4RF1A

Crystal structure of the middle-east respiratory syndrome coronavirus papain-like protease in complex with ubiquitin (space group p63)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
321
structure length
319
Chain Sequence
LTIEVLVTVDGVNFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKELYGPVDPTFLHRFYSLKAAVHGWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFVIPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVWREWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQLVEHTTPWLLLSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKLILKFDSGTVSKTSDWKCKVTDVLFPGQKYSSDCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords ORF1ab protein
publication title Crystal Structure of the Middle East Respiratory Syndrome Coronavirus (MERS-CoV) Papain-like Protease Bound to Ubiquitin Facilitates Targeted Disruption of Deubiquitinating Activity to Demonstrate Its Role in Innate Immune Suppression.
pubmed doi rcsb
source organism Human betacoronavirus 2c jordan-n3/2012
total genus 86
structure length 319
sequence length 321
ec nomenclature
pdb deposition date 2014-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1190 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4rf1A02
3.10.20.540 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4rf1A01
3.90.70.90 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4rf1A03
4OVZB 4REZA 2FE8A 4RNAA 5E6JA 4P16A 3E9SA 4PT5A 4MM3B 4OW0A 3MJ5A 4RF0A 4M0WA 3MP2A 5KO3A 4WURA 4RF1A 4R3DA 4OVZA
chains in the Genus database with same CATH superfamily
