0PA 3JR5A 2FIFA 1AU4A 2LRUA 3NZUA 3WIMA 1S4VA 2JQFR 3RFZB 1B9RA 3WAOA 1AYVA 3A9JB 3S2AA 1BY8A 3KWZA 4GKJM 1WR6E 3LXSA 3ECIA 3BWUD 5JHBA 3RD2A 1S3SG 1YALA 4D8BA 1N33M 1RLFA 1ZAEA 4IIWA 2DKLA 2KC2A 4K0KM 2AQ3B 2R9NA 3MHZA 4LF6M 1ZXIA 2BWEA 5CHVC 2RMMA 3HX3A 2Z3XA 4WIPA 1Q5WB 3H8BA 3PW3A 4P7IA 3VLFB 6PADA 1FIQA 5E6PA 2YJ2A 1D5XC 3NZ3A 1QAQA 1YIWA 2DLBA 1FNWA 2KDMA 4KDIC 4A20A 1XNRM 3DBSA 4W9IA 4I04A 3ZTDA 1BXTA 3CGWA 3FKEA 5ITQA 2J4XA 3GRVA 4KKJA 3AU5A 1G3IA 4MH8A 2O6XA 4EZKA 4ZDVA 2KWDA 4M9ZA 1CB5A 5KPRA 2O6VA 1D4BA 2JT4B 4YL8A 1GC6A 3JW0X 5AUIA 1N34M 3FD9A 2DCAA 1C1YB 3AOEA 4DQOC 4F1SA 4XWWA 3NZSA 3Q8AA 3L2AA 2E6XA 3IHPC 4IJEA 2BKFA 5JH5C 2FIDA 3ZKJC 1TS5A 1UBIA 3NOBA 4LDTB 2KLCA 4FK5A 3GRYA 3ABVB 4W9GA 3QT4A 1JRPA 3ZNID 1YN3A 1Q39A 2Z0EB 3I63C 1C76A 2DX5B 3ZUAA 2KVRA 1YOVB 2J7QC 2N0SB 2IO2B 3BVMA 1UWXA 3VXWA 5KQDA 2QIEB 2WGSA 2Y3AA 4GKKM 1ISNA 3PT2B 3HHAA 3UIPB 2N9PC 2M0XA 2CWBA 3PRMB 4OVZB 4GHLA 2XZUA 3U6CA 1ZP0B 2LASA 2WLBA 3FKYA 1U5IA 1DOYA 3ZRFA 2K9XA 4CQNA 3Q8GA 3QYEA 3UK6A 3U52E 1KSFX 4FA6A 1DGFA 2OJRA 2BYVE 3HHWA 4LNIA 2KNAA 2RRUA 1YJJA 1T0QC 1QMYA 2F5NA 2IY0B 4ZUXU 2ZPYA 2PKOA 2DCCA 1HJPA 4WWNA 5GXGB 3VKGA 1E9RA 3M63B 5JXVA 5CX3A 2AYNA 4C7YA 1GJSA 2Y0TA 1IBMM 3AXCA 2CP8A 1SXJB 1KTKA 1EWYC 2DOSA 1N6ZA 3HWSA 2OOBA 1MPEA 1WX9A 2SEBD 3L54A 1W5SA 3I4VA 4I8OA 2YR0A 1GAQB 1XXGA 1HEZE 4CHTB 1TIFA 1NQCA 1TH2A 4C4VB 5F02A 4OVVA 3F92A 3Q69A 3QIJA 2EKEC 3ZXVA 2BB6A 1MHXA 3VHTC 2WNMA 3GZNB 4HXDB 2PTLA 3ML9A 1K3WA 1R2YA 4IBDA 5G55A 4LF5M 4NNJB 2XU1A 2FNAA 2KTFA 1CQDA 5C1ZA 2X4AA 4TKNA 3ZQ4A 3KLSX 2Z4SA 3MTNA 1FNUA 3E21A 4BKSA 3ZNHA 3FYCA 2BS3B 3AFHA 1NEKB 5D7GA 1PBHA 3H4MA 3PZDA 3ZGZA 2KDFB 4DK5A 3RNEC 2VHFA 4FVMA 3DFZA 5ITRA 3GZNI 1T43A 1RWSA 3P63A 4AW4A 3JSVA 1IBXA 2ARYA 3U60A 2LGYA 1T6BX 2Q2EB 2WXOA 4KLNA 5EJCA 5DPRA 3I5JC 2R4JA 3AEAB 1SG9A 4W9DA 1GC7A 3B2FA 1G71A 2JP7A 3T8MA 2BTWB 1YE9A 2DWLA 2XN9C 2FT2A 3P42A 3RGSA 4JI0M 1F77A 3A9KA 2JZPA 2I7PA 2C96A 2B1NA 3WALA 2G8EA 4ITKA 4FHJA 4BOZB 1CZPA 1J7CA 3NHEB 4LF9M 1I7HA 1WGDA 1SXTA 1SNKA 3R7RA 4N8WA 2ZTCA 1GNUA 4XUIA 2JRIB 2BB5A 2NBUA 1R2ZA 4I5SA 2LI5A 3NVZA 4BQVA 2D7EA 3DWMA 2YFQA 3W68A 4LNFA 3ZO5B 2RGOA 3NJTA 1AIPC 2DWNA 1N77A 4FADA 4WH4A 2KWUB 3B89A 3KW6A 3IAS1 4MGHA 3BVGA 2L52A 2ASQA 3P5VA 2LHDA 4JE3B 2MA9B 3LQRA 4MSXA 1R4NI 3AI8A 4DBGB 3VRBB 3MTVA 1ZOYB 4I6NB 3NUHB 4JIOU 2Z0DB 2J7NA 4II7A 4WP2A 3KW9A 2JUJA 4BOSC 4B6WA 4CDFB 1DEUA 1ZDXA 1CJLA 3ZQJA 4KKIA 1LTMA 2EKKA 2EMSA 3U6MA 2LGDA 2XEWA 2CR5A 3KOWE 1ZMUA 4ZRIA 5LXHA 2KWVB 4YVAA 1XCTL 1FM0D 3J80S 2FOIC 3A42A 4N59A 1XMOM 3VK7A 4DXGA 2R9FA 2D2QA 5JZEA 2LVPA 3AE7B 3THGA 2NQDB 4I05A 5FKAC 3WAMA 8CATA 1QAMA 3BPMA 3CSFA 3T9LA 1GLOA 2P86A 3MK6A 3OVZA 4FLHA 1U4AA 2JA2A 2L7IA 3E9SA 1TTNA 2DCBA 2BGFA 5T8IA 3BOWA 1AU3A 3FTEA 2A5UA 4L2YA 4MGKE 5EDSA 1PQSA 2WX1A 2CU1A 2DZNB 1KHPA 3Q3FA 4LF8M 2K25A 2NTSA 2LGXA 3C3DA 5EGWA 1OIPA 3DHHC 2VZKB 3QAUA 1WX8A 3URYA 3IHPA 5FR3A 3Q6BA 2KD0A 5A24A 3PTFC 4NRWA 4N9F4 4C56C 2HWJA 4MT5A 2WS3B 4D2KA 4LG2A 3NRZA 2J7QA 2JY8A 3GLFB 2L0TA 5CVMA 4HLEA 4Q8GA 3P4PB 3HU2A 1AUAA 3KUCB 4XYCA 3GP1A 3KUZA 3GLGB 3KFUG 4RM9A 4OHJA 3OF8A 1W5TA 4YTMB 2CV2A 5HI1A 2BWES 4ANVA 4AOFA 4B3MM 3AE3B 3DVGY 4RY2A 2ZVNA 5BMIA 4BBAA 1L2CA 5IN7A 2MEKA 2MH7A 1VDLA 1YT7A 4FWHA 2G8LA 3Q8EA 1PPPA 4IBBA 1P0RA 2C7NB 1L8QA 1HNZM 1JWUD 1T3QA 2FUDA 1E7VA 1IBXB 3JSVB 2QEJC 2KNBA 3U60B 3FTFA 2DYOA 4FJZA 4GSWA 4CDDB 3SMSA 1WGKA 2WSCF 4US9A 4I07A 3T1YM 1OKSA 1C78A 4K3BA 4XK8F 3DWGC 3VUXA 4K7SA 2LNHC 4AI6A 4GMVA 4LJOB 4AJYB 1C7YA 1MIRA 3PHXA 4GOCA 1D2NA 1WIVA 3PXGA 3L17A 4DV6M 3Q8CA 1D0LA 2DWZB 3RCZA 3MC9A 3PNYA 3I3TB 4KHPM 2ZBKB 2DENA 1I4XA 2H7JA 1TDZA 2LMCA 2CHVA 2L3ZA 1STFE 3JYUA 2DYMA 2D5GA 3T15A 2XU4A 5IREB 1TS4A 4DMYA 1WX7A 2C98A 2CS4A 2Z84A 4G3OA 1D0KA 2ATOA 2G8JA 4RGTA 4OU7A 3VTUA 3P5XA 4WJPA 2L7HA 4WWOA 1WHCA 3CH3X 3ML8A 1SXJC 1F0ZA 4MDKE 2IYDB 1ITOA 3U4EG 1ORYB 1V1OA 2V1UA 1GL6A 4FHKA 3U6OA 2ZVOA 3RVVA 4MH0E 2DAIA 4IWQA 1WGHA 1WF9A 2PMVA 3RT3B 3FC4A 2G45B 3AM9A 4BBNF 2NQAA 2XFTA 1EIJA 4B3TM 4ZYNA 3HY5A 5AZGA 3ILKA 1MHHE 2W9NA 4I81A 1HTOA 1IY2A 2FRAA 8PCHA 2J5YA 2JZ1A 1K53A 3HZJA 3SMPA 1FFUA 2V4LA 5DYIA 4LFAM 4PD2A 2V1CA 1QANA 4XR7A 1V9JA 1EWCA 2LZ6A 2PVGC 3GQ5A 4LJ7A 2V3SA 1PJTA 4G54A 3A45A 1X1MA 4AWJA 1U9XA 5FTNA 4OEMA 5KQ8A 5FLXS 2V4IB 2KXJA 5CHFA 5D6JB 4NC6A 1RM6C 3CIRB 3WAPA 2R6NA 3Q2AC 3RUIB 4TQ1A 4MJSB 1NNJA 4CISA 2RPQA 3ZDTA 3X0WA 3M3JA 1R4MB 1ZQ9A 3UIOB 3PSEA 1HA5A 3QK0A 2NQGA 2KT7A 1PRBA 2E3TA 3HUIA 3P4QB 1EU3A 3B2GA 3NVYA 4OZAA 3KS4A 1J7BA 3UMMA 4FJVB 1ET9A 2ZCCA 1FCLA 1JROA 4W4UA 4PCZA 4B3RM 1UNSA 1HTQA 3WXFA 3D8LA 3HJSA 2Q5WD 3A4SC 4ASWC 3QSDA 1IP9A 4JI5M 2ACTA 2L09A 2GBNA 2LXCA 1FXIA 4W9CA 1L2DA 3GPPA 2KC1A 1V81A 2JY6A 3V3XA 2D07B 3W1SA 3C8YA 3EECA 1ESFA 2R2OA 4NZLB 2Y6EA 2C99A 3VH3B 4LJ6A 1C4PA 1RAXA 2KQ7A 3GB1A 3U6LA 3N1YC 2YJ9A 2AIMA 5IAAC 3L27A 1PGXA 2BW2A 4HROA 1VEKA 2QQ8A 4USAA 3TIXA 4WA6A 4K3CA 4HDOA 3NG0A 3B9JA 1WGYA 4LJPB 1ENFA 1P7EA 2WSEF 3U8EA 4XGIA 1P9DU 1PGAA 4ZRQA 3M62B 4TSSA 2C5LC 1KF6B 3O0UA 1TS3A 1T6OA 1FXTB 2HKJA 4O1NA 3KWLA 3FE3A 1TKEA 1CVZA 3DBLB 2L05A 2CUZA 4TUUA 5AUKA 2KLGA 1DOXA 4M00A 2M1MA 4G4QA 1GO5A 3DBRB 1ZIVA 4AKGA 2LH0A 3MJ5A 5CTRC 1J09A 1CPJA 2UUBM 2KMCA 4M8NA 2I1KA 2BDZA 2F1GA 2AQ1B 3VR8B 2VF8A 4LGYA 3IECA 1WJNA 2WX0A 4IKGA 3TEXA 2FO5A 2LJIA 2GOWA 2KZRA 2R9OA 4MEMA 2PE6B 2QENA 1WGNA 1NBFC 3L4PA 2DC8A 4W5BA 3H6SA 3TCAA 2DC9A 3QJ3A 1WXQA 2GI9A 2MR9A 4YSYB 2R2QA 2HWKA 3NS1A 5J2RA 2V6ZM 3SAWA 3HHXA 1WH3A 5BYSA 4L15A 1SSNA 3BYTB 4MI7A 1AECA 2KJ6A 3K9PB 2CE7A 2M5ZA 1GCBA 4X57B 4W9LA 1YK7A 2DZOB 3R2TA 1KLVA 2HAKA 3UZUA 3P4SB 1KH0A 4DV0M 2LVOC 2Y20A 2GLSA 2CHZA 4G4RA 2WZJA 5C3JB 4XZXA 4EIWA 1IM2A 4IM3A 2LEKA 2QC8A 4II3B 1C4AA 2DNAA 4DHZE 2HL7A 3BB7A 4RCOA 3HM3A 4DR4M 1V34A 1YUBA 2DZYA 1PVJA 3W9CB 2FCNA 3DOAA 1VD2A 2R6FA 2VRRB 4EE2A 2C0YA 2JZZA 1MEMA 3RPFC 4PDIA 3IG5A 1Z2MA 1IYFA 3APDA 2YJ8A 3K9MA 3PT2A 1L2BA 4WAFA 2WXNA 4OVZA 4P6VF 2FS1A 4WURA 1T5XD 2LWPA 1K52A 4AXMA 1IGCA 3CF2A 2VH2A 3SASA 1V49A 1J8CA 2AVWA 1UELA 3C19A 5FR6A 1TJEA 2YLMA 2R9CA 4R71A 2ACZB 2K0BX 1IGDA 5GKNA 4A55A 3N4CA 3BK1A 4PS3A 5BMGA 1IPGA 4AZFA 1Y56A 4ITQA 4HKZE 4NAMA 2OHFA 1SXJA 3AE8B 1FPYA 4IM0A 4RF1A 4G50A 3BINA 3PS6A 4CO7A 1FEHA 1XO3A 2R0IA 1SE9A 2KX0A 1GB4A 1D0MA 1QAOA 1T0RC 4Q2JA 2PBHA 3TRKA 1JW9D 2G4SA 3RNGC 1XEEA 1MN3A 7CATA 2D10A 5CVNB 3LJ3A 5CHTA 4HXDA 2ZM6M 2VDBB 2NPTA 2KMAA 1EWOA 3SATA 2ZAOA 5FTLA 3K24A 1F29A 4FJCA 2NBVB 1P3QU 2KRKA 4PS7A 2CV0A 2DWQA 2G3QB 3GRUA 4NSRA 4QNRA 2HHNA 1WR1A 2MH8A 4GRIA 3W1YA 4FCWA 4DHZB 3T3NA 4QBBA 1ZE3D 1OFIA 5LMNM 3AE6B 3L28A 4KSLC 5TSSA 3KQ4A 5E6OA 2HH5A 1K3BB 2KDIA 1D5MC 4W9HA 3OQCA 4LLGM 2V3PA 1UM8A 2W54A 4GN1A 4FWDA 4GITA 2JU6X 1FFVA 3PFIA 2MX2A 4NRVA 1YQBA 2LGSA 2NCNA 5LMUM 1NYRA 5IKCM 3QWLA 3W0FA 2K6BA 3MC0B 2BTWA 1N5WA 1EWLA 4G3XB 2WP9B 2DAJA 1UKFA 4AKHA 5EF4A 4ZTBA 3ALBA 3SR6A 1U9WA 4K7UA 2WXPA 4YYRA 3OF9A 1KLUD 4BOZA 2ERCA 2QPAA 1SXJE 1ICFA 2NBWB 1L6UA 4LFCM 3TWKA 3I04M 5ITYA 3NHEA 3O1GA 4JYAM 2LVNC 4KO8A 1IY0A 2JRIA 4RNAA 5CHWA 1IWDA 3RN9C 3ZIMA 1TBEA 2L4FA 4WWPA 1NO1A 4A3OA 1T0SC 2PEAA 1SB3C 4KLBA 2VF7A 3TUOA 1AU2A 3H8HA 1S3SA 2KTRB 1TZOA 2AGAA 3LCVB 4DBGA 2IPKD 4CYEA 2GB1A 1AW7A 4FJYA 2RGHA 1FRRA 1R7SA 2UYZB 1HNXM 2WXJA 3PGEA 2R61A 5IT9S 4GB9A 1TYGB 1PJSA 1I94M 3KYCD 3JAMS 3H7PB 5L83A 1PJIA 3C58A 3EUB2 1WZ3A 1MFWA 1XMQM 2BDLA 3Q3JA 1IXSB 1NDDA 3IXSA 2RKOA 1FCCC 1ZPSA 1ZMWA 3KSJA 4ANUA 4GC5A 4W9FA 2CRUA 3HWNA 1F2AA 1A6RA 1FNVA 4HL4A 2K9DA 2VIIA 1V8CA 4C00A 1FD6A 2XEPA 3FUUA 2XK5B 3KVWA 2VQEM 4K7CA 2NMQA 1K8RB 3VTWA 4LF7M 1OFFA 1GECE 4JPSA 3AEEB 1E5WA 1Q0WB 4NJCA 2K6DB 4LJ9A 3GOEA 5DPSA 3O65B 2WXKA 4N6EB 3LQQA 1VEJA 3FUWA 3ZRCA 2OQ4A 1QOAA 2KNVA 1MX0A 4DHJD 3EIEA 4M9SA 1L7YA 1QUTA 1PGBA 5FSWA 1A5RA 2MBQA 3V6CA 2LVOA 2KNZA 3LVVA 1XF5L 4B0MA 1XHBA 1Z6TA 3HHMA 1ZXHA 5C2TB 2OP3A 3BIID 3MFGA 1IXRC 2VQFM 1V86A 2C60A 1P7FA 3VTVA 1E9SA 3SARA 3KOYE 1NLJA 2NPTB 3GLFA 2HTHA 1YK8A 5PADA 4ACFA 4BZAA 4PDGA 3GLGA 3DVNV 