3DBHB 2A5UA 4JX1C 4ANRA 1ICFA 2L83A 1F4IA 3UIPB 4ANWA 4NRWA 3QCAA 1P3QU 3R2IA 1FD6A 5IA7A 1YMHE 3M62B 4J6IA 4MJSB 1FJGM 1VSNA 4B7GA 2JWUA 2KJHB 2XNAC 1WIVA 2PTLA 1NPZA 1PJSA 4FCWA 4BB9A 2Z0DB 1D2NA 2XEPA 3SR6A 4BPVA 3N30A 1E10A 3MTNA 3Q3NC 1DGBA 1P7FA 1M94A 2BWFA 1NV8A 3WANA 4IJFA 5JHBA 3PXGA 4AKHA 3SFZA 1L6VA 2LGIA 5CX3A 2V4LA 4WJOA 3TMPB 4X6IA 2K5PA 2WU2B 5DPRA 2BYEA 4YVAA 1XLOA 1NHGC 3Q8XA 1K53A 3GRVA 2DHZA 3APDA 1PJQA 3QX1A 1BGOA 2BU3A 3IFUA 1C76A 3B7ZA 2KD0A 3DA1A 1J19A 2FIFA 3PRPB 2QCZA 4W9GA 2ATOA 1WRDB 1Q10A 2FCQA 2LTUA 2K25A 4Q7JA 2INCC 1NHWC 4GEWA 5L8RF 2F5PA 1EO6A 1WMHB 2R0IA 5FPWA 2Y5CA 3OLMD 1L1ZA 2R4JA 4IBDA 1V2YA 2DYMA 2HE7A 2MSED 3KYDD 4MT5A 2Y6EA 3LB8C 4LNIA 4IKGA 1I4PA 3FYCA 4WJPA 3NHEA 1WGGA 5BYQA 2DWQA 5KPTA 4MZSA 2R62A 1I7HA 5JH5C 4K0KM 4ZHPA 1SE4A 4Z6YA 2AGAA 2GLSA 2UU7A 3GLFE 1EWYC 1K52A 2LRWA 2D10A 1NLJA 1AU3A 4AXLA 4A9AA 3GLHB 3NZUA 4N8WA 4JQWC 2BPSA 2F5NA 2ACZB 2N9EB 2RGFA 4KGRA 1QANA 1VZ8A 3E21A 4RFBA 1WJNA 2DZOB 3IT6B 3ZNGC 3HK0A 1SB3C 2PEAA 3B9PA 2LHDA 1MVKA 4BBNC 4DWFA 2CWBA 2LI5A 1XHBA 2L1AA 2KLCA 3U6CA 1UNSA 3B7QA 4J3OD 2KMAA 4DR5M 1GB4A 4BKTA 1WM3A 1SIJA 2WXIA 1JRUA 2CHZA 3NG0A 2KQ7A 1GPXA 3KP0E 4II7A 4HDOA 3RE8A 1NI3A 2XF3A 3I04M 4W9EA 3ZKJC 4YY3M 4D8EA 2L8JA 2XGNA 3N32A 3U8ZA 5J2RA 3Q14C 3IMAA 1DGHA 4MACA 1CJEA 1JCKB 2DCAA 2QENA 5JXVA 3T9LA 4AQYM 1CB5A 3L2AA 1NVMA 1T0RC 4JI4M 1HE8A 2RRUA 2VZKD 1SSNA 3CIRB 3RPFC 3FAHA 2R9NA 1PYWD 3P4PB 1OQYA 2ZPNA 1GJTA 3FKEA 3SFEB 3AV0A 2K8BA 1WGDA 1AU4A 1T5XD 1IXRC 4X66M 2JT4B 4FK5A 3BK2A 4TV3A 3PRZA 4LCDE 4PT5A 3KS8A 3SDLC 4HPPA 3L27A 3BWUD 4OW0A 3TUOA 1N5WA 3V6EB 4I6LB 3BY4B 5EP2A 2KVZA 4HKZE 4IG7B 4KVGB 5FR6A 2Z84A 4X64M 4GDKB 4LJPB 3MJWA 2VHFA 2KDEB 3EIEA 4BBAA 4FJZA 2QHOB 5A2QS 2GBNA 1EF7A 4CJ6A 1ZP0B 3I5JC 3KWBX 3T3NA 2H89B 3PLVA 4ITQA 3SHGB 5AZFA 1F52A 2P5TA 2CE7A 4ZHOA 2DCCA 3KSEA 1NJFA 1ET6A 1WX8A 1V34A 3L10B 5ITQA 3AEBB 4PYUA 1GL6A 2LGDA 1ET9A 4LJ5A 4KSLC 5GXGB 4QHSA 4FJVB 3KX1A 2WXHA 4BOUA 2W54A 3B2GA 3I06A 2KQ4X 2J7QC 3VFDA 