3ZJUA 4LJ5A 2DC6A 2D7HA 1Y8GA 4JGHB 3VAWA 4QRGA 4C7ZA 3MJWA 1WR1B 1L1TA 2JUOA 2KACA 4IBJA 4A3PA 4PK1A 3BCNA 2L76A 4EEWA 1BVSA 5E6NA 1WJ4A 4FCVA 3DZDA 3CBJA 1NB5A 1NV8A 2MROB 1HNWM 3BOSA 2V1YA 2K1FA 2IDYA 1KFUL 2LVQD 4ZPXA 3LCUA 3VKHA 3AU4A 1L4ZB 5HKHA 3DHIC 2HJ1A 1HXYD 2DJGB 4KIKB 4HPLB 2W82A 4MZSA 4GH9A 1PPOA 1WGGA 1X37A 4DV7M 1QDTA 3L08A 2L6OA 3RZWC 4YSXB 3W30A 5HHDG 1VRAB 3SEBA 2MJEA 5DYGA 1DGHA 3I3TA 2WU2B 4K81A 1A70A 2KHWB 4WQMA 1R4NB 2G6DA 2ZJDA 4G11A 3I9V1 1GB1A 2J0KA 3HVZA 1PXVA 3QARA 1VDVA 2DJFB 3M99A 2CEAA 3MP9A 1L1ZA 3N3KB 5I4DA 1CK1A 1EF7A 3D6SA 2HDEA 2DVWB 1JR3D 2E5LM 3L0WB 3IOQA 2GBKA 2AQ2B 2C7MB 3VDZA 1G41A 1QILA 4ZHOA 4L23A 2LFIA 3GLFE 3DPDA 2LVQA 1G4AE 1MU5A 3EIHA 4LNKA 3R7QA 3GLGE 3NY5A 5FTJA 1AN8A 3N20C 2KDBA 4IDIA 1OAIA 1QDRA 3GLHA 4AQYM 3TSSA 1PFDA 1L2NA 2I2YA 5F3WA 4XC2A 1DKIA 4I4LA 2MP2B 2FCSA 3KFQA 4DXFA 1QQRA 1WGLA 2FFJA 2M8SA 4DDGD 3KKUA 1MJDA 3WHKA 4DR3M 5CHVA 3B7ZA 2D3GA 3I06A 1VJKA 3HM6X 1LQBA 1T0YA 2H5XA 4AKIA 4H2AA 4BSQA 1WZ0A 1GMYA 4Z8XA 1V97A 4XWTA 2UU7A 1J7AA 5G2NA 1MEGA 2MBBB 3KVFB 3E46A 2OEDA 1I4WA 3CBKA 3KUDB 1OQYA 4A3VB 2KFKB 4E71A 1EWPA 4BPVA 3CSTA 1TT5B 5IWAM 4EZJA 4HPPA 1IN8A 4MJSA 5H37D 1IXZA 2ONQA 4BS5A 5L95C 1IUEA 2REXA 4IBCA 4LJ4A 3NBXX 3J7AS 1WMHB 4C80A 3AH7A 2DC7A 1E8XA 4LRTA 1QF6A 3AE5B 1VQ1A 3APFA 2IGHA 3UF8A 3N9YC
chains in the Genus database with same CATH topology
3HJQA 2BU3A 4KX6B 2GRIA 3PZ7A 5EZQA 5D3DA 4RGNA 3U7ZA 3TWMA 4NXMM 2EA0A 1IN6A 3KS8A 3ZJTA 4S12A 5BYRA 1CJEA 1HZ5A 3V05A 5EP1A 4XE0A 1IY1A 2A5YB 1QYRA 2JWUA 3K1JA 4YY3M 2J53A 2CJNA 3J27B 2W3RA 1L5PA 2MJ3A 2INNE 4KGSA 2F5OA 2QCUA 4X64M 3LXFA 3U6DA 4BB9A 3GQ3A 4M0DA 5MPOA 2RPVA 4MB7A 1IBKM 3JR4A 5EXTA 1DGHB 3U6PA 3IG8A 4DV4M 3U6EA 1OQRA 3WCQA 2R45A 5H8YE 3HKPA 3KSXA 1AWDA 1JQ4A 4KGRA 2YQZA 2KEBA 2V0GA 3K92A 1N63A 3IAM1 2BBCA 3FUXA 1NSFA 1E32A 1EM7A 4LFBM 3T1HM 2QBYB 1E9MA 1JWAD 3OTOM 2R65A 5ITTA 1C79A 1YJIA 2FUG1 2UUCM 3W0LB 1UUPA 2WXHA 2AHMA 3SC3A 2WDQB 3GLHB 4A6QA 3KWVA 2B76B 3HHZA 2FE8A 2RDHA 1GLNA 2QILA 4MGZE 2D7GA 4M9XA 3GQ4A 3ETRA 1QKZA 1H6UA 3R9XB 1NNUC 1EE8A 2UUAM 4DUYM 2KXEA 2Z7JA 1FO4A 3W31A 1C4CA 1BUIC 3GLIB 4JI2M 2XZFA 4FCTA 4LJAA 4QOZC 2Y0QA 1DGJA 4RH6A 1XC8A 2F5SA 4TUWA 4RGMA 1IN5A 2KQ4X 3GPUA 4DR5M 1TS2A 1UWMA 3AE2B 2WXRA 1OFHA 4NL4H 4YSZB 4X66M 4BOSA 1Z5AA 4MGIE 2H1RA 3SBJA 1WYGA 3CF0A 1VLBA 2I7NA 2KA6B 2WXFA 2LXEA 1SE4A 1I4RA 2XSZD 4IBEA 1XLQA 4AQ7A 1YSYA 3PHWA 4LCBA 3UJNA 4JXJA 1NI3A 3FAHA 1PDXA 3W5UB 1CQVA 3GPXA 1HZ6A 1Z5CA 3HHYA 1DGBA 4FD2A 4DR6M 3TWLA 1OQQA 2XNAC 2KAJA 5ITUA 4HEA1 1PYWD 2KRUA 2BT6A 1GVNA 5EXPA 4FXCA 1QOFA 2H89B 4QHTA 3LB8C 2AX5A 4B7HA 3K8ZA 3FILA 4GUAA 3TL4X 4WW0A 1SE3A 3PZ8A 4G6ZA 3RE8A 2QJLA 2INPE 3NBIA 4BLCA 1NVMA 3T38A 1JWBD 3OWEB 3GPYA 4LF4M 4W5WA 2CV1A 3LMMA 2R62A 2Z8LA 4B7GA 1IBLM 4GHAA 4MM3B 3PHUA 1E0ZA 4L8RC 2BJWA 1SJED 2ZAMA 4YWGG 1Q3BA 2G5GX 1UGJA 4QOSA 4CGYB 5JI3E 2R4EA 4KODA 5EE0A 3O65A 1TKGA 4YTNB 4JI8M 2JQRB 3L26A 3AOGA 3E56A 3HJ8A 1ET6A 3VFDA 4M0WA 3I4YA 3Q8FA 1DO0A 1E94E 2WDRB 1QZMA 3WHLA 2L1AA 3FTCA 2KN4A 4YXDB 3UGJA 4LY6A 4OX9M 2HHHM 2Y5PA 3KDSE 4DUZM 4JI4M 4TMAB 2HTME 1XLNA 3VQIA 1N60A 3MP2A 4KGTA 2KZUA 3AMZA 1L4DB 4B0EA 2WXMA 2KMMA 1DO2A 4GLSC 2DBYA 2K22A 1PUTA 3TEWA 1K3XA 1VZ6A 1E6EB 4A9AA 5BMHA 1TDHA 4ZRPA 1J7KA 4JI7M 3IFUA 1JWMD 3CTWB 3AN1A 2QMTA 1MI0A 1Z5BA 4AG6A 2KW0A 1WRIA 3VRAB 4HJGE 2ZANA 1D5ZC 1GOZA 1NVID 2X49A 4NSOB 3A46A 2Y5CA 3ZH9B 3BY4A 3W5VB 2N9LA 2IGDA 1XLOA 2ON8A 4D81A 1HQRD 4G4NA 4ARIA 1DOIA 5LNK1 2UXBM 1Q3CA 2M0AA 3KOZE 3IT6B 3VDPA 1XXHB 4R3DA 3K2LA 4A90A 3TQSA 2C9CA 2JYEA 3ZCBB 1RFKA 3AEBB 3FILB 1N61A 3RFWA 3U61B 1NHWC 2UXDM 4LK0M 1VZ8A 4DR2M 1KLGD 5EXSA 1N62A 4LZJA 3TE6A 2J7OA 1FRDA 2O5RA 1V1PA 2ZW0A 3KP0E 3R8FA 5FK9C 1KRHA 1RYJA 4GDLB 3AECB 4DV1M 3PVSA 1L0XB 2XFSA 1HQYE 4LJ8A 4D80A 3KP1E 2Y21A 2LHEA 2VZKD 2UZJA 2HCBA 3VDUA 2N9KA 4JWUC 5HG2A 1OJLA 2FBWB 3BK2A 4A5UA 1VR9A 3BYYB 2WDVB 1N5XA 2PLPA 1K51A 1C1KA 2P5TA 1T3TA 3VR9B 1N32M 2BTEA 1JMLA 4XDDA 3SFDB 2LGIA 4J3OD 4GMQA 3SYKA 4BOUA 4P16A 3P4RB 5FTMA 3C0RA 4LGMA 4REZA 3SFZA 5EE3A 2MJDA 3U6QA 3AV0A 5C18A 2G1EA 1KFYB 1IQPA 4NOOB 1JCKB 1FXAA 2F4VM 2SAKA 1JQJC 3AJIB 2NQ8C 1DGGA 3Q8BA 4ARCA 2QP9X 5G5GA 4AG5A 1E7PB 4L16A 3PO0A 4LTUA 3B21A 4QNMA 1IN4A 1I4PA 1M4VA 1GPXA 1R6BX 1YQ3B 5EP4A 4JI6M 5KO3A 4JX1C 1G59A 2JTCA 3U6SA 4B08A 1VDDA 3SHGB 2QBYA 5EP2A 5EXXA 2PW9A 4IUMA 4XBOA 1STEA 1F2RI 1KFVA 1QVRA 4YT0B 1L0VB 3HU3A 2BS2B 1V1PB 1HR0M 1N78A 2C9OA 2WXQA 1N36M 3ZC7B 1NJFA 1Z59A 4RFBA 3A98B 1QOBA 2BJVA 3MHVC 2BS4B 2ZW1A 3B9PA 1JR3A 3FUTA 4IBIA 4BOQA 2M19A 4HKQA 1QQWA 3GLIA 4DR7M 4D8IA 1NJGA 4DV5M 2CU3A 2F5QA 1FJGM 3P1MA 1J5EM 4GC9A 1N75A 4IBFA 2IGGA 1EU4A 1SBBB 5BR8M 3AKZA 4AS1A 4TQ0A 3BVZA 2XLJA 2L83A 2CFOA 1SF0A 5EE1A 2RDGA 3GP7A 5EZSA 3KOXE 2LWXA 3DA1A 1YQ4B 2F5PA 4A8XC 3U5ZA 1PM5A 4OZBA 1E10A 2PIAA 1GL7A 4IBKA 1WSPA 4X62M 3FTDA 1I4HA 2XH9A 2DHRA 5D3IB 3NVWA 2QSDA 4LRSA 1YNTE 3M7GA 2JYTA 3T3OA 3LYYA 1NY5A 1TH4A 1G8PA 3TEZA 1R7RA 1L0YB 2BYTA 1B1ZA 3O13A 4MACA 1TKYA 3J81S 3KXEC 1AYFA 5ITXA 3ZJVA 2YEPB 2WXLA 2EELA 2K5PA 4IOIE 4L1BA 3U2SC 1QT9A 4OZCA 5EP3A 2G9HD 2JX5A 5JI2E 4PT5A 1FMAD 4NAWB 3AL0C 2OPFA 3SAUA 1VZ7A 1LO5D 5KPTA 4IBGA 1YN5A 3TPZA 3J9CA 4NXNM 3HU1A 5E26A 2JSVX 1MVKA 2CJOA 4IJFA 1IN7A 2X38A 3FUVA 4XDCA 2UU9M 5EE9A 2EKIA 3GRRA 3R2IA 2WXIA 4ZHPA 5ITXE 4JI1M 3CWIA 3AEGB 1BMLC 2I38A 2DWMA 1DYQA 5A2QS 1JWSD 3FYDA 2W3SA 1XLPA 2EO2A 4IP3A 2C5RA 4N58A 3SHFA 1F2RC 3HGIA 2Z4RA 1FNNA 4G4OA 3GO8A 2K3UA 3R8BA 3AB5A 4Z6YA 3UI3A 5DNYA 2J52A 3IT4B 1I4GA 1I4QA 3BZDB 1XCQL 3LVWA 4L4UA 4YTPB 3TMPA 3U5ZB 1YMHE 1TY2A 3SAVA 3SYLA 1YN4A 1C9FA 4DR1M 5H92C 2K47A 3AE1B 4X65M 4BOPA 3L25A 2NTTA 2R46A 4UDUC 1D6EC 2CHQA 1SIJA 4RF0A 2KZSA 2QZ4A 1ZUD2 3I57A 3AOEC 3AV8A 1HQCA 2W55A 3D8BA 2PVOD 3BBAA 4R7GA 1L6VA 3NVVA 4LZZA 2XF3A 4US8A 1SJHD 4HLQA 1HT2E 2M56B 4D82A 5E6JA 2H88B 1TY0A 1XWIA 2R18A 5G5HA 2TSSA 5EQTA 1ZDVA 2ICIA 1XXHA 3GS2A 4GDKB 2XSZA 1SE2A 4JN6A 4DV3M 3U61A 1XNQM 2M60A 3PNVA 4QHSA 1NY6A 2YNMD 5C1BA 3AE9B 4JI3M 4D8EA 1NENB 4B3SM 3HVDA 1PJJA 1GKIA 1SEBD 3L29A 1WWTA 2CHGA 4JV5M 3CF6E 3ZYYX 1Q10A 4L78A 4FW9A 5KPZA 1ROEA 5HFYA 1SXJD 2WXGA 3EA6A 3PRPA 4GIPA 1KYIA 2IJ0A 1LV7A 1JALA 4YHHM 3TEYA 3PRMA 1YZBA 3VK8A 3J7BA 4ZOHC 4B7FA 3Q8XA 5FTKA 4OW0A 4MGYE 2X8AA 3AEDB 2L32A 5BPVA 3RGPA 3J2PB 1QOGA 4WWMA 4RKXA 2UXCM 1ACCA 4JWSC 2XGNA 1C77A 3W2DA 1QLBB 3M0EA 3M6AA 3AE4B 4ZYSA 4RGOS 1NYQA 5BYQA 3AEFB 2WU5B 3EGRA 4DV2M 2J42A 3RNVA 3I51A 3SFEB 3E4RA 1K82A 1HT1E 1NHGC 4HRSA 2DXIA 1K50A 3NWLA 4FWGA 2BNKA 2EUCA 2LUMA 2V3NA 2YEPF 2N7JA 2JXTA 2WQYB 3HRDD 1TGUA 5IZ7D 1TH3A 2K0PA 3JR5A 3RFZB 1B9RA 4GKJM 3BWUD 4D8BA 1N33M 1ZAEA 4IIWA 4K0KM 2AQ3B 3MHZA 4LF6M 1ZXIA 2RMMA 2Z3XA 4WIPA 3VLFB 1FIQA 1D5XC 3NZ3A 1QAQA 2DLBA 1FNWA 2KDMA 1XNRM 1BXTA 3FKEA 5ITQA 2J4XA 3GRVA 4KKJA 1G3IA 4MH8A 2KWDA 4M9ZA 5KPRA 1D4BA 5AUIA 1N34M 3FD9A 3AOEA 4DQOC 4XWWA 3Q8AA 3L2AA 2E6XA 4IJEA 1TS5A 3GRYA 3ABVB 1JRPA 1YN3A 1Q39A 1C76A 2J7QC 2N0SB 3BVMA 1UWXA 5KQDA 2QIEB 2Y3AA 4GKKM 4OVZB 4GHLA 2XZUA 3U6CA 1ZP0B 2WLBA 1DOYA 2K9XA 4CQNA 3UK6A 3U52E 1KSFX 1DGFA 3HHWA 1YJJA 2F5NA 2PKOA 5GXGB 3VKGA 1E9RA 5JXVA 4C7YA 2Y0TA 1IBMM 1SXJB 1KTKA 1EWYC 2DOSA 3HWSA 1MPEA 2SEBD 1W5SA 3I4VA 4I8OA 2YR0A 1GAQB 1XXGA 1HEZE 4CHTB 1TH2A 3Q69A 2BB6A 1MHXA 2WNMA 4HXDB 2PTLA 1K3WA 1R2YA 4IBDA 4LF5M 2FNAA 2X4AA 3ZQ4A 3KLSX 2Z4SA 1FNUA 3ZNHA 3FYCA 2BS3B 3AFHA 1NEKB 5D7GA 3H4MA 3ZGZA 4FVMA 3DFZA 5ITRA 1RWSA 3P63A 4AW4A 1IBXA 3U60A 1T6BX 2Q2EB 2WXOA 4KLNA 5EJCA 2R4JA 3AEAB 3B2FA 2BTWB 1YE9A 2DWLA 2XN9C 3P42A 3RGSA 4JI0M 1F77A 2JZPA 2I7PA 2C96A 4ITKA 1CZPA 1J7CA 4LF9M 1I7HA 1SXTA 2BB5A 1R2ZA 4I5SA 3NVZA 2D7EA 3DWMA 2YFQA 2RGOA 2DWNA 1N77A 4WH4A 3KW6A 3IAS1 4MGHA 3BVGA 2L52A 2LHDA 4JE3B 3LQRA 3VRBB 3MTVA 1ZOYB 3NUHB 2J7NA 4II7A 1ZDXA 4KKIA 3U6MA 3KOWE 1XCTL 1FM0D 3J80S 2FOIC 3A42A 4N59A 1XMOM 3VK7A 4DXGA 5JZEA 3AE7B 3THGA 5FKAC 8CATA 1QAMA 3MK6A 2JA2A 2L7IA 3E9SA 5T8IA 3FTEA 4L2YA 4MGKE 2DZNB 4LF8M 2NTSA 2VZKB 3QAUA 3URYA 5FR3A 4NRWA 4C56C 4MT5A 2WS3B 4D2KA 4LG2A 3NRZA 2J7QA 3GLFB 3P4PB 3HU2A 3GP1A 3GLGB 3KFUG 4OHJA 1W5TA 4YTMB 2CV2A 5HI1A 4B3MM 3AE3B 5BMIA 4BBAA 1L2CA 2MEKA 2MH7A 4FWHA 2G8LA 3Q8EA 4IBBA 1L8QA 1HNZM 1JWUD 1T3QA 1IBXB 2QEJC 3U60B 3FTFA 2DYOA 3SMSA 1WGKA 4US9A 3T1YM 1C78A 3DWGC 2LNHC 4AI6A 3PHXA 1D2NA 3Q8CA 3PXGA 4DV6M 2DWZB 3PNYA 4KHPM 2ZBKB 1I4XA 1TDZA 2LMCA 2CHVA 2DYMA 2D5GA 3T15A 5IREB 1TS4A 2C98A 2Z84A 4RGTA 4OU7A 2L7HA 1SXJC 1F0ZA 3U4EG 1ORYB 1V1OA 2V1UA 1GL6A 3U6OA 4MH0E 2PMVA 3FC4A 3AM9A 2XFTA 4B3TM 3ILKA 1MHHE 4I81A 1IY2A 1K53A 3SMPA 1FFUA 5DYIA 4LFAM 4PD2A 2V1CA 1QANA 1EWCA 2PVGC 3GQ5A 4LJ7A 3A45A 5FTNA 5KQ8A 5FLXS 2V4IB 1RM6C 3CIRB 4TQ1A 1NNJA 4CISA 1ZQ9A 3PSEA 1HA5A 2E3TA 3HUIA 3P4QB 1EU3A 3B2GA 3NVYA 4OZAA 3KS4A 1J7BA 3UMMA 1ET9A 1FCLA 1JROA 4PCZA 4B3RM 1UNSA 3D8LA 3HJSA 2Q5WD 4JI5M 2L09A 1FXIA 1L2DA 3GPPA 3V3XA 3W1SA 3C8YA 1ESFA 4NZLB 2C99A 4LJ6A 1C4PA 3GB1A 3U6LA 3L27A 1PGXA 2BW2A 4HROA 4USAA 3B9JA 1ENFA 1P7EA 4XGIA 1PGAA 4ZRQA 4TSSA 1KF6B 1TS3A 2HKJA 4O1NA 3KWLA 1TKEA 5AUKA 2CUZA 1DOXA 4G4QA 4AKGA 2LH0A 3MJ5A 1J09A 2UUBM 2AQ1B 3VR8B 4LGYA 4IKGA 3TEXA 2LJIA 2QENA 3L4PA 1WXQA 2GI9A 4YSYB 2HWKA 3NS1A 2V6ZM 3SAWA 3HHXA 5BYSA 4L15A 1SSNA 3BYTB 4MI7A 2CE7A 2M5ZA 2DZOB 3R2TA 3UZUA 3P4SB 1KH0A 4DV0M 2Y20A 4G4RA 5C3JB 4XZXA 4EIWA 1IM2A 2LEKA 1C4AA 2HL7A 3BB7A 4RCOA 4DR4M 1YUBA 1PVJA 3W9CB 3DOAA 4EE2A 3RPFC 4PDIA 3IG5A 3PT2A 1L2BA 4WAFA 2WXNA 4OVZA 4P6VF 4WURA 1T5XD 1K52A 1IGCA 3CF2A 3SASA 1TJEA 2ACZB 1IGDA 5GKNA 4A55A 3BK1A 5BMGA 4AZFA 1Y56A 4ITQA 4HKZE 4NAMA 2OHFA 1SXJA 3AE8B 4RF1A 1FEHA 1XO3A 1GB4A 1QAOA 4Q2JA 3TRKA 1JW9D 1XEEA 7CATA 2ZM6M 3SATA 2ZAOA 5FTLA 2KRKA 2CV0A 2DWQA 3GRUA 4NSRA 4QNRA 4GRIA 4FCWA 3T3NA 1ZE3D 1OFIA 5LMNM 3AE6B 3L28A 5TSSA 3KQ4A 1D5MC 3OQCA 4LLGM 2V3PA 1UM8A 2W54A 4FWDA 4GITA 2JU6X 1FFVA 3PFIA 4NRVA 5LMUM 1NYRA 3QWLA 3W0FA 3MC0B 2BTWA 1N5WA 2WP9B 1UKFA 4AKHA 4ZTBA 3SR6A 2WXPA 1KLUD 4BOZA 2ERCA 2QPAA 1SXJE 1L6UA 4LFCM 3TWKA 5ITYA 4JYAM 4KO8A 1IY0A 2JRIA 4RNAA 1SB3C 3TUOA 3H8HA 1S3SA 1TZOA 2AGAA 2IPKD 2GB1A 1AW7A 2RGHA 1FRRA 1R7SA 2WXJA 1HNXM 2R61A 5IT9S 1TYGB 1I94M 3JAMS 1PJIA 3C58A 3EUB2 1XMQM 1IXSB 3IXSA 2RKOA 1FCCC 1ZPSA 3KSJA 4GC5A 4HL4A 1FNVA 2VIIA 1V8CA 1FD6A 2XEPA 3FUUA 3KVWA 2VQEM 2NMQA 4LF7M 1OFFA 4JPSA 3AEEB 4NJCA 4LJ9A 2WXKA 4N6EB 3LQQA 3FUWA 2OQ4A 1QOAA 1MX0A 3EIEA 4M9SA 1PGBA 5FSWA 4B0MA 1XF5L 3LVVA 1XHBA 1Z6TA 1ZXHA 5C2TB 3BIID 3MFGA 1IXRC 2VQFM 1P7FA 1E9SA 3SARA 3KOYE 3GLFA 4PDGA 3GLGA 3ZJUA 4LJ5A 2D7HA 4C7ZA 1L1TA 2KACA 4IBJA 4FCVA 3DZDA 1HNWM 3BOSA 2IDYA 4ZPXA 3VKHA 1L4ZB 1HXYD 2W82A 4GH9A 1X37A 4DV7M 2L6OA 4YSXB 3W30A 5HHDG 1VRAB 3SEBA 2MJEA 5DYGA 1DGHA 2WU2B 1A70A 4WQMA 3I9V1 1GB1A 3HVZA 1VDVA 2CEAA 3MP9A 1L1ZA 5I4DA 1CK1A 2HDEA 2DVWB 1JR3D 2E5LM 2AQ2B 1G41A 1QILA 4ZHOA 4L23A 2LFIA 1MU5A 1G4AE 3EIHA 5FTJA 1AN8A 4IDIA 3GLHA 4AQYM 3TSSA 1PFDA 1DKIA 2I2YA 5F3WA 4I4LA 4DXFA 1QQRA 2FFJA 3WHKA 4DR3M 1VJKA 4AKIA 4H2AA 4Z8XA 1V97A 4XWTA 1J7AA 2OEDA 1I4WA 4A3VB 5IWAM 1IN8A 5H37D 1IXZA 2ONQA 1IUEA 4IBCA 4LJ4A 3J7AS 4C80A 3AH7A 4LRTA 1QF6A 3AE5B 2IGHA 3N9YC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MJ5 A;  4PT5 A;  4RNA A;  3E9S A;  4P16 A;  4MM3 B;  5KO3 A;  4REZ A;  4R3D A;  4OVZ A;  4RF1 A;  3MP2 A;  2FE8 A;  4WUR A;  4M0W A;  4OVZ B;  4OW0 A;  5E6J A;  4RF0 A; 
#chains in the Genus database with same CATH topology
 1E7U A;  3HJQ A;  2BU3 A;  4KX6 B;  4K7W A;  3V6C B;  2KOX A;  2GRI A;  3PZ7 A;  5AZF A;  5EZQ A;  3CMM B;  3ZTC A;  5D3D A;  4RGN A;  3U7Z A;  3TWM A;  4FUL A;  4TV3 A;  1H4R A;  4NXM M;  5J18 A;  2EA0 A;  1U9V A;  4XZ4 A;  2FRQ A;  4KDL B;  1QZE A;  1IN6 A;  3C0R B;  5JHA A;  3KS8 A;  3GLH E;  4ANR A;  3ZJT A;  4JQW C;  4S12 A;  3AI5 A;  2M4N A;  5BYR A;  1AYU A;  1CJE A;  1HZ5 A;  3V05 A;  2ZPN A;  1YLA A;  5EP1 A;  2C7H A;  4NPN A;  4XE0 A;  1IY1 A;  2A5Y B;  2RSU A;  4ANX A;  1QYR A;  2JWU A;  3K1J A;  4YY3 M;  1EF5 A;  2CJN A;  3J27 B;  2J53 A;  2W3R A;  5IA7 A;  1L5P A;  2MJ3 A;  2INN E;  2KVZ A;  4CIZ A;  4KGS A;  2F5O A;  1AAR A;  2QCU A;  4X64 M;  3LXF A;  3U6D A;  4BB9 A;  3SU8 X;  3GQ3 A;  2MJ5 B;  3VUY A;  4M0D A;  2RR9 A;  2GQF A;  3PRZ A;  5MPO A;  2KDL A;  1KFX L;  3TL5 A;  2KQS A;  2RPV A;  4ZRK A;  2FTD A;  4MB7 A;  1IBK M;  4YYV A;  3JR4 A;  5EXT A;  2LXA A;  1DGH B;  4HJK A;  3U6P A;  3HIZ A;  3RVW A;  3IG8 A;  4DV4 M;  3U6E A;  2XU3 A;  1MG4 A;  1AIM A;  1OQR A;  1UF0 A;  2VH1 A;  2R45 A;  1LXD A;  4NJ7 A;  5H8Y E;  3WCQ A;  3HKP A;  3KSX A;  1AWD A;  1JQ4 A;  4KGR A;  2YQZ A;  5D2M B;  2KEB A;  3HK0 A;  2V0G A;  3KWB X;  2DAE A;  3K92 A;  1N63 A;  3IAM 1;  2BBC A;  3FUX A;  3EHV A;  1NSF A;  3K9P A;  1R5L A;  4P6E A;  1E32 A;  1WJ7 A;  3ZNG C;  1Q02 A;  3B74 A;  2J0M A;  1EM7 A;  5DCN A;  1PPD A;  4LFB M;  3LDZ E;  1CMX B;  3T1H M;  2QBY B;  1E9M A;  1JWA D;  2XBB C;  2K8H A;  1ZMV A;  3OTO M;  4IUM B;  3PV1 A;  2JY5 A;  4JLC A;  2R65 A;  5ITT A;  1C79 A;  1YJI A;  2FUG 1;  1WM2 A;  3C9P A;  2UUC M;  3V61 A;  2PNS A;  3W0L B;  1UUP A;  2WXH A;  2AHM A;  3SC3 A;  2WDQ B;  3GLH B;  4A6Q A;  2MSE D;  3KWV A;  4II2 B;  2B76 B;  3HHZ A;  4E74 A;  2FE8 A;  2RDH A;  1WJU A;  5GMV A;  4F2L A;  4PS8 A;  1Y4H A;  1GLN A;  1V33 A;  2QIL A;  4MGZ E;  4IWO A;  2D7G A;  4M9X A;  3GQ4 A;  2X8X X;  3ETR A;  2GHU A;  1QKZ A;  1H6U A;  1F1H A;  1WY8 A;  3R9X B;  4Q7J A;  1EO6 A;  1NNU C;  1H8C A;  1EE8 A;  1RRB A;  2UUA M;  3AUL A;  4DUY M;  5KHO A;  2KXE A;  2Z7J A;  1FO4 A;  4KT0 F;  3HHI A;  3RMK C;  3W31 A;  1VEG A;  1C4C A;  3RUL A;  4YYW A;  1S1Q B;  1VCB A;  2LRW A;  2YVC A;  3LFY A;  2NQI A;  5DFL A;  1BUI C;  3GLI B;  4JI2 M;  4AUQ C;  2XZF A;  4FCT A;  3VVW B;  4LJA A;  2C9W B;  3S3Q A;  4QOZ C;  2GBM A;  3OG5 A;  2Y0Q A;  2LVA A;  1DGJ A;  4RH6 A;  1XC8 A;  3FRH A;  2AUZ A;  2F5S A;  1XT9 B;  4TUW A;  4RGM A;  1IN5 A;  2I1J A;  4LCD E;  2KQ4 X;  3GPU A;  1E8Z A;  2RDB C;  4DR5 M;  3QCA A;  1TS2 A;  1UWM A;  1KHQ A;  2MCN B;  4BVU C;  1I42 A;  3AE2 B;  2WXR A;  1OFH A;  3V6E A;  4MEL A;  4NL4 H;  4LNN A;  4YSZ B;  4X66 M;  1WGR A;  3ZXR A;  4BOS A;  1XB2 B;  1Z5A A;  2LTU A;  3GCB A;  4MGI E;  3OJ3 A;  5DPT A;  2H1R A;  5JA7 A;  1JB0 F;  3SBJ A;  1WYG A;  2J0J A;  3CF0 A;  2JPH A;  1XKG A;  2G3Q A;  2I7N A;  1VLB A;  2KA6 B;  2DHY A;  1O0E A;  4FIP A;  1GJT A;  2WXF A;  3GE3 C;  2LXE A;  4I6P A;  1X9Y A;  1SE4 A;  1WXS A;  1I4R A;  2XSZ D;  4IBE A;  1XLQ A;  4AQ7 A;  2DHZ A;  1YSY A;  3PHW A;  4LCB A;  1VG5 A;  2MGW A;  3UJN A;  4JXJ A;  2BQQ A;  1KJT A;  2KWC A;  1NI3 A;  1WJ6 A;  1WM3 A;  2N7E A;  4KZ0 A;  2JWZ A;  3FAH A;  1PDX A;  3W5U B;  2BWB A;  2WDT B;  1CQV A;  2BWF A;  3GPX A;  1HZ6 A;  3OIS A;  1Z5C A;  3ZW3 A;  1OAO C;  2E02 A;  2QDF A;  4XX5 A;  3I01 M;  3HHY A;  1DGB A;  2HD5 B;  4FD2 A;  2LUE A;  2JXN A;  4DR6 M;  2EJS A;  3TWL A;  1OQQ A;  2XNA C;  5J17 A;  1ATK A;  2KAJ A;  5ITU A;  2Y5B B;  2N9X A;  4HEA 1;  3S3R A;  3ZDM C;  1PYW D;  2KRU A;  4FBJ B;  2BT6 A;  3MHS D;  1GVN A;  5TR5 A;  5EXP A;  4FXC A;  2D3A A;  2O2V B;  1QOF A;  3L13 A;  2ZZP B;  2H89 B;  4QHT A;  3LB8 C;  4WJQ A;  2AX5 A;  4B7H A;  3A1Q A;  3K8Z A;  4X6H A;  2WWZ A;  1AU0 A;  3FIL A;  1M94 A;  4GUA A;  1TGZ B;  4GXB A;  3TL4 X;  3RYT A;  4WW0 A;  1SE3 A;  3DDC B;  3PPA A;  4G6Z A;  3PZ8 A;  2KTR A;  2G7Y A;  3A4R A;  3RE8 A;  2QJL A;  3PBH A;  2INP E;  3NBI A;  4BLC A;  2EKF A;  2BYE A;  1NVM A;  1V5T A;  3T38 A;  1JWB D;  2ZEQ A;  4BFR A;  3OWE B;  3GPY A;  3UIN B;  4LF4 M;  4W5W A;  2CV1 A;  4RKU F;  3IFW B;  3H7P A;  4X6J A;  3MMP A;  3LMM A;  1RU3 A;  2KFJ A;  2MLB A;  4IW0 A;  3K9O A;  2R62 A;  3V60 A;  3F75 A;  2Z8L A;  1IXS A;  4UN2 B;  4B7G A;  1IBL M;  4GHA A;  4MM3 B;  3DHG C;  4RM8 A;  3PHU A;  1E0Z A;  1UFZ A;  4F7Z A;  4L8R C;  1PIP A;  2BJW A;  2OOA A;  1SJE D;  2XK5 A;  1ME3 A;  3VFK A;  2ZAM A;  3USV A;  3DVG X;  4YWG G;  2N9E B;  1Q3B A;  2G5G X;  1UGJ A;  