4HRSA 2V1CA 2Y5PA 4C4VA 3H8BA 3O1GA 2D07B 5EXTA 4JN6A 2WXNA 3C19A 2XU3A 3Q3FA 3OWEB 2BS3B 2JWZA 3SHFA 1IYFA 4PDGA 2MJ5B 3FUTA 3TNXA 4NZLB 5EXXA 1ROEA 3K2LA 3GLIE 3UINB 3QC8B 2QSDA 2CRUA 4OX9M 3BBZA 2IBIB 3ALBA 1TU6A 4S12A 4FWHA 3KWVA 3W9CB 4DV6M 3E1ZB 4YV8A 3TEWA 4MSQB 2IO3B 3L25A 1WE7A 3ZJVA 4C00A 2DI0A 4QAYA 4IC7B 2D11A 3EA6A 4LJ4A 1K51A 2WDQB 5G55A 3KOXE 3KUCB 4KSKC 1JWBD 4RKUF 1Y4HA 4L16A 4RGNA 3VUWA 3U60B 4DBGA 2DWLA 1OIPA 3FTFA 1J8CA 2F5SA 2HCBA 3TL4X 1YUBA 2KXEA 2XSZA 2KO3A 2NR2A 1F2CA 1ZDXA 1F2RI 2Z59B 3KOZE 1HEZE 2N9XA 2L09A 4FHJA 2FCMA 3MTNB 1CK1A 1N34M 3T6PA 5EP4A 2LH0A 1OAOC 2LJ5A 5EE1A 3USVA 1GOZA 3H4MA 4R3DA 3VVWB 2FT2A 3AE5B 3H7PA 4B7FA 2N7EA 3RULA 4LF5M 5I4DA 3IT4B 3PNVA 2R45A 1PJJA 3HU3A 1EU3A 5HI1A 3TE6A 4IWPA 1V97A 3C9PA 3VRAB 3QA8A 1VZ7A 3ZJTA 2JZ3B 4IDIA 4F1SA 3D6SA 2KLGA 4N58A 3JVZX 4PYZA 5TR5A 5DFLA 2M0XA 1CUKA 1CZPA 2BF8B 3AKZA 3SYLA 2DC9A 2KTFA 4PS8A 3HD3A 3A33B 3BYTB 2Y5BA 2LZ6A 1LO5D 4JGHB 3RVXA 1VZ6A 1LQBA 1TR8A 2WGSA 3GOEA 3TWKA 3Q69A 3VQIA 1AU2A 3AEAB 4I05A 1PXVA 4DXAB 3UZUA 1HNWM 2IJ0A 5FR3A 5H8YE 1S1QB 4I6NB 4B0EA 4HKQA 1XLNA 2O6XA 3IUTA 4F2LA 4LJAA 2BBCA 3DBHI 3AM9A 3W1SA 3SARA 3SAWA 2X38A 2EJSA 2JZZA 1YJ1A 3IBEA 2W3RA 3I9V1 2W82A 1T3TA 3HU2A 1PQSA 3NVZA 3QJZA 3U4EG 4MSMB 3LFYA 3U2SC 3F92A 2R46A 1OTRA 3H7SA 4KDIC 2KJRA 1JQ4A 1QT9A 1BUIC 1PM5A 2H1RA 5TSSA 5CVMA 3U6LA 1ZMVA 3PHXA 2M56B 4KZCA 4JYAM 3H8CA 1PGYA 1HR0M 2AL3A 1MHWA 2A5YB 4JV5M 4NC6A 4XR7A 1BMLC 3FUWA 1DYQA 2G4DB 2J0KA 3PPAA 5JH3A 3KVWA 1H6UA 1R4GA 5FLXS 2WXGA 4PDIA 2F5OA 1FXTB 4YXDB 1SXTA 2CJOA 1Z5CA 1YN5A 3H7DA 2JQGR 2D7EA 1YQBA 5EDSA 1UWMA 3N3KB 1E90A 2LXCA 3DZDA 1MFWA 2EELA 2EMTA 3ZCBB 2DC7A 3LJ3A 1BXTA 2RPQA 3GLGE 5G5GA 4LJ9A 4DDGD 1MHHE 5C23A 4AJYB 3N1YC 2FTDA 2GMIC 3B0AA 2ZANA 3SHQA 4DV3M 3H4JA 1JROA 1IQPA 