5LXI B;  4QOS A;  2BKR B;  4NY0 A;  2CHX A;  2FH0 A;  4CGY B;  5JI3 E;  2R4E A;  4KOD A;  5EE0 A;  2JY7 A;  2HE7 A;  2R44 A;  1YD8 U;  2OZ2 A;  3O65 A;  2P0R A;  1TTE A;  1TKG A;  4YTN B;  4JI8 M;  2JQR B;  4F8C B;  4URK A;  3L26 A;  3QJZ A;  3QQ8 B;  3AOG A;  3E56 A;  3HJ8 A;  1ET6 A;  1MG8 A;  3OVX A;  4CHK A;  3UGB B;  3MOR A;  3VFD A;  4M0W A;  5J94 A;  5LLI A;  3I4Y A;  3Q8F A;  1DO0 A;  2K39 A;  3V6E B;  1E94 E;  2WDR B;  3C9E A;  3BWK A;  1QZM A;  3WHL A;  1TLO A;  2QHO B;  2L1A A;  3DF0 A;  2LD9 A;  3FTC A;  3V76 A;  2KN4 A;  3IV2 A;  4YXD B;  3UGJ A;  3GE8 C;  4LY6 A;  4B9K A;  4OX9 M;  3OAW A;  2HHH M;  2Y5P A;  1YJ1 A;  3KDS E;  4DUZ M;  4Y28 F;  1P3Q Q;  4JI4 M;  1UGM A;  4TMA B;  1QUS A;  2YJB A;  2HTM E;  4BAX A;  1XLN A;  3VQI A;  1N60 A;  3MP2 A;  4KGT A;  2KZU A;  3AMZ A;  1L4D B;  4B0E A;  2WXM A;  2KMM A;  1DO2 A;  4GLS C;  2DBY A;  3RNA C;  2K22 A;  4ANW A;  1PUT A;  2LHG A;  4MSM B;  1VSN A;  3TEW A;  1K3X A;  1VZ6 A;  1WXM A;  1E6E B;  2JXX A;  4G0N B;  4A9A A;  3PDF A;  4P6G A;  3WXE A;  5BMH A;  3KH0 A;  1MJG M;  1TDH A;  3PHW B;  4ZRP A;  1J7K A;  4JI7 M;  3IFU A;  1JWM D;  3CTW B;  2HXZ A;  3AN1 A;  2QMT A;  1MI0 A;  4WJO A;  1Z5B A;  4AG6 A;  4KVG B;  2KW0 A;  1UBQ A;  1WRI A;  4KIK A;  4HDQ A;  3VRA B;  1NL6 A;  2L0F A;  4HJG E;  2BYF A;  2ZAN A;  1D5Z C;  1OGW A;  4HPM B;  1GOZ A;  3N3G A;  1NVI D;  2O6V D;  2X49 A;  2KJR A;  2N4F A;  4NSO B;  2N1W A;  1WXA A;  3A46 A;  2Y5C A;  3ZH9 B;  3BY4 A;  3P5U A;  3U7D A;  2K8C A;  2FAZ A;  3W5V B;  3QA8 A;  2QCZ A;  2N9L A;  2IGD A;  1XLO A;  2UWQ A;  1ZCM A;  1E8W A;  2ON8 A;  3ZLZ A;  4D81 A;  1HQR D;  2KDE B;  3BPF A;  1ZV1 A;  4G4N A;  4ARI A;  3N3K A;  1DOI A;  5LNK 1;  2Z8Y M;  2UXB M;  4P1C C;  1Q3C A;  2M0A A;  3KOZ E;  3IT6 B;  3VDP A;  3A1Q B;  1XXH B;  4R3D A;  1F52 A;  2LVP C;  3K2L A;  4A90 A;  3TQS A;  2DI0 A;  2C9C A;  2JYE A;  2KHH A;  2BF8 B;  2KO3 A;  3ZCB B;  1RFK A;  3AEB B;  3FIL B;  1N61 A;  4LNO A;  3RFW A;  3U61 B;  2EMT A;  4GGQ A;  1NHW C;  2UXD M;  1JQP A;  3DQV A;  4LK0 M;  1CTE A;  1IFY A;  1OTR B;  3ZUN A;  1VZ8 A;  4DDI D;  4DR2 M;  1KLG D;  3EC8 A;  3U8Z A;  5EXS A;  1N62 A;  3H6N A;  2KX3 A;  2DZM A;  4QAY A;  4LZJ A;  2MP2 A;  2DZJ A;  3TE6 A;  2J7O A;  1FRD A;  3IUT A;  2O5R A;  1V1P A;  2ZW0 A;  3WXG A;  3KP0 E;  5IP4 D;  2DYB A;  3R8F A;  3PNR A;  1MS6 A;  5FK9 C;  1POP A;  3K9O B;  1KRH A;  1RYJ A;  4GDL B;  1YVB A;  3AEC B;  4DV1 M;  3PVS A;  1L0X B;  2XFS A;  1HQY E;  4W9K A;  2KFK A;  5AZH A;  4LJ8 A;  4CJ6 A;  4W9J A;  4QRX A;  4D80 A;  3KP1 E;  2OUL A;  2Y21 A;  4HEO A;  2WHI A;  3VH4 B;  4QH6 A;  2LHE A;  2PJH A;  2VZK D;  2UZJ A;  1HE8 A;  2HCB A;  3PRP B;  3VDU A;  1V2Y A;  3RNF C;  2N9K A;  1UD7 A;  2IO0 B;  4JWU C;  5HG2 A;  1OJL A;  3H4J A;  2FBW B;  3BK2 A;  1EWM A;  4A5U A;  1WMH A;  1GG3 A;  1VR9 A;  1MHW A;  4YYU A;  3BYY B;  2WDV B;  3QX1 A;  1N5X A;  2JNH A;  5FPW A;  1NI2 A;  2PLP A;  4N79 A;  1WYW B;  1K51 A;  2MHJ A;  2NS5 A;  1GUA B;  1NV9 A;  1C1K A;  3L16 A;  4EUT A;  2P5T A;  1Q6K A;  2IZV B;  4M0W B;  3Q14 C;  1T3T A;  1TR8 A;  3VR9 B;  4BKS D;  2JQG R;  1N32 M;  2BTE A;  1JML A;  4XDD A;  2APL A;  4HWI B;  3D32 A;  1LGR A;  2LGI A;  3SFD B;  2MBO A;  4J3O D;  4GMQ A;  1PGY A;  3SYK A;  4BOU A;  4P16 A;  3P4R B;  5FTM A;  3NS8 A;  3C0R A;  5BO4 B;  4LGM A;  4REZ A;  3SFZ A;  4EFO A;  1G6J A;  1SGH A;  3B7Q A;  4YYS A;  5EE3 A;  2MJD A;  3U6Q A;  3AV0 A;  5C18 A;  2AWT A;  4HCP B;  2G1E A;  4BS6 A;  2AS8 A;  2XU5 A;  1ME4 A;  2JWS A;  2G4D B;  3P5W A;  4PAD A;  5AEK B;  1KFY B;  4S0R A;  1IQP A;  4NOO B;  1NPZ A;  1JCK B;  1FXA A;  1C3T A;  3HD3 A;  2F4V M;  2SAK A;  1JQJ C;  3AJI B;  1WIA A;  2NQ8 C;  1DGG A;  2ZNV B;  2JVC A;  3Q8B A;  4ARC A;  4X6I A;  4ICU A;  1WE6 A;  2QP9 X;  5C23 A;  1NB3 A;  3Q3O C;  5G5G A;  1DV0 A;  3EFU A;  2B3A A;  4WJN A;  4AG5 A;  1E7P B;  3QAQ A;  4AJW A;  3A33 B;  4L16 A;  3PO0 A;  4LTU A;  2DZK A;  3B21 A;  3M95 A;  4GEW A;  2FCQ A;  2WYQ A;  5IOI A;  4QNM A;  2AL3 A;  1IN4 A;  3BY4 B;  2IBI A;  2LJ5 A;  3EFC A;  1I4P A;  4W9E A;  1M4V A;  1GPX A;  1CUK A;  1R6B X;  1YQ3 B;  5EP4 A;  1AYW A;  4JI6 M;  5KO3 A;  3B1L X;  4JX1 C;  1QXP A;  2DAF A;  1G59 A;  2JTC A;  3U6S A;  3TJP A;  4B08 A;  4HCN B;  2NR2 A;  2L00 B;  1VDD A;  3CH2 X;  3DCG A;  3SHG B;  2N35 A;  4PP2 E;  2QBY A;  5EP2 A;  5EXX A;  1P98 A;  2PW9 A;  4IUM A;  3QHT A;  4NAW A;  4KSK C;  4XBO A;  1STE A;  1F2R I;  4IWP A;  1KFV A;  2OJW A;  1QVR A;  2DAM A;  4YT0 B;  1L0V B;  3HU3 A;  2D3C A;  1UH6 A;  2BS2 B;  2O6V B;  3IG3 A;  1V1P B;  1HR0 M;  1N78 A;  2MBH A;  2C9O A;  2WXQ A;  1N36 M;  2IPP B;  3ZC7 B;  1NJF A;  4JL9 A;  3B08 A;  1Z59 A;  4RFB A;  3A98 B;  1QOB A;  2BJV A;  4YV8 A;  2DZI A;  3MHV C;  2BS4 B;  2GMI C;  2ZW1 A;  3B9P A;  1PPN A;  4YYQ A;  3TNX A;  3W1S C;  1JR3 A;  3FUT A;  4IBI A;  4BOQ A;  2M19 A;  2DAG A;  1DF0 A;  4HKQ A;  4ZRJ A;  1QQW A;  1V6E A;  4HVB A;  3KSE A;  3GLI A;  2CHW A;  4DR7 M;  4D8I A;  3W67 A;  1NJG A;  1EF1 A;  2D3B A;  4DV5 M;  2CU3 A;  2F7D A;  2F5Q A;  1FJG M;  3P1M A;  1J5E M;  1TZ1 A;  4GC9 A;  1N75 A;  4IBF A;  2IGG A;  4AP4 C;  1EU4 A;  1SBB B;  5BR8 M;  2RD0 A;  4F1I A;  3UQB A;  1ZW7 A;  3AKZ A;  4AS1 A;  1OIZ A;  4TQ0 A;  2KAN A;  1F2C A;  2CIO A;  3BVZ A;  1XQQ A;  2XLJ A;  1D3Z A;  2L83 A;  1ZKH A;  2CFO A;  5JH3 A;  1THE A;  1SF0 A;  5EE1 A;  2RDG A;  2AEH A;  3GP7 A;  5EZS A;  3KOX E;  2LWX A;  3N1Z C;  3DA1 A;  1YQ4 B;  1YX6 B;  3RI7 C;  2F5P A;  1E8Y A;  4Q8H A;  3KW5 B;  4A8X C;  4QRV A;  2A4Z A;  2OOB B;  4B95 A;  3U5Z A;  1PM5 A;  4IG7 B;  4OZB A;  1E10 A;  1TF0 B;  3FRI A;  2PIA A;  1GL7 A;  4IBK A;  1WSP A;  4X62 M;  2MQJ A;  3FTD A;  2CB5 A;  1I4H A;  5DPW A;  4CDC B;  4ICV A;  2XH9 A;  2DHR A;  5D3I B;  3NVW A;  3RNC C;  2QSD A;  4LRS A;  4DHJ B;  4L6V 6;  1BQI A;  1YNT E;  3V62 A;  3M7G A;  2JYT A;  2M17 A;  2YJC A;  1JR3 E;  1OEY J;  3MTN B;  4M8M A;  3T3O A;  3LYY A;  1NY5 A;  1TH4 A;  4WQO B;  1G8P A;  3TEZ A;  2N7D A;  3B7N A;  3GLI E;  2MW5 A;  2IND C;  1R7R A;  4I6L B;  1L0Y B;  3JVZ X;  3ZNH B;  2HD5 A;  5L8R F;  2BYT A;  1B1Z A;  3RVX A;  3O13 A;  4MAC A;  2OO9 A;  3UQA A;  1TKY A;  3J81 S;  3KXE C;  1AYF A;  2IBI B;  2HJ8 A;  5ITX A;  2K8B A;  1KOT A;  3PLU A;  3ZJV A;  2Y5B A;  2YEP B;  2WXL A;  3PVL A;  1F4I A;  1QOL A;  4PP1 A;  2EEL A;  2JRH A;  3LW5 F;  1WI0 A;  2K5P A;  1CV8 A;  4IOI E;  4DMX A;  5IO9 A;  2L7R A;  2FNJ B;  2O2V A;  1A5T A;  4L1B A;  3U2S C;  3F5V A;  3T6P A;  1QT9 A;  1J0G A;  1BGO A;  1V80 A;  2MWS B;  4OZC A;  2ZTD A;  5EP3 A;  4BBN C;  4GDK A;  4GIV A;  4DWF A;  2G9H D;  3B0A A;  1F2B A;  2D11 A;  2JX5 A;  1QDQ A;  5JI2 E;  1Y8R C;  3A9K B;  4PT5 A;  4HWY A;  1FMA D;  4NJ6 A;  4NAW B;  3AL0 C;  2CKH B;  2OPF A;  1JRU A;  2P7U A;  1MDW A;  3SAU A;  1VZ7 A;  3R66 C;  1LO5 D;  1FH0 A;  5KPT A;  3SD5 A;  4IBG A;  1YN5 A;  1UZX B;  2BVC A;  1Y08 A;  1TL9 A;  9PAP A;  3DVN U;  3TPZ A;  3QC8 B;  2N1V A;  3J9C A;  4NXN M;  3HU1 A;  5E26 A;  2JSV X;  2B1M A;  1MVK A;  2CJO A;  4MSQ B;  4MM3 A;  2JF5 A;  1F9J A;  3H8C A;  3RZF A;  1Q1O A;  4IJF A;  2L8J A;  1IN7 A;  2V9H A;  2FUH B;  2ZNV C;  2X38 A;  3KX1 A;  3FUV A;  4XDC A;  2UU9 M;  5EE9 A;  2WSF F;  1V92 A;  2EKI A;  3GRR A;  3R2I A;  3H7S A;  2WXI A;  3DOW A;  4ZHP A;  3H89 A;  5ITX E;  1R4G A;  4BKG A;  3R3M A;  4JI1 M;  3CWI A;  3AEG B;  1BML C;  1WXV A;  2DWM A;  1DYQ A;  2I38 A;  1U9Q X;  5A2Q S;  1JWS D;  3OJ4 B;  3FYD A;  4NQK E;  1LFD A;  2LHC A;  2W3S A;  1PAD A;  5JZE B;  3P2B A;  4GU2 A;  2MBE A;  1E90 A;  2AYO A;  1XLP A;  3K8U A;  3IVF A;  2EO2 A;  4KZC A;  4WAA A;  1GJZ A;  4IP3 A;  2C5R A;  4N58 A;  2ZCB A;  3X23 A;  3SHF A;  3B79 A;  3E1Z B;  1F2R C;  3H7D A;  1Z5S B;  3HGI A;  2Z4R A;  1FNN A;  4G4O A;  2O25 A;  2E01 A;  2GNO A;  3GO8 A;  2K3U A;  2O01 F;  3R8B A;  2QHO A;  1XD3 B;  2QNJ A;  3AB5 A;  3BBZ A;  4Z6Y A;  1V5O A;  3APC A;  3UI3 A;  1VJV A;  5DNY A;  4E3C A;  2DZL A;  3KYD D;  2J52 A;  4EKU A;  3IT4 B;  1I4G A;  1I4Q A;  4EZL A;  3BZD B;  1XCQ L;  4DXA B;  3LVW A;  4L4U A;  1P1A A;  3N32 A;  4IM2 A;  1HUC B;  2PRE A;  1SP4 B;  4YTP B;  3TMP A;  2DAK A;  3U5Z B;  4K1R B;  1YMH E;  1TY2 A;  3Q3M C;  3SAV A;  3SYL A;  1YN4 A;  4P1B C;  7PCK A;  2KKC A;  3SHQ A;  4DR1 M;  1C9F A;  4OVU A;  5H92 C;  2IO1 B;  2K47 A;  1R4M I;  3AE1 B;  4X65 M;  4BOP A;  3L25 A;  2J7Q B;  2NTT A;  2R46 A;  2KJH B;  4UDU C;  1D6E C;  2CHQ A;  1SIJ A;  4EOY A;  4RF0 A;  3WA0 A;  2KZS A;  2QZ4 A;  1ZUD 2;  2AUX A;  2DNF A;  3I57 A;  3AOE C;  3AV8 A;  1HQC A;  2W55 A;  3D8B A;  2PVO D;  3BBA A;  2INC C;  4R7G A;  1L6V A;  3H1U A;  3NVV A;  3A9J A;  4LZZ A;  2XF3 A;  4MZO A;  3N30 A;  1KXR A;  4US8 A;  2GFO A;  4BKT A;  5CVO B;  3TBL D;  1SJH D;  2DZZ A;  2L2D A;  4HLQ A;  2MRP A;  1HT2 E;  3QWZ B;  2M56 B;  4D82 A;  5E6J A;  1WE7 A;  2Z59 B;  2H88 B;  1TY0 A;  2BPS A;  4LDT D;  1XWI A;  2R18 A;  2GBJ A;  2TSS A;  5G5H A;  4IC7 B;  4PYU A;  5EQT A;  3PHX B;  1RFA A;  1ZDV A;  2ICI A;  1XXH A;  3GS2 A;  3Q3N C;  4GDK B;  3VUW A;  2XSZ A;  1SE2 A;  3ONS A;  4JN6 A;  4OEL A;  2LBC A;  1EUV B;  4DV3 M;  2DEN B;  3U61 A;  1XNQ M;  2M60 A;  1I35 A;  1OTR A;  3PNV A;  4QHS A;  2FCM A;  1NY6 A;  2YNM D;  5C1B A;  3ENE A;  2FQ9 A;  3ZNZ B;  3AE9 B;  3QYB A;  2FYE A;  1YX5 B;  4JI3 M;  2AL6 A;  2KN5 A;  2RGF A;  3DBL I;  4D8E A;  1NEN B;  2IO3 B;  2KK8 A;  4B3S M;  1PJQ A;  2E03 A;  3HVD A;  3U30 A;  1BP4 A;  2GBR A;  3DBR I;  4AXL A;  1PJJ A;  1GKI A;  4KV2 A;  1SEB D;  1WRD B;  1PCI A;  1J19 A;  3L29 A;  2CHG A;  1WWT A;  4JV5 M;  3ZVV A;  5KHQ A;  3CF6 E;  3ZYY X;  2KYW A;  3MHH A;  1Q10 A;  4S17 A;  4GDL A;  1EFU B;  2B3T A;  3MHS A;  2WBF X;  1OEY A;  1WFY A;  2NVU I;  3MC8 A;  1BT0 A;  1GAB A;  4L78 A;  4RMA A;  2E00 A;  4FW9 A;  5KPZ A;  1ROE A;  4XGA B;  2JZ3 B;  1SXJ D;  5HFY A;  3IMA A;  2WXG A;  3SDL C;  2DCD A;  3EA6 A;  3PRP A;  1KM7 A;  3L10 B;  4PI3 A;  4GIP A;  1KYI A;  4FN2 A;  4M02 A;  2IJ0 A;  1LV7 A;  3ERV A;  4CZW A;  1JAL A;  2PPH A;  4HK2 A;  4PYZ A;  1CS8 A;  4N4Z A;  4YHH M;  4NQL B;  3TEY A;  3PRM A;  3N1X C;  1YZB A;  4M01 A;  3VK8 A;  3J7B A;  2AU1 A;  4ZOH C;  4B7F A;  2AYO B;  3Q8X A;  5FTK A;  1SIF A;  3BC3 A;  1M6D A;  4OW0 A;  3DBH B;  4W5C A;  2IY1 B;  4MGY E;  1XXH E;  2X8A A;  3IEJ A;  3AED B;  2L32 A;  5BPV A;  2K6Q A;  3PSE B;  3RGP A;  3J2P B;  3WAN A;  1CSB B;  1QOG A;  4WWM A;  1TU6 A;  4RKX A;  2QSF X;  2UXC M;  5D94 A;  3BXW A;  1ACC A;  4JWS C;  3RNB C;  2XGN A;  1C77 A;  4P17 A;  3W2D A;  1QLB B;  2PAD A;  3M0E A;  3M6A A;  3AE4 B;  4ZYS A;  4RGO S;  2PE9 A;  3H9D A;  2R9M A;  1NYQ A;  5BYQ A;  3AEF B;  2WU5 B;  3EGR A;  4DV2 M;  1LM8 B;  2J42 A;  3IBE A;  3TMP B;  3RNV A;  3I51 A;  2JZ0 A;  1ZGU B;  3PRE A;  3DBH I;  3E4R A;  3SFE B;  1K82 A;  1HT1 E;  4C4V A;  2VHS A;  3OLM D;  1PE6 A;  3PLV A;  1NHG C;  2JY6 B;  4HRS A;  2DXI A;  1K50 A;  3NWL A;  4FWG A;  2BNK A;  2EUC A;  2L4E A;  2LUM A;  5K16 A;  4CDE B;  4J6I A;  2V3N A;  2YEP F;  2N7J A;  2JXT A;  2WQY B;  3HRD D;  1TGU A;  5IZ7 D;  1TH3 A;  3C3E A;  2K0P A;  3JR5 A;  2FIF A;  1AU4 A;  2LRU A;  3NZU A;  3WIM A;  1S4V A;  2JQF R;  3RFZ B;  1B9R A;  3WAO A;  1AYV A;  3A9J B;  3S2A A;  1BY8 A;  3KWZ A;  4GKJ M;  1WR6 E;  3LXS A;  3ECI A;  3BWU D;  5JHB A;  3RD2 A;  1S3S G;  1YAL A;  4D8B A;  1N33 M;  1RLF A;  1ZAE A;  4IIW A;  2DKL A;  2KC2 A;  4K0K M;  2AQ3 B;  2R9N A;  3MHZ A;  4LF6 M;  1ZXI A;  2BWE A;  5CHV C;  2RMM A;  3HX3 A;  2Z3X A;  4WIP A;  1Q5W B;  3H8B A;  3PW3 A;  4P7I A;  3VLF B;  6PAD A;  1FIQ A;  5E6P A;  2YJ2 A;  1D5X C;  3NZ3 A;  1QAQ A;  1YIW A;  2DLB A;  1FNW A;  2KDM A;  4KDI C;  4A20 A;  1XNR M;  3DBS A;  4W9I A;  4I04 A;  3ZTD A;  1BXT A;  3CGW A;  3FKE A;  5ITQ A;  2J4X A;  3GRV A;  4KKJ A;  3AU5 A;  1G3I A;  4MH8 A;  2O6X A;  4EZK A;  4ZDV A;  2KWD A;  4M9Z A;  1CB5 A;  5KPR A;  2O6V A;  1D4B A;  2JT4 B;  4YL8 A;  1GC6 A;  3JW0 X;  5AUI A;  1N34 M;  3FD9 A;  2DCA A;  1C1Y B;  3AOE A;  4DQO C;  4F1S A;  4XWW A;  3NZS A;  3Q8A A;  3L2A A;  2E6X A;  3IHP C;  4IJE A;  2BKF A;  5JH5 C;  2FID A;  3ZKJ C;  1TS5 A;  1UBI A;  3NOB A;  4LDT B;  2KLC A;  4FK5 A;  3GRY A;  3ABV B;  4W9G A;  3QT4 A;  1JRP A;  3ZNI D;  1YN3 A;  1Q39 A;  2Z0E B;  3I63 C;  1C76 A;  2DX5 B;  3ZUA A;  2KVR A;  1YOV B;  2J7Q C;  2N0S B;  2IO2 B;  3BVM A;  1UWX A;  3VXW A;  5KQD A;  2QIE B;  2WGS A;  2Y3A A;  4GKK M;  1ISN A;  3PT2 B;  3HHA A;  3UIP B;  2N9P C;  2M0X A;  2CWB A;  3PRM B;  4OVZ B;  4GHL A;  2XZU A;  3U6C A;  1ZP0 B;  2LAS A;  2WLB A;  3FKY A;  1U5I A;  1DOY A;  3ZRF A;  2K9X A;  4CQN A;  3Q8G A;  3QYE A;  3UK6 A;  3U52 E;  1KSF X;  4FA6 A;  1DGF A;  2OJR A;  2BYV E;  3HHW A;  4LNI A;  2KNA A;  2RRU A;  1YJJ A;  1T0Q C;  1QMY A;  2F5N A;  2IY0 B;  4ZUX U;  2ZPY A;  2PKO A;  2DCC A;  1HJP A;  4WWN A;  5GXG B;  3VKG A;  1E9R A;  3M63 B;  5JXV A;  5CX3 A;  2AYN A;  4C7Y A;  1GJS A;  2Y0T A;  1IBM M;  3AXC A;  2CP8 A;  1SXJ B;  1KTK A;  1EWY C;  2DOS A;  1N6Z A;  3HWS A;  2OOB A;  1MPE A;  1WX9 A;  2SEB D;  3L54 A;  1W5S A;  3I4V A;  4I8O A;  2YR0 A;  1GAQ B;  1XXG A;  1HEZ E;  4CHT B;  1TIF A;  1NQC A;  1TH2 A;  4C4V B;  5F02 A;  4OVV A;  3F92 A;  3Q69 A;  3QIJ A;  2EKE C;  3ZXV A;  2BB6 A;  1MHX A;  3VHT C;  2WNM A;  3GZN B;  4HXD B;  2PTL A;  3ML9 A;  1K3W A;  1R2Y A;  4IBD A;  5G55 A;  4LF5 M;  4NNJ B;  2XU1 A;  2FNA A;  2KTF A;  1CQD A;  5C1Z A;  2X4A A;  4TKN A;  3ZQ4 A;  3KLS X;  2Z4S A;  3MTN A;  1FNU A;  3E21 A;  4BKS A;  3ZNH A;  3FYC A;  2BS3 B;  3AFH A;  1NEK B;  5D7G A;  1PBH A;  3H4M A;  3PZD A;  3ZGZ A;  2KDF B;  4DK5 A;  3RNE C;  2VHF A;  4FVM A;  3DFZ A;  5ITR A;  3GZN I;  1T43 A;  1RWS A;  3P63 A;  4AW4 A;  3JSV A;  1IBX A;  2ARY A;  3U60 A;  2LGY A;  1T6B X;  2Q2E B;  2WXO A;  4KLN A;  5EJC A;  5DPR A;  3I5J C;  2R4J A;  3AEA B;  1SG9 A;  4W9D A;  1GC7 A;  3B2F A;  1G71 A;  2JP7 A;  3T8M A;  2BTW B;  1YE9 A;  2DWL A;  2XN9 C;  2FT2 A;  3P42 A;  3RGS A;  4JI0 M;  1F77 A;  3A9K A;  2JZP A;  2I7P A;  2C96 A;  2B1N A;  3WAL A;  2G8E A;  4ITK A;  4FHJ A;  4BOZ B;  1CZP A;  1J7C A;  3NHE B;  4LF9 M;  1I7H A;  1WGD A;  1SXT A;  1SNK A;  3R7R A;  4N8W A;  2ZTC A;  1GNU A;  4XUI A;  2JRI B;  2BB5 A;  2NBU A;  1R2Z A;  4I5S A;  2LI5 A;  3NVZ A;  4BQV A;  2D7E A;  3DWM A;  2YFQ A;  3W68 A;  4LNF A;  3ZO5 B;  2RGO A;  3NJT A;  1AIP C;  2DWN A;  1N77 A;  4FAD A;  4WH4 A;  2KWU B;  3B89 A;  3KW6 A;  3IAS 1;  4MGH A;  3BVG A;  2L52 A;  2ASQ A;  3P5V A;  2LHD A;  4JE3 B;  2MA9 B;  3LQR A;  4MSX A;  1R4N I;  3AI8 A;  4DBG B;  3VRB B;  3MTV A;  1ZOY B;  4I6N B;  3NUH B;  4JIO U;  2Z0D B;  2J7N A;  4II7 A;  4WP2 A;  3KW9 A;  2JUJ A;  4BOS C;  4B6W A;  4CDF B;  1DEU A;  1ZDX A;  1CJL A;  3ZQJ A;  4KKI A;  1LTM A;  2EKK A;  2EMS A;  3U6M A;  2LGD A;  2XEW A;  2CR5 A;  3KOW E;  1ZMU A;  4ZRI A;  5LXH A;  2KWV B;  4YVA A;  1XCT L;  1FM0 D;  3J80 S;  2FOI C;  3A42 A;  4N59 A;  1XMO M;  3VK7 A;  4DXG A;  2R9F A;  2D2Q A;  5JZE A;  2LVP A;  3AE7 B;  3THG A;  2NQD B;  4I05 A;  5FKA C;  3WAM A;  8CAT A;  1QAM A;  3BPM A;  3CSF A;  3T9L A;  1GLO A;  2P86 A;  3MK6 A;  3OVZ A;  4FLH A;  1U4A A;  2JA2 A;  2L7I A;  3E9S A;  1TTN A;  2DCB A;  2BGF A;  5T8I A;  3BOW A;  1AU3 A;  3FTE A;  2A5U A;  4L2Y A;  4MGK E;  5EDS A;  1PQS A;  2WX1 A;  2CU1 A;  2DZN B;  1KHP A;  3Q3F A;  4LF8 M;  2K25 A;  2NTS A;  2LGX A;  3C3D A;  5EGW A;  1OIP A;  3DHH C;  2VZK B;  3QAU A;  1WX8 A;  3URY A;  3IHP A;  5FR3 A;  3Q6B A;  2KD0 A;  5A24 A;  3PTF C;  4NRW A;  4N9F 4;  4C56 C;  2HWJ A;  4MT5 A;  2WS3 B;  4D2K A;  4LG2 A;  3NRZ A;  2J7Q A;  2JY8 A;  3GLF B;  2L0T A;  5CVM A;  4HLE A;  4Q8G A;  3P4P B;  3HU2 A;  1AUA A;  3KUC B;  4XYC A;  3GP1 A;  3KUZ A;  3GLG B;  3KFU