3A4SC 4NY0A 3ZUNA 1N6ZA 2QDFA 1O0EA 1ATKA 2L7HA 3P5VA 2J7OA 3FKYA 3R8BA 3KUDB 4RKXA 3N20C 1P7EA 4EZKA 1V92A 2BJWA 4BOZA 1GC6A 1IN5A 2C9OA 4IBCA 2UUAM 4W4UA 3OF8A 4F7ZA 4HPLB 2QC8A 2FH0A 2E01A 5D3DA 1HUCB 2FRQA 3B74A 1N5XA 1YJJA 4XGAB 3AI5A 4G4NA 1Z5BA 3BB7A 2KJ6A 4TQ0A 3A9KA 3U6OA 3B7NA 5FTJA 2TSSA 2GNOA 4DV2M 1WGKA 3P42A 1P98A 3PFIA 1YX6B 3ZO5B 3HJQA 5BYRA 4A3PA 1X9YA 3ZYYX 1A5TA 1HNZM 1PGAA 4UN2B 1UF0A 4GGQA 4WQOB 3GLFB 1K3BB 3P63A 3V05A 4DR1M 5D7GA 3M99A 4QH6A 4CHTB 3H8HA 1YD8U 5EXPA 3WAPA 4P6GA 2C7MB 1ENFA 5D94A 1PGXA 1NSFA 4CQNA 1SXJD 1WXVA 3PZDA 4FVMA 5ITYA 4GKKM 3PRMB 2R6NA 4BS6A 1CPJA 2J5YA 2O6VD 4X62M 2I1JA 1WXMA 4QRGA 3AXCA 3KOWE 3AEDB 1DGFA 4A3OA 1UELA 3SATA 1VEKA 3BIID 2DC6A 4LTUA 1FH0A 1L0VB 5G5HA 4ARIA 4GB9A 3ZRCA 1I42A 3WXFA 3M6AA 3NBIA 3M3JA 2AEHA 1WH3A 4W9DA 5E6PA 1GMYA 4D81A 2KX0A 4IWOA 1VRAB 2NPTA 5DPWA 1P0RA 4NXMM 1IM2A 2XEWA 3O0UA 2IO2B 2UWQA 1FRRA 3S2AA 1C1KA 1STEA 2RSUA 3P5UA 4CHKA 2FCNA 5KPRA 4DHJD 1SF0A 2ZTCA 2C7NB 4US9A 1D4BA 4YSZB 5EGWA 2HWJA 2OOBB 1EWPA 1F2AA 4P6VF 1QLBB 2HTME 2PIAA 2D2QA 2WZJA 3I4YA 2KTRB 2UZJA 5JZEA 4HROA 2MQJA 2XH9A 1QMYA 3TSSA 4A55A 2LGXA 1GLOA 1EIJA 1D0LA 3GLHA 1OJLA 2OHFA 2QILA 4TKNA 2N7DA 4DV1M 3GLGA 1WX7A 1YQ4B 3RCZA 1NB3A 3E4RA 2DCBA 2JZPA 3GP7A 3MHSA 1R4MB 3U5ZA 3ZXVA 2H88B 2AS8A 4NRVA 2ON8A 3J9CA 2P7UA 4N59A 1U9VA 2R65A 2B1NA 2OO9A 3PREA 3NJTA 7CATA 1E7UA 1QKZA 1GB1A 2BKRB 2GFOA 2XLJA 2DAMA 1DEUA 5FSWA 4GN1A 3RI7C 4L78A 4AG5A 1QOFA 2BS2B 2YJ9A 1GL7A 1CSBB 1MU5A 1L2BA 3V76A 1IN7A 1TKYA 2G7YA 5KHOA 3APFA 2R61A 2HD5A 1OTRB 3DFZA 3KS4A 4CO7A 4JWUC 2WXQA 2BGFA 3U6MA 4LF4M 3RMKC 4AWJA 1XO3A 2M1MA 2KMCA 2BTWB 2BW2A 3SD5A 3J80S 1UKFA 2JNHA 3M0EA 4TMAB 2GQFA 1GCBA 1J7AA 2GBRA 3PGEA 3PHXB 3TEXA 1QDTA 2CR5A 2J0JA 2DZJA 2QPAA 3GLIB 1WXAA 3TWMA 2EKEC 1SEBD 2WXRA 