G;  4RM9 A;  4OHJ A;  3OF8 A;  1W5T A;  4YTM B;  2CV2 A;  5HI1 A;  2BWE S;  4ANV A;  4AOF A;  4B3M M;  3AE3 B;  3DVG Y;  4RY2 A;  2ZVN A;  5BMI A;  4BBA A;  1L2C A;  5IN7 A;  2MEK A;  2MH7 A;  1VDL A;  1YT7 A;  4FWH A;  2G8L A;  3Q8E A;  1PPP A;  4IBB A;  1P0R A;  2C7N B;  1L8Q A;  1HNZ M;  1JWU D;  1T3Q A;  2FUD A;  1E7V A;  1IBX B;  3JSV B;  2QEJ C;  2KNB A;  3U60 B;  3FTF A;  2DYO A;  4FJZ A;  4GSW A;  4CDD B;  3SMS A;  1WGK A;  2WSC F;  4US9 A;  4I07 A;  3T1Y M;  1OKS A;  1C78 A;  4K3B A;  4XK8 F;  3DWG C;  3VUX A;  4K7S A;  2LNH C;  4AI6 A;  4GMV A;  4LJO B;  4AJY B;  1C7Y A;  1MIR A;  3PHX A;  4GOC A;  1D2N A;  1WIV A;  3PXG A;  3L17 A;  4DV6 M;  3Q8C A;  1D0L A;  2DWZ B;  3RCZ A;  3MC9 A;  3PNY A;  3I3T B;  4KHP M;  2ZBK B;  2DEN A;  1I4X A;  2H7J A;  1TDZ A;  2LMC A;  2CHV A;  2L3Z A;  1STF E;  3JYU A;  2DYM A;  2D5G A;  3T15 A;  2XU4 A;  5IRE B;  1TS4 A;  4DMY A;  1WX7 A;  2C98 A;  2CS4 A;  2Z84 A;  4G3O A;  1D0K A;  2ATO A;  2G8J A;  4RGT A;  4OU7 A;  3VTU A;  3P5X A;  4WJP A;  2L7H A;  4WWO A;  1WHC A;  3CH3 X;  3ML8 A;  1SXJ C;  1F0Z A;  4MDK E;  2IYD B;  1ITO A;  3U4E G;  1ORY B;  1V1O A;  2V1U A;  1GL6 A;  4FHK A;  3U6O A;  2ZVO A;  3RVV A;  4MH0 E;  2DAI A;  4IWQ A;  1WGH A;  1WF9 A;  2PMV A;  3RT3 B;  3FC4 A;  2G45 B;  3AM9 A;  4BBN F;  2NQA A;  2XFT A;  1EIJ A;  4B3T M;  4ZYN A;  3HY5 A;  5AZG A;  3ILK A;  1MHH E;  2W9N A;  4I81 A;  1HTO A;  1IY2 A;  2FRA A;  8PCH A;  2J5Y A;  2JZ1 A;  1K53 A;  3HZJ A;  3SMP A;  1FFU A;  2V4L A;  5DYI A;  4LFA M;  4PD2 A;  2V1C A;  1QAN A;  4XR7 A;  1V9J A;  1EWC A;  2LZ6 A;  2PVG C;  3GQ5 A;  4LJ7 A;  2V3S A;  1PJT A;  4G54 A;  3A45 A;  1X1M A;  4AWJ A;  1U9X A;  5FTN A;  4OEM A;  5KQ8 A;  5FLX S;  2V4I B;  2KXJ A;  5CHF A;  5D6J B;  4NC6 A;  1RM6 C;  3CIR B;  3WAP A;  2R6N A;  3Q2A C;  3RUI B;  4TQ1 A;  4MJS B;  1NNJ A;  4CIS A;  2RPQ A;  3ZDT A;  3X0W A;  3M3J A;  1R4M B;  1ZQ9 A;  3UIO B;  3PSE A;  1HA5 A;  3QK0 A;  2NQG A;  2KT7 A;  1PRB A;  2E3T A;  3HUI A;  3P4Q B;  1EU3 A;  3B2G A;  3NVY A;  4OZA A;  3KS4 A;  1J7B A;  3UMM A;  4FJV B;  1ET9 A;  2ZCC A;  1FCL A;  1JRO A;  4W4U A;  4PCZ A;  4B3R M;  1UNS A;  1HTQ A;  3WXF A;  3D8L A;  3HJS A;  2Q5W D;  3A4S C;  4ASW C;  3QSD A;  1IP9 A;  4JI5 M;  2ACT A;  2L09 A;  2GBN A;  2LXC A;  1FXI A;  4W9C A;  1L2D A;  3GPP A;  2KC1 A;  1V81 A;  2JY6 A;  3V3X A;  2D07 B;  3W1S A;  3C8Y A;  3EEC A;  1ESF A;  2R2O A;  4NZL B;  2Y6E A;  2C99 A;  3VH3 B;  4LJ6 A;  1C4P A;  1RAX A;  2KQ7 A;  3GB1 A;  3U6L A;  3N1Y C;  2YJ9 A;  2AIM A;  5IAA C;  3L27 A;  1PGX A;  2BW2 A;  4HRO A;  1VEK A;  2QQ8 A;  4USA A;  3TIX A;  4WA6 A;  4K3C A;  4HDO A;  3NG0 A;  3B9J A;  1WGY A;  4LJP B;  1ENF A;  1P7E A;  2WSE F;  3U8E A;  4XGI A;  1P9D U;  1PGA A;  4ZRQ A;  3M62 B;  4TSS A;  2C5L C;  1KF6 B;  3O0U A;  1TS3 A;  1T6O A;  1FXT B;  2HKJ A;  4O1N A;  3KWL A;  3FE3 A;  1TKE A;  1CVZ A;  3DBL B;  2L05 A;  2CUZ A;  4TUU A;  5AUK A;  2KLG A;  1DOX A;  4M00 A;  2M1M A;  4G4Q A;  1GO5 A;  3DBR B;  1ZIV A;  4AKG A;  2LH0 A;  3MJ5 A;  5CTR C;  1J09 A;  1CPJ A;  2UUB M;  2KMC A;  4M8N A;  2I1K A;  2BDZ A;  2F1G A;  2AQ1 B;  3VR8 B;  2VF8 A;  4LGY A;  3IEC A;  1WJN A;  2WX0 A;  4IKG A;  3TEX A;  2FO5 A;  2LJI A;  2GOW A;  2KZR A;  2R9O A;  4MEM A;  2PE6 B;  2QEN A;  1WGN A;  1NBF C;  3L4P A;  2DC8 A;  4W5B A;  3H6S A;  3TCA A;  2DC9 A;  3QJ3 A;  1WXQ A;  2GI9 A;  2MR9 A;  4YSY B;  2R2Q A;  2HWK A;  3NS1 A;  5J2R A;  2V6Z M;  3SAW A;  3HHX A;  1WH3 A;  5BYS A;  4L15 A;  1SSN A;  3BYT B;  4MI7 A;  1AEC A;  2KJ6 A;  3K9P B;  2CE7 A;  2M5Z A;  1GCB A;  4X57 B;  4W9L A;  1YK7 A;  2DZO B;  3R2T A;  1KLV A;  2HAK A;  3UZU A;  3P4S B;  1KH0 A;  4DV0 M;  2LVO C;  2Y20 A;  2GLS A;  2CHZ A;  4G4R A;  2WZJ A;  5C3J B;  4XZX A;  4EIW A;  1IM2 A;  4IM3 A;  2LEK A;  2QC8 A;  4II3 B;  1C4A A;  2DNA A;  4DHZ E;  2HL7 A;  3BB7 A;  4RCO A;  3HM3 A;  4DR4 M;  1V34 A;  1YUB A;  2DZY A;  1PVJ A;  3W9C B;  2FCN A;  3DOA A;  1VD2 A;  2R6F A;  2VRR B;  4EE2 A;  2C0Y A;  2JZZ A;  1MEM A;  3RPF C;  4PDI A;  3IG5 A;  1Z2M A;  1IYF A;  3APD A;  2YJ8 A;  3K9M A;  3PT2 A;  1L2B A;  4WAF A;  2WXN A;  4OVZ A;  4P6V F;  2FS1 A;  4WUR A;  1T5X D;  2LWP A;  1K52 A;  4AXM A;  1IGC A;  3CF2 A;  2VH2 A;  3SAS A;  1V49 A;  1J8C A;  2AVW A;  1UEL A;  3C19 A;  5FR6 A;  1TJE A;  2YLM A;  2R9C A;  4R71 A;  2ACZ B;  2K0B X;  1IGD A;  5GKN A;  4A55 A;  3N4C A;  3BK1 A;  4PS3 A;  5BMG A;  1IPG A;  4AZF A;  1Y56 A;  4ITQ A;  4HKZ E;  4NAM A;  2OHF A;  1SXJ A;  3AE8 B;  1FPY A;  4IM0 A;  4RF1 A;  4G50 A;  3BIN A;  3PS6 A;  4CO7 A;  1FEH A;  1XO3 A;  2R0I A;  1SE9 A;  2KX0 A;  1GB4 A;  1D0M A;  1QAO A;  1T0R C;  4Q2J A;  2PBH A;  3TRK A;  1JW9 D;  2G4S A;  3RNG C;  1XEE A;  1MN3 A;  7CAT A;  2D10 A;  5CVN B;  3LJ3 A;  5CHT A;  4HXD A;  2ZM6 M;  2VDB B;  2NPT A;  2KMA A;  1EWO A;  3SAT A;  2ZAO A;  5FTL A;  3K24 A;  1F29 A;  4FJC A;  2NBV B;  1P3Q U;  2KRK A;  4PS7 A;  2CV0 A;  2DWQ A;  2G3Q B;  3GRU A;  4NSR A;  4QNR A;  2HHN A;  1WR1 A;  2MH8 A;  4GRI A;  3W1Y A;  4FCW A;  4DHZ B;  3T3N A;  4QBB A;  1ZE3 D;  1OFI A;  5LMN M;  3AE6 B;  3L28 A;  4KSL C;  5TSS A;  3KQ4 A;  5E6O A;  2HH5 A;  1K3B B;  2KDI A;  1D5M C;  4W9H A;  3OQC A;  4LLG M;  2V3P A;  1UM8 A;  2W54 A;  4GN1 A;  4FWD A;  4GIT A;  2JU6 X;  1FFV A;  3PFI A;  2MX2 A;  4NRV A;  1YQB A;  2LGS A;  2NCN A;  5LMU M;  1NYR A;  5IKC M;  3QWL A;  3W0F A;  2K6B A;  3MC0 B;  2BTW A;  1N5W A;  1EWL A;  4G3X B;  2WP9 B;  2DAJ A;  1UKF A;  4AKH A;  5EF4 A;  4ZTB A;  3ALB A;  3SR6 A;  1U9W A;  4K7U A;  2WXP A;  4YYR A;  3OF9 A;  1KLU D;  4BOZ A;  2ERC A;  2QPA A;  1SXJ E;  1ICF A;  2NBW B;  1L6U A;  4LFC M;  3TWK A;  3I04 M;  5ITY A;  3NHE A;  3O1G A;  4JYA M;  2LVN C;  4KO8 A;  1IY0 A;  2JRI A;  4RNA A;  5CHW A;  1IWD A;  3RN9 C;  3ZIM A;  1TBE A;  2L4F A;  4WWP A;  1NO1 A;  4A3O A;  1T0S C;  2PEA A;  1SB3 C;  4KLB A;  2VF7 A;  3TUO A;  1AU2 A;  3H8H A;  1S3S A;  2KTR B;  1TZO A;  2AGA A;  3LCV B;  4DBG A;  2IPK D;  4CYE A;  2GB1 A;  1AW7 A;  4FJY A;  2RGH A;  1FRR A;  1R7S A;  2UYZ B;  1HNX M;  2WXJ A;  3PGE A;  2R61 A;  5IT9 S;  4GB9 A;  1TYG B;  1PJS A;  1I94 M;  3KYC D;  3JAM S;  3H7P B;  5L83 A;  1PJI A;  3C58 A;  3EUB 2;  1WZ3 A;  1MFW A;  1XMQ M;  2BDL A;  3Q3J A;  1IXS B;  1NDD A;  3IXS A;  2RKO A;  1FCC C;  1ZPS A;  1ZMW A;  3KSJ A;  4ANU A;  4GC5 A;  4W9F A;  2CRU A;  3HWN A;  1F2A A;  1A6R A;  1FNV A;  4HL4 A;  2K9D A;  2VII A;  1V8C A;  4C00 A;  1FD6 A;  2XEP A;  3FUU A;  2XK5 B;  3KVW A;  2VQE M;  4K7C A;  2NMQ A;  1K8R B;  3VTW A;  4LF7 M;  1OFF A;  1GEC E;  4JPS A;  3AEE B;  1E5W A;  1Q0W B;  4NJC A;  2K6D B;  4LJ9 A;  3GOE A;  5DPS A;  3O65 B;  2WXK A;  4N6E B;  3LQQ A;  1VEJ A;  3FUW A;  3ZRC A;  2OQ4 A;  1QOA A;  2KNV A;  1MX0 A;  4DHJ D;  3EIE A;  4M9S A;  1L7Y A;  1QUT A;  1PGB A;  5FSW A;  1A5R A;  2MBQ A;  3V6C A;  2LVO A;  2KNZ A;  3LVV A;  1XF5 L;  4B0M A;  1XHB A;  1Z6T A;  3HHM A;  1ZXH A;  5C2T B;  2OP3 A;  3BII D;  3MFG A;  1IXR C;  2VQF M;  1V86 A;  2C60 A;  1P7F A;  3VTV A;  1E9S A;  3SAR A;  3KOY E;  1NLJ A;  2NPT B;  3GLF A;  2HTH A;  1YK8 A;  5PAD A;  4ACF A;  4BZA A;  4PDG A;  3GLG A;  3DVN V;  3ZJU A;  4LJ5 A;  2DC6 A;  2D7H A;  1Y8G A;  4JGH B;  3VAW A;  4QRG A;  4C7Z A;  3MJW A;  1WR1 B;  1L1T A;  2JUO A;  2KAC A;  4IBJ A;  4A3P A;  4PK1 A;  3BCN A;  2L76 A;  4EEW A;  1BVS A;  5E6N A;  1WJ4 A;  4FCV A;  3DZD A;  3CBJ A;  1NB5 A;  1NV8 A;  2MRO B;  1HNW M;  3BOS A;  2V1Y A;  2K1F A;  2IDY A;  1KFU L;  2LVQ D;  4ZPX A;  3LCU A;  3VKH A;  3AU4 A;  1L4Z B;  5HKH A;  3DHI C;  2HJ1 A;  1HXY D;  2DJG B;  4KIK B;  4HPL B;  2W82 A;  4MZS A;  4GH9 A;  1PPO A;  1WGG A;  1X37 A;  4DV7 M;  1QDT A;  3L08 A;  2L6O A;  3RZW C;  4YSX B;  3W30 A;  5HHD G;  1VRA B;  3SEB A;  2MJE A;  5DYG A;  1DGH A;  3I3T A;  2WU2 B;  4K81 A;  1A70 A;  2KHW B;  4WQM A;  1R4N B;  2G6D A;  2ZJD A;  4G11 A;  3I9V 1;  1GB1 A;  2J0K A;  3HVZ A;  1PXV A;  3QAR A;  1VDV A;  2DJF B;  3M99 A;  2CEA A;  3MP9 A;  1L1Z A;  3N3K B;  5I4D A;  1CK1 A;  1EF7 A;  3D6S A;  2HDE A;  2DVW B;  1JR3 D;  2E5L M;  3L0W B;  3IOQ A;  2GBK A;  2AQ2 B;  2C7M B;  3VDZ A;  1G41 A;  1QIL A;  4ZHO A;  4L23 A;  2LFI A;  3GLF E;  3DPD A;  2LVQ A;  1G4A E;  1MU5 A;  3EIH A;  4LNK A;  3R7Q A;  3GLG E;  3NY5 A;  5FTJ A;  1AN8 A;  3N20 C;  2KDB A;  4IDI A;  1OAI A;  1QDR A;  3GLH A;  4AQY M;  3TSS A;  1PFD A;  1L2N A;  2I2Y A;  5F3W A;  4XC2 A;  1DKI A;  4I4L A;  2MP2 B;  2FCS A;  3KFQ A;  4DXF A;  1QQR A;  1WGL A;  2FFJ A;  2M8S A;  4DDG D;  3KKU A;  1MJD A;  3WHK A;  4DR3 M;  5CHV A;  3B7Z A;  2D3G A;  3I06 A;  1VJK A;  3HM6 X;  1LQB A;  1T0Y A;  2H5X A;  4AKI A;  4H2A A;  4BSQ A;  1WZ0 A;  1GMY A;  4Z8X A;  1V97 A;  4XWT A;  2UU7 A;  1J7A A;  5G2N A;  1MEG A;  2MBB B;  3KVF B;  3E46 A;  2OED A;  1I4W A;  3CBK A;  3KUD B;  1OQY A;  4A3V B;  2KFK B;  4E71 A;  1EWP A;  4BPV A;  3CST A;  1TT5 B;  5IWA M;  4EZJ A;  4HPP A;  1IN8 A;  4MJS A;  5H37 D;  1IXZ A;  2ONQ A;  4BS5 A;  5L95 C;  1IUE A;  2REX A;  4IBC A;  4LJ4 A;  3NBX X;  3J7A S;  1WMH B;  4C80 A;  3AH7 A;  2DC7 A;  1E8X A;  4LRT A;  1QF6 A;  3AE5 B;  1VQ1 A;  3APF A;  2IGH A;  3UF8 A;  3N9Y C; 
#chains in the Genus database with same CATH homology
 3HJQ A;  2BU3 A;  4KX6 B;  2GRI A;  3PZ7 A;  5EZQ A;  5D3D A;  4RGN A;  3U7Z A;  3TWM A;  4NXM M;  2EA0 A;  1IN6 A;  3KS8 A;  3ZJT A;  4S12 A;  5BYR A;  1CJE A;  1HZ5 A;  3V05 A;  5EP1 A;  4XE0 A;  1IY1 A;  2A5Y B;  1QYR A;  2JWU A;  3K1J A;  4YY3 M;  2J53 A;  2CJN A;  3J27 B;  2W3R A;  1L5P A;  2MJ3 A;  2INN E;  4KGS A;  2F5O A;  2QCU A;  4X64 M;  3LXF A;  3U6D A;  4BB9 A;  3GQ3 A;  4M0D A;  5MPO A;  2RPV A;  4MB7 A;  1IBK M;  3JR4 A;  5EXT A;  1DGH B;  3U6P A;  3IG8 A;  4DV4 M;  3U6E A;  1OQR A;  3WCQ A;  2R45 A;  5H8Y E;  3HKP A;  3KSX A;  1AWD A;  1JQ4 A;  4KGR A;  2YQZ A;  2KEB A;  2V0G A;  3K92 A;  1N63 A;  3IAM 1;  2BBC A;  3FUX A;  1NSF A;  1E32 A;  1EM7 A;  4LFB M;  3T1H M;  2QBY B;  1E9M A;  1JWA D;  3OTO M;  2R65 A;  5ITT A;  1C79 A;  1YJI A;  2FUG 1;  2UUC M;  3W0L B;  1UUP A;  2WXH A;  2AHM A;  3SC3 A;  2WDQ B;  3GLH B;  4A6Q A;  3KWV A;  2B76 B;  3HHZ A;  2FE8 A;  2RDH A;  1GLN A;  2QIL A;  4MGZ E;  2D7G A;  4M9X A;  3GQ4 A;  3ETR A;  1QKZ A;  1H6U A;  3R9X B;  1NNU C;  1EE8 A;  2UUA M;  4DUY M;  2KXE A;  2Z7J A;  1FO4 A;  3W31 A;  1C4C A;  1BUI C;  3GLI B;  4JI2 M;  2XZF A;  4FCT A;  4LJA A;  4QOZ C;  2Y0Q A;  1DGJ A;  4RH6 A;  1XC8 A;  2F5S A;  4TUW A;  4RGM A;  1IN5 A;  2KQ4 X;  3GPU A;  4DR5 M;  1TS2 A;  1UWM A;  3AE2 B;  2WXR A;  1OFH A;  4NL4 H;  4YSZ B;  4X66 M;  4BOS A;  1Z5A A;  4MGI E;  2H1R A;  3SBJ A;  1WYG A;  3CF0 A;  1VLB A;  2I7N A;  2KA6 B;  2WXF A;  2LXE A;  1SE4 A;  1I4R A;  2XSZ D;  4IBE A;  1XLQ A;  4AQ7 A;  1YSY A;  3PHW A;  4LCB A;  3UJN A;  4JXJ A;  1NI3 A;  3FAH A;  1PDX A;  3W5U B;  1CQV A;  3GPX A;  1HZ6 A;  1Z5C A;  3HHY A;  1DGB A;  4FD2 A;  4DR6 M;  3TWL A;  1OQQ A;  2XNA C;  2KAJ A;  5ITU A;  4HEA 1;  1PYW D;  2KRU A;  2BT6 A;  1GVN A;  5EXP A;  4FXC A;  1QOF A;  2H89 B;  4QHT A;  3LB8 C;  2AX5 A;  4B7H A;  3K8Z A;  3FIL A;  4GUA A;  3TL4 X;  4WW0 A;  1SE3 A;  3PZ8 A;  4G6Z A;  3RE8 A;  2QJL A;  2INP E;  3NBI A;  4BLC A;  1NVM A;  3T38 A;  1JWB D;  3OWE B;  3GPY A;  4LF4 M;  4W5W A;  2CV1 A;  3LMM A;  2R62 A;  2Z8L A;  4B7G A;  1IBL M;  4GHA A;  4MM3 B;  3PHU A;  1E0Z A;  4L8R C;  2BJW A;  1SJE D;  2ZAM A;  4YWG G;  1Q3B A;  2G5G X;  1UGJ A;  4QOS A;  4CGY B;  5JI3 E;  2R4E A;  4KOD A;  5EE0 A;  3O65 A;  1TKG A;  4YTN B;  4JI8 M;  2JQR B;  3L26 A;  3AOG A;  3E56 A;  3HJ8 A;  1ET6 A;  3VFD A;  4M0W A;  3I4Y A;  3Q8F A;  1DO0 A;  1E94 E;  2WDR B;  1QZM A;  3WHL A;  2L1A A;  3FTC A;  2KN4 A;  4YXD B;  3UGJ A;  4LY6 A;  4OX9 M;  2HHH M;  2Y5P A;  3KDS E;  4DUZ M;  4JI4 M;  4TMA B;  2HTM E;  1XLN A;  3VQI A;  1N60 A;  3MP2 A;  4KGT A;  2KZU A;  3AMZ A;  1L4D B;  4B0E A;  2WXM A;  2KMM A;  1DO2 A;  4GLS C;  2DBY A;  2K22 A;  1PUT A;  3TEW A;  1K3X A;  1VZ6 A;  1E6E B;  4A9A A;  5BMH A;  1TDH A;  4ZRP A;  1J7K A;  4JI7 M;  3IFU A;  1JWM D;  3CTW B;  3AN1 A;  2QMT A;  1MI0 A;  1Z5B A;  4AG6 A;  2KW0 A;  1WRI A;  3VRA B;  4HJG E;  2ZAN A;  1D5Z C;  1GOZ A;  1NVI D;  2X49 A;  4NSO B;  3A46 A;  2Y5C A;  3ZH9 B;  3BY4 A;  3W5V B;  2N9L A;  2IGD A;  1XLO A;  2ON8 A;  4D81 A;  1HQR D;  4G4N A;  4ARI A;  1DOI A;  5LNK 1;  2UXB M;  1Q3C A;  2M0A A;  3KOZ E;  3IT6 B;  3VDP A;  1XXH B;  4R3D A;  3K2L A;  4A90 A;  3TQS A;  2C9C A;  2JYE A;  3ZCB B;  1RFK A;  3AEB B;  3FIL B;  1N61 A;  3RFW A;  3U61 B;  1NHW C;  2UXD M;  4LK0 M;  1VZ8 A;  4DR2 M;  1KLG D;  5EXS A;  1N62 A;  4LZJ A;  3TE6 A;  2J7O A;  1FRD A;  2O5R A;  1V1P A;  2ZW0 A;  3KP0 E;  3R8F A;  5FK9 C;  1KRH A;  1RYJ A;  4GDL B;  3AEC B;  4DV1 M;  3PVS A;  1L0X B;  2XFS A;  1HQY E;  4LJ8 A;  4D80 A;  3KP1 E;  2Y21 A;  2LHE A;  2VZK D;  2UZJ A;  2HCB A;  3VDU A;  2N9K A;  4JWU C;  5HG2 A;  1OJL A;  2FBW B;  3BK2 A;  4A5U A;  1VR9 A;  3BYY B;  2WDV B;  1N5X A;  2PLP A;  1K51 A;  1C1K A;  2P5T A;  1T3T A;  3VR9 B;  1N32 M;  2BTE A;  1JML A;  4XDD A;  3SFD B;  2LGI A;  4J3O D;  4GMQ A;  3SYK A;  4BOU A;  4P16 A;  3P4R B;  5FTM A;  3C0R A;  4LGM A;  4REZ A;  3SFZ A;  5EE3 A;  2MJD A;  3U6Q A;  3AV0 A;  5C18 A;  2G1E A;  1KFY B;  1IQP A;  4NOO B;  1JCK B;  1FXA A;  2F4V M;  2SAK A;  1JQJ C;  3AJI B;  2NQ8 C;  1DGG A;  3Q8B A;  4ARC A;  2QP9 X;  5G5G A;  4AG5 A;  1E7P B;  4L16 A;  3PO0 A;  4LTU A;  3B21 A;  4QNM A;  1IN4 A;  1I4P A;  1M4V A;  1GPX A;  1R6B X;  1YQ3 B;  5EP4 A;  4JI6 M;  5KO3 A;  4JX1 C;  1G59 A;  2JTC A;  3U6S A;  4B08 A;  1VDD A;  3SHG B;  2QBY A;  5EP2 A;  5EXX A;  2PW9 A;  4IUM A;  4XBO A;  1STE A;  1F2R I;  1KFV A;  1QVR A;  4YT0 B;  1L0V B;  3HU3 A;  2BS2 B;  1V1P B;  1HR0 M;  1N78 A;  2C9O A;  2WXQ A;  1N36 M;  3ZC7 B;  1NJF A;  1Z59 A;  4RFB A;  3A98 B;  1QOB A;  2BJV A;  3MHV C;  2BS4 B;  2ZW1 A;  3B9P A;  1JR3 A;  3FUT A;  4IBI A;  4BOQ A;  2M19 A;  4HKQ A;  1QQW A;  3GLI A;  4DR7 M;  4D8I A;  1NJG A;  4DV5 M;  2CU3 A;  2F5Q A;  1FJG M;  3P1M A;  1J5E M;  4GC9 A;  1N75 A;  4IBF A;  2IGG A;  1EU4 A;  1SBB B;  5BR8 M;  3AKZ A;  4AS1 A;  4TQ0 A;  3BVZ A;  2XLJ A;  2L83 A;  2CFO A;  1SF0 A;  5EE1 A;  2RDG A;  3GP7 A;  5EZS A;  3KOX E;  2LWX A;  3DA1 A;  1YQ4 B;  2F5P A;  4A8X C;  3U5Z A;  1PM5 A;  4OZB A;  1E10 A;  2PIA A;  1GL7 A;  4IBK A;  1WSP A;  4X62 M;  3FTD A;  1I4H A;  2XH9 A;  2DHR A;  5D3I B;  3NVW A;  2QSD A;  4LRS A;  1YNT E;  3M7G A;  2JYT A;  3T3O A;  3LYY A;  1NY5 A;  1TH4 A;  1G8P A;  3TEZ A;  1R7R A;  1L0Y B;  2BYT A;  1B1Z A;  3O13 A;  4MAC A;  1TKY A;  3J81 S;  3KXE C;  1AYF A;  5ITX A;  3ZJV A;  2YEP B;  2WXL A;  2EEL A;  2K5P A;  4IOI E;  4L1B A;  3U2S C;  1QT9 A;  4OZC A;  5EP3 A;  2G9H D;  2JX5 A;  5JI2 E;  4PT5 A;  1FMA D;  4NAW B;  3AL0 C;  2OPF A;  3SAU A;  1VZ7 A;  1LO5 D;  5KPT A;  4IBG A;  1YN5 A;  3TPZ A;  3J9C A;  4NXN M;  3HU1 A;  5E26 A;  2JSV X;  1MVK A;  2CJO A;  4IJF A;  1IN7 A;  2X38 A;  3FUV A;  4XDC A;  2UU9 M;  5EE9 A;  2EKI A;  3GRR A;  3R2I A;  2WXI A;  4ZHP A;  5ITX E;  4JI1 M;  3CWI A;  3AEG B;  1BML C;  2I38 A;  2DWM A;  1DYQ A;  5A2Q S;  1JWS D;  3FYD A;  2W3S A;  1XLP A;  2EO2 A;  4IP3 A;  2C5R A;  4N58 A;  3SHF A;  1F2R C;  3HGI A;  2Z4R A;  1FNN A;  4G4O A;  3GO8 A;  2K3U A;  3R8B A;  3AB5 A;  4Z6Y A;  3UI3 A;  5DNY A;  2J52 A;  3IT4 B;  1I4G A;  1I4Q A;  3BZD B;  1XCQ L;  3LVW A;  4L4U A;  4YTP B;  3TMP A;  3U5Z B;  1YMH E;  1TY2 A;  3SAV A;  3SYL A;  1YN4 A;  1C9F A;  4DR1 M;  5H92 C;  2K47 A;  3AE1 B;  4X65 M;  4BOP A;  3L25 A;  2NTT A;  2R46 A;  4UDU C;  1D6E C;  2CHQ A;  1SIJ A;  4RF0 A;  2KZS A;  2QZ4 A;  1ZUD 2;  3I57 A;  3AOE C;  3AV8 A;  1HQC A;  2W55 A;  3D8B A;  2PVO D;  3BBA A;  4R7G A;  1L6V A;  3NVV