4YSXB 2R9OA 1IUEA 1NVID 3AEEB 1E9RA 1TH3A 4JI5M 2K22A 3E9SA 1IN8A 2L00B 1SJED 1JR3E 1ZDVA 2L32A 2SEBD 4WWNA 4NSOB 5KQ8A 3AL0C 2LGSA 1AU0A 2BDZA 1FFUA 1WWTA 1UBQA 2G1EA 1AYFA 2PPHA 3ZJUA 3W1SC 3KKUA 1ZMWA 1D0MA 2W55A 3AFHA 1XLPA 3ZVVA 3L17A 5ITRA 2XFTA 2RDGA 3J81S 2F4VM 2IO1B 3C3EA 4FHKA 3LDZE 1V6EA 2LJIA 2L2DA 1HQCA 2FYEA 4IM2A 4OZBA 3U61B 3Q8CA 2KN4A 2KDLA 2MROB 4KKJA 4NL4H 1YK8A 2LRUA 2AHMA 2JA2A 3FTCA 4MGIE 1F1HA 2UXBM 3M7GA 4O1NA 3ZNHB 4FWDA 1LGRA 4ZRKA 2I2YA 2F1GA 2LWXA 2ZTDA 1KJTA 1Q6KA 2AVWA 4LRTA 4YT0B 2JPHA 3GE8C 1TF0B 2BWES 1FNVA 1YZBA 4BOZB 3KFQA 4IBGA 1HNXM 4NNJB 4OHJA 3DVNV 3L54A 2ZJDA 4AS1A 1D5XC 4GUAA 5EP1A 5DPTA 2RDBC 5HG2A 2MBBB 4WH4A 3C0RA 1YSYA 4GHAA 1G71A 1QZEA 1S4VA 3A9KB 3N1XC 2KKCA 2C9WB 3VRBB 1KXRA 1XT9B 1MN3A 4JPSA 2G3QB 2FS1A 4I8OA 3ENEA 5CHTA 3R2TA 1D5MC 4LFBM 5HFYA 2XN9C 3IEJA 2L52A 3N3GA 2DBYA 1F2RC 3Q8FA 3ETRA 1PVJA 3SU8X 3RVVA 1M6DA 2PREA 1T0QC 1E8WA 1OFHA 1XKGA 2JZ1A 3A98B 2DHRA 3BOWA 1Q5WB 5BMIA 4WJQA 4UDUC 3RNAC 3U60A 1N33M 3PNYA 1MG4A 2MP2A 2AUXA 3W31A 4D80A 4CGYB 2HJ1A 3VDUA 4MI7A 2AX5A 4W9FA 1UZXB 2E02A 4DV4M 3QIJA 2BS4B 1KFUL 3LQRA 1YALA 1F0ZA 1T43A 3Q3MC 1NO1A 1RRBA 2R9FA 1KM7A 2WSCF 2ZVOA 2LGYA 3B9JA 3R3MA 2DAEA 3L26A 4B95A 4GH9A 1WFYA 2V1YA 4US8A 1IGCA 3ZRFA 2NPTB 4M02A 1PIPA 3LCVB 1Y8RC 2IY0B 2ZAOA 1GG3A 5C3JB 3FYDA 3LQQA 2QNJA 1WR1A 5FKAC 3RNEC 1DKIA 4CDFB 2KA6B 3H9DA 2E6XA 1MJGM 2K9DA 5FTLA 5AZGA 2VQFM 2B3AA 4IBIA 2WQYB 1JR3A 4IBEA 1DOYA 1RWSA 3A42A 2I1KA 2DZMA 4E74A 4EOYA 4CDEB 2NQ8C 5IAAC 3KWZA 3P4SB 2RGOA 2PVOD 1QDQA 5H37D 5JZEB 3LXFA 2BWEA 1UFZA 3ZQ4A 2WDVB 3IG3A 4MELA 2KXJA 4XYCA 4AOFA 1EWOA 2EKKA 3JSVB 3BYYB 1QQWA 2AQ2B 1XXHE 2CUZA 1JALA 4B0MA 3VAWA 3GLGB 4B3TM 1HA5A 3U8EA 1TKEA 2MH8A 2VDBB 1FRDA 2G4SA 3U5ZB 1YNTE 3BVGA 2YFQA 2V3PA 4KGTA 4LK0M 4NPNA 2ZEQA 3VXWA 1G8PA 1QILA 2MLBA 3P4RB 1PE6A 2JY6B 2WXKA 1MJDA 5C2TB 4DXFA 3CSTA 3IFWB 2OULA 2WP9B 3VKHA 2WYQA 1ZIVA 1Y8GA 4L8RC 4NSRA 4BKSA 1PCIA 1UGJA 2HD5B 2N9KA 3BPMA 3UGBB 3FILA 4L2YA 1LM8B 1TH4A 2EO2A 2L7RA 8PCHA 1IN4A 1TH2A 3FD9A 4ZPXA 1VDVA 1OFIA 3IAM1 2FUG1 4FXCA 3EC8A 1R6BX 5DCNA 5EE3A 1RYJA 1KH0A 1L5PA 4AP4C 2IPKD 3A46A 1TJEA 1WXSA 3PV1A 4LDTB 2GBKA 2KDIA 4JI8M 2MWSB 2VF8A 4I5SA 3RN9C 2UUCM 2FRAA 2HXZA 3ONSA 4EEWA 2QBYA 4QNRA 1WHCA 3U6DA 4IWQA 3DWGC 2Z8LA 2XSZD 4JE3B 3T8MA 2L0TA 1W5TA 3VLFB 1C9FA 4Y28F 2I7PA 1G4AE 2KQSA 2O25A 2KACA 4XE0A 2FQ9A 2BKFA 3KOYE 3AE7B 1WXQA 2DENB 3E56A 4LGMA 3H6NA 3L4PA 3N3KA 4I81A 2UUBM 4KV2A 3QK0A 1VD2A 3NUHB 5GKNA 2P86A 4K81A 2QZ4A 1TY2A 3N4CA 1FM0D 3V62A 2CIOA 2WSFF 4HXDA 1R4MI 3CMMB 2Z8YM 1R7RA 2KANA 2DZYA 1FXAA 4IUMB 3L29A 1ZV1A 1C4AA 2DJGB 1VJKA 1A6RA 4DHJB 4B3MM 4QRVA 4BQVA 2CV2A 2DWMA 2LMCA 2HTHA 3CGWA 1WI0A 3IXSA 3SASA 1AUAA 4C7YA 1T0YA 4KX6B 1ZQ9A 3WXGA 3M95A 3V60A 2LHCA 2AL6A 3I63C 4DV7M 4MGZE 1XD3B 3C0RB 1TT5B 2JY5A 1GABA 1ZUD2 1QAQA 1JWAD 5BMHA 3KFUG 1N75A 3P1MA 4HCNB 3W0LB 3VUYA 2C98A 3ZTCA 2PVGC 1DO2A 4ZDVA 1IXZA 4G0NB 1E8YA 4GIPA 4HPMB 2R4EA 2ZVNA 3GLFA 1BVSA 5DYIA 3MHVC 3GPYA 1EWMA 2MEKA 4WWPA 3DHHC 3VH4B 3LYYA 2MJDA 4M01A 2FOIC 2LVPA 1VDDA 1H4RA 2BB6A 1V49A 3FE3A 3HY5A 4IBKA 5ITTA 3NVWA 4DXGA 2BWBA 2LBCA 4BOPA 2MJ3A 6PADA 4IBFA 1TLOA 4AKGA 3PRMA 2O5RA 2KZUA 1QXPA 2JTCA 1PADA 4DUYM 1UGMA 2OP3A 1HQRD 1YOVB 2MP2B 4AJWA 3RD2A 3WHKA 3AMZA 1MEGA 1JW9D 3U6PA 3TQSA 2V4IB 2FUHB 5CVOB 4HK2A 5BMGA 4WP2A 3P4QB 3OVXA 3UK6A 1NYRA 4B6WA 1ZE3D 1WZ0A 4OZCA 3U7DA 1VJVA 2B76B 1C1YB 1QUTA 3QJ3A 2FE8A 1C4PA 4QOZC 2NQIA 1UUPA 1F29A 1FXIA 2WXPA 4N6EB 3Q8AA 4WAAA 3IV2A 2NS5A 2D5GA 1XF5L 1WR1B 3VFKA 4WAFA 4LNNA 1E94E 1MX0A 3VR9B 1DOXA 4HWYA 3SYKA 1WJ6A 5JA7A 2OOBA 2AQ1B 5IKCM 1TS4A 