A;  4LZZ A;  2XF3 A;  4US8 A;  1SJH D;  4HLQ A;  1HT2 E;  2M56 B;  4D82 A;  5E6J A;  2H88 B;  1TY0 A;  1XWI A;  2R18 A;  5G5H A;  2TSS A;  5EQT A;  1ZDV A;  2ICI A;  1XXH A;  3GS2 A;  4GDK B;  2XSZ A;  1SE2 A;  4JN6 A;  4DV3 M;  3U61 A;  1XNQ M;  2M60 A;  3PNV A;  4QHS A;  1NY6 A;  2YNM D;  5C1B A;  3AE9 B;  4JI3 M;  4D8E A;  1NEN B;  4B3S M;  3HVD A;  1PJJ A;  1GKI A;  1SEB D;  3L29 A;  1WWT A;  2CHG A;  4JV5 M;  3CF6 E;  3ZYY X;  1Q10 A;  4L78 A;  4FW9 A;  5KPZ A;  1ROE A;  5HFY A;  1SXJ D;  2WXG A;  3EA6 A;  3PRP A;  4GIP A;  1KYI A;  2IJ0 A;  1LV7 A;  1JAL A;  4YHH M;  3TEY A;  3PRM A;  1YZB A;  3VK8 A;  3J7B A;  4ZOH C;  4B7F A;  3Q8X A;  5FTK A;  4OW0 A;  4MGY E;  2X8A A;  3AED B;  2L32 A;  5BPV A;  3RGP A;  3J2P B;  1QOG A;  4WWM A;  4RKX A;  2UXC M;  1ACC A;  4JWS C;  2XGN A;  1C77 A;  3W2D A;  1QLB B;  3M0E A;  3M6A A;  3AE4 B;  4ZYS A;  4RGO S;  1NYQ A;  5BYQ A;  3AEF B;  2WU5 B;  3EGR A;  4DV2 M;  2J42 A;  3RNV A;  3I51 A;  3SFE B;  3E4R A;  1K82 A;  1HT1 E;  1NHG C;  4HRS A;  2DXI A;  1K50 A;  3NWL A;  4FWG A;  2BNK A;  2EUC A;  2LUM A;  2V3N A;  2YEP F;  2N7J A;  2JXT A;  2WQY B;  3HRD D;  1TGU A;  5IZ7 D;  1TH3 A;  2K0P A;  3JR5 A;  3RFZ B;  1B9R A;  4GKJ M;  3BWU D;  4D8B A;  1N33 M;  1ZAE A;  4IIW A;  4K0K M;  2AQ3 B;  3MHZ A;  4LF6 M;  1ZXI A;  2RMM A;  2Z3X A;  4WIP A;  3VLF B;  1FIQ A;  1D5X C;  3NZ3 A;  1QAQ A;  2DLB A;  1FNW A;  2KDM A;  1XNR M;  1BXT A;  3FKE A;  5ITQ A;  2J4X A;  3GRV A;  4KKJ A;  1G3I A;  4MH8 A;  2KWD A;  4M9Z A;  5KPR A;  1D4B A;  5AUI A;  1N34 M;  3FD9 A;  3AOE A;  4DQO C;  4XWW A;  3Q8A A;  3L2A A;  2E6X A;  4IJE A;  1TS5 A;  3GRY A;  3ABV B;  1JRP A;  1YN3 A;  1Q39 A;  1C76 A;  2J7Q C;  2N0S B;  3BVM A;  1UWX A;  5KQD A;  2QIE B;  2Y3A A;  4GKK M;  4OVZ B;  4GHL A;  2XZU A;  3U6C A;  1ZP0 B;  2WLB A;  1DOY A;  2K9X A;  4CQN A;  3UK6 A;  3U52 E;  1KSF X;  1DGF A;  3HHW A;  1YJJ A;  2F5N A;  2PKO A;  5GXG B;  3VKG A;  1E9R A;  5JXV A;  4C7Y A;  2Y0T A;  1IBM M;  1SXJ B;  1KTK A;  1EWY C;  2DOS A;  3HWS A;  1MPE A;  2SEB D;  1W5S A;  3I4V A;  4I8O A;  2YR0 A;  1GAQ B;  1XXG A;  1HEZ E;  4CHT B;  1TH2 A;  3Q69 A;  2BB6 A;  1MHX A;  2WNM A;  4HXD B;  2PTL A;  1K3W A;  1R2Y A;  4IBD A;  4LF5 M;  2FNA A;  2X4A A;  3ZQ4 A;  3KLS X;  2Z4S A;  1FNU A;  3ZNH A;  3FYC A;  2BS3 B;  3AFH A;  1NEK B;  5D7G A;  3H4M A;  3ZGZ A;  4FVM A;  3DFZ A;  5ITR A;  1RWS A;  3P63 A;  4AW4 A;  1IBX A;  3U60 A;  1T6B X;  2Q2E B;  2WXO A;  4KLN A;  5EJC A;  2R4J A;  3AEA B;  3B2F A;  2BTW B;  1YE9 A;  2DWL A;  2XN9 C;  3P42 A;  3RGS A;  4JI0 M;  1F77 A;  2JZP A;  2I7P A;  2C96 A;  4ITK A;  1CZP A;  1J7C A;  4LF9 M;  1I7H A;  1SXT A;  2BB5 A;  1R2Z A;  4I5S A;  3NVZ A;  2D7E A;  3DWM A;  2YFQ A;  2RGO A;  2DWN A;  1N77 A;  4WH4 A;  3KW6 A;  3IAS 1;  4MGH A;  3BVG A;  2L52 A;  2LHD A;  4JE3 B;  3LQR A;  3VRB B;  3MTV A;  1ZOY B;  3NUH B;  2J7N A;  4II7 A;  1ZDX A;  4KKI A;  3U6M A;  3KOW E;  1XCT L;  1FM0 D;  3J80 S;  2FOI C;  3A42 A;  4N59 A;  1XMO M;  3VK7 A;  4DXG A;  5JZE A;  3AE7 B;  3THG A;  5FKA C;  8CAT A;  1QAM A;  3MK6 A;  2JA2 A;  2L7I A;  3E9S A;  5T8I A;  3FTE A;  4L2Y A;  4MGK E;  2DZN B;  4LF8 M;  2NTS A;  2VZK B;  3QAU A;  3URY A;  5FR3 A;  4NRW A;  4C56 C;  4MT5 A;  2WS3 B;  4D2K A;  4LG2 A;  3NRZ A;  2J7Q A;  3GLF B;  3P4P B;  3HU2 A;  3GP1 A;  3GLG B;  3KFU G;  4OHJ A;  1W5T A;  4YTM B;  2CV2 A;  5HI1 A;  4B3M M;  3AE3 B;  5BMI A;  4BBA A;  1L2C A;  2MEK A;  2MH7 A;  4FWH A;  2G8L A;  3Q8E A;  4IBB A;  1L8Q A;  1HNZ M;  1JWU D;  1T3Q A;  1IBX B;  2QEJ C;  3U60 B;  3FTF A;  2DYO A;  3SMS A;  1WGK A;  4US9 A;  3T1Y M;  1C78 A;  3DWG C;  2LNH C;  4AI6 A;  3PHX A;  1D2N A;  3Q8C A;  3PXG A;  4DV6 M;  2DWZ B;  3PNY A;  4KHP M;  2ZBK B;  1I4X A;  1TDZ A;  2LMC A;  2CHV A;  2DYM A;  2D5G A;  3T15 A;  5IRE B;  1TS4 A;  2C98 A;  2Z84 A;  4RGT A;  4OU7 A;  2L7H A;  1SXJ C;  1F0Z A;  3U4E G;  1ORY B;  1V1O A;  2V1U A;  1GL6 A;  3U6O A;  4MH0 E;  2PMV A;  3FC4 A;  3AM9 A;  2XFT A;  4B3T M;  3ILK A;  1MHH E;  4I81 A;  1IY2 A;  1K53 A;  3SMP A;  1FFU A;  5DYI A;  4LFA M;  4PD2 A;  2V1C A;  1QAN A;  1EWC A;  2PVG C;  3GQ5 A;  4LJ7 A;  3A45 A;  5FTN A;  5KQ8 A;  5FLX S;  2V4I B;  1RM6 C;  3CIR B;  4TQ1 A;  1NNJ A;  4CIS A;  1ZQ9 A;  3PSE A;  1HA5 A;  2E3T A;  3HUI A;  3P4Q B;  1EU3 A;  3B2G A;  3NVY A;  4OZA A;  3KS4 A;  1J7B A;  3UMM A;  1ET9 A;  1FCL A;  1JRO A;  4PCZ A;  4B3R M;  1UNS A;  3D8L A;  3HJS A;  2Q5W D;  4JI5 M;  2L09 A;  1FXI A;  1L2D A;  3GPP A;  3V3X A;  3W1S A;  3C8Y A;  1ESF A;  4NZL B;  2C99 A;  4LJ6 A;  1C4P A;  3GB1 A;  3U6L A;  3L27 A;  1PGX A;  2BW2 A;  4HRO A;  4USA A;  3B9J A;  1ENF A;  1P7E A;  4XGI A;  1PGA A;  4ZRQ A;  4TSS A;  1KF6 B;  1TS3 A;  2HKJ A;  4O1N A;  3KWL A;  1TKE A;  5AUK A;  2CUZ A;  1DOX A;  4G4Q A;  4AKG A;  2LH0 A;  3MJ5 A;  1J09 A;  2UUB M;  2AQ1 B;  3VR8 B;  4LGY A;  4IKG A;  3TEX A;  2LJI A;  2QEN A;  3L4P A;  1WXQ A;  2GI9 A;  4YSY B;  2HWK A;  3NS1 A;  2V6Z M;  3SAW A;  3HHX A;  5BYS A;  4L15 A;  1SSN A;  3BYT B;  4MI7 A;  2CE7 A;  2M5Z A;  2DZO B;  3R2T A;  3UZU A;  3P4S B;  1KH0 A;  4DV0 M;  2Y20 A;  4G4R A;  5C3J B;  4XZX A;  4EIW A;  1IM2 A;  2LEK A;  1C4A A;  2HL7 A;  3BB7 A;  4RCO A;  4DR4 M;  1YUB A;  1PVJ A;  3W9C B;  3DOA A;  4EE2 A;  3RPF C;  4PDI A;  3IG5 A;  3PT2 A;  1L2B A;  4WAF A;  2WXN A;  4OVZ A;  4P6V F;  4WUR A;  1T5X D;  1K52 A;  1IGC A;  3CF2 A;  3SAS A;  1TJE A;  2ACZ B;  1IGD A;  5GKN A;  4A55 A;  3BK1 A;  5BMG A;  4AZF A;  1Y56 A;  4ITQ A;  4HKZ E;  4NAM A;  2OHF A;  1SXJ A;  3AE8 B;  4RF1 A;  1FEH A;  1XO3 A;  1GB4 A;  1QAO A;  4Q2J A;  3TRK A;  1JW9 D;  1XEE A;  7CAT A;  2ZM6 M;  3SAT A;  2ZAO A;  5FTL A;  2KRK A;  2CV0 A;  2DWQ A;  3GRU A;  4NSR A;  4QNR A;  4GRI A;  4FCW A;  3T3N A;  1ZE3 D;  1OFI A;  5LMN M;  3AE6 B;  3L28 A;  5TSS A;  3KQ4 A;  1D5M C;  3OQC A;  4LLG M;  2V3P A;  1UM8 A;  2W54 A;  4FWD A;  4GIT A;  2JU6 X;  1FFV A;  3PFI A;  4NRV A;  5LMU M;  1NYR A;  3QWL A;  3W0F A;  3MC0 B;  2BTW A;  1N5W A;  2WP9 B;  1UKF A;  4AKH A;  4ZTB A;  3SR6 A;  2WXP A;  1KLU D;  4BOZ A;  2ERC A;  2QPA A;  1SXJ E;  1L6U A;  4LFC M;  3TWK A;  5ITY A;  4JYA M;  4KO8 A;  1IY0 A;  2JRI A;  4RNA A;  1SB3 C;  3TUO A;  3H8H A;  1S3S A;  1TZO A;  2AGA A;  2IPK D;  2GB1 A;  1AW7 A;  2RGH A;  1FRR A;  1R7S A;  2WXJ A;  1HNX M;  2R61 A;  5IT9 S;  1TYG B;  1I94 M;  3JAM S;  1PJI A;  3C58 A;  3EUB 2;  1XMQ M;  1IXS B;  3IXS A;  2RKO A;  1FCC C;  1ZPS A;  3KSJ A;  4GC5 A;  4HL4 A;  1FNV A;  2VII A;  1V8C A;  1FD6 A;  2XEP A;  3FUU A;  3KVW A;  2VQE M;  2NMQ A;  4LF7 M;  1OFF A;  4JPS A;  3AEE B;  4NJC A;  4LJ9 A;  2WXK A;  4N6E B;  3LQQ A;  3FUW A;  2OQ4 A;  1QOA A;  1MX0 A;  3EIE A;  4M9S A;  1PGB A;  5FSW A;  4B0M A;  1XF5 L;  3LVV A;  1XHB A;  1Z6T A;  1ZXH A;  5C2T B;  3BII D;  3MFG A;  1IXR C;  2VQF M;  1P7F A;  1E9S A;  3SAR A;  3KOY E;  3GLF A;  4PDG A;  3GLG A;  3ZJU A;  4LJ5 A;  2D7H A;  4C7Z A;  1L1T A;  2KAC A;  4IBJ A;  4FCV A;  3DZD A;  1HNW M;  3BOS A;  2IDY A;  4ZPX A;  3VKH A;  1L4Z B;  1HXY D;  2W82 A;  4GH9 A;  1X37 A;  4DV7 M;  2L6O A;  4YSX B;  3W30 A;  5HHD G;  1VRA B;  3SEB A;  2MJE A;  5DYG A;  1DGH A;  2WU2 B;  1A70 A;  4WQM A;  3I9V 1;  1GB1 A;  3HVZ A;  1VDV A;  2CEA A;  3MP9 A;  1L1Z A;  5I4D A;  1CK1 A;  2HDE A;  2DVW B;  1JR3 D;  2E5L M;  2AQ2 B;  1G41 A;  1QIL A;  4ZHO A;  4L23 A;  2LFI A;  1MU5 A;  1G4A E;  3EIH A;  5FTJ A;  1AN8 A;  4IDI A;  3GLH A;  4AQY M;  3TSS A;  1PFD A;  1DKI A;  2I2Y A;  5F3W A;  4I4L A;  4DXF A;  1QQR A;  2FFJ A;  3WHK A;  4DR3 M;  1VJK A;  4AKI A;  4H2A A;  4Z8X A;  1V97 A;  4XWT A;  1J7A A;  2OED A;  1I4W A;  4A3V B;  5IWA M;  1IN8 A;  5H37 D;  1IXZ A;  2ONQ A;  1IUE A;  4IBC A;  4LJ4 A;  3J7A S;  4C80 A;  3AH7 A;  4LRT A;  1QF6 A;  3AE5 B;  2IGH A;  3N9Y C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...