1XMQM 2IGDA 3PT2B 2KTRA 2Y3AA 4W9IA 1SGHA 2K0PA 4LNFA 3LMMA 3V6CA 4L1BA 4YTPB 1D5ZC 3H89A 2W3SA 1TGUA 2KDBA 1U9XA 5EQTA 3ZH9B 4KGSA 3SFDB 3L28A 2FUDA 3JYUA 1PDXA 2H5XA 2ZZPB 4A5UA 3PLUA 3K9MA 2FNJB 4PP2E 4G4QA 3VDPA 4L23A 1PBHA 4HCPB 3DDCB 2G9HD 1ESFA 5L95C 2J52A 5F3WA 1V5TA 4G4RA 1YT7A 4KT0F 2Q5WD 4WJNA 5CHWA 1FO4A 4CIZA 1QOBA 1GLNA 3B2FA 3K9PA 3L16A 4JI2M 4X65M 2YR0A 4DK5A 2DWZB 4PD2A 3NOBA 4DHZE 1AYVA 3DVGY 2NQGA 4BOSA 4XWTA 2UXDM 1KYIA 2L7IA 4GITA 4M0WA 3FILB 2KNZA 3FRIA 5CTRC 4ACFA 4KIKA 2MW5A 3BWKA 4KKIA 2BTWA 1K82A 1WR6E 4B7HA 2YEPF 4BVUC 1GO5A 3RGPA 4EFOA 3KYCD 4YSYB 1U5IA 1V86A 2AU1A 2BQQA 1IBKM 2DYBA 1OEYA 3GLIA 1UH6A 2CKHB 2QBYB 1IPGA 2PE9A 4DDID 4RM8A 1VG5A 2IYDB 4GC9A 1YE9A 1NDDA 1T0SC 5T8IA 1EUVB 2HH5A 3X0WA 1JWUD 3TEYA 1N77A 1VLBA 3VTWA 4Q2JA 1I4GA 4TUUA 3W0FA 3U7ZA 2CEAA 1Q3BA 1V80A 1HTQA 1JB0F 4GC5A 2D3GA 2JU6X 5D2MB 2GRIA 2CHVA 3VKGA 4R7GA 1R4NB 4D82A 1GJSA 1JMLA 3RNGC 1HT1E 4LF9M 3ZNZB 4JI0M 3KUZA 3FTEA 1KFYB 2JY7A 3DWMA 3U61A 2DCDA 1EM7A 3S3QA 3AJIB 4AI6A 4MB7A 2NQDB 1DV0A 3AOGA 2V9HA 4N9F4 4USAA 4HXDB 4WA6A 1R2ZA 2PNSA 2Z7JA 3ZNHA 1V81A 4JI1M 3B08A 2HKJA 3IAS1 1Z2MA 1ZW7A 4I6PA 2JYTA 1QAOA 5ITXE 1KLUD 5DYGA 1KSFX 2V3SA 3KW9A 2BB5A 1EF1A 1ZXHA 1E8XA 1IP9A 4HVBA 2M8SA 1W5SA 4HL4A 5AUKA 2NVUI 3JAMS 4FN2A 3HUIA 1GJZA 1B1ZA 3GCBA 3O65A 2JZ0A 4QHTA 1NNUC 4P1BC 3MHSD 4HLEA 2G3QA 4WWMA 2QQ8A 3WHLA 4RCOA 3AI8A 4LY6A 4W9JA 3R7QA 1SXJE 3X23A 2K6BA 3NS8A 3D8LA 1ZXIA 7PCKA 2DWNA 4OVZA 4MGHA 5LXIB 1XXHB 3TIXA 2X8AA 1GECE 3QAUA 3W30A 3SEBA 3MC8A 4XUIA 1N61A 4LF8M 2PMVA 2LXAA 2JP7A 3RNBC 5E6NA 4IP3A 2D3BA 2JF5A 4NAWA 4I4LA 4JI3M 3V3XA 1NNJA 3B1LX 1I94M 4W5CA 1XXGA 1Z5SB 3DBSA 2W9NA 4M9XA 1KHQA 2KW0A 3HJ8A 5BYSA 3ML8A 2EMSA 2VZKB 3GB1A 3Q8EA 4FCVA 4FW9A 3T38A 3F75A 2V3NA 3GQ3A 4CISA 5EP3A 5CVNB 5EZQA 1SE3A 4PCZA 3TJPA 3BC3A 2X4AA 1RU3A 2A4ZA 2XK5A 1Z59A 4M0DA 1XLQA 2MJEA 3DPDA 4HJGE 1IWDA 4HDQA 4GXBA 1AYUA 1R2YA 3NBXX 1AN8A 2IGGA 2WDTB 4AG6A 5LNK1 2LVQD 2KNBA 3SAVA 2XZFA 5H92C 3E46A 3GRYA 2DJFB 1ORYB 2E00A 2INNE 1TS5A 1TTEA 4XX5A 3CBKA 2FCSA 3RNFC 4GMQA 3JR4A 3GPPA 1L2NA 3V6CB 4BFRA 3THGA 2WNMA 5JI2E 4LF6M 3JSVA 1MS6A 1T3QA 1ZKHA 3HHMA 3B79A 2M17A 2WSEF 1U9QX 1VQ1A 2NBWB 1YK7A 1K3WA 4E71A 3ZIMA 2RD0A 3HHZA 3DBLB 1AIMA 2JUJA 1QOAA 1YIWA 3QT4A 2CFOA 3HHXA 2HWKA 3HIZA 2JY6A 1BQIA 3KSXA 2KFJA 2EKIA 1PUTA 5ITXA 4ANUA 5KQDA 4MEMA 1D6EC 1VEJA 3K9PB 1AIPC 3P2BA 1MG8A 3KW5B 3LXSA 4YTNB 4C56C 4EKUA 4FJYA 1KFXL 1P3QQ 1IXSB 4QRXA 3TCAA 3LCUA 1UBIA 3J7BA 1YN3A 3KDSE 4LJ6A 1WE6A 1POPA 1AW7A 1AWDA 4M8MA 4M0WB 2Y21A 4KIKB 1LTMA 2DVWB 3VHTC 3ABVB 4X57B 2N1WA 2R6FA 2CHWA 3EFUA 1SE9A 2M0AA 4M00A 3P5XA 2DKLA 3VUXA 1Z6TA 1QQRA 2LUEA 3LW5F 4B9KA 3RT3B 1XCTL 2WX0A 2JXXA 1SXJA 3RZFA 5HHDG 5E6OA 3K92A 2O6VA 1HT2E 4LNKA 1F9JA 1ZPSA 3PVSA 1TZOA 4DR3M 4YYRA 2HAKA 5KHQA 1RFKA 3AU4A 4A6QA 1YQ3B 2Y0TA 1XMOM 2RMMA 3CBJA 2DENA 2AYNA 1IY2A 2QSFX 2ACTA 1D0KA 1YLAA 2BJVA 2WHIA 1QOGA 3ZDTA 3O13A 3APCA 2JRHA 3T3OA 1E9MA 2M19A 3NZ3A 2KHHA 2K8HA 2GHUA 2KWUB 3OAWA 3HKPA 2KC1A 3SMPA 1FCCC 1SE2A 5AEKB 3FUVA 3AECB 1TIFA 1WSPA 4BOSC 1D3ZA 3C8YA 3W5VB 4D2KA 4IUMA 3C58A 3BK1A 3AN1A 1N36M 5IT9S 2D3CA 1KFVA 1XCQL 4P1CC 2KZSA 1CV8A 2QEJC 2ONQA 4X6HA 4YYWA 3AEFB 1IFYA 3R7RA 1STFE 3RGSA 4MZOA 4PI3A 1TTNA 3OISA 4ZRQA 3CH3X 2Q2EB 1RLFA 2AWTA 4HLQA 3PSEB 2ZNVB 4BZAA 1FNUA 1E5WA 4DR2M 3K9OB 4XGIA 2GB1A 2G8EA 2WXFA 1TS3A 3CWIA 1HXYD 1PPOA 5LXHA 1TS2A 3RUIB 3O65B 1OIZA 3PNRA 2PJHA 1VDLA 4A90A 1KTKA 1NENB 5FTKA 1IBMM 1V5OA 3QSDA 1GVNA 5FK9C 2DZNB 2FNAA 1ZCMA 3MHZA 4PP1A 1NQCA 3A1QA 1AECA 4GOCA 5JHAA 3AV8A 4RGMA 2VF7A 5EJCA 2L0FA 2K6DB 1J7BA 3DQVA 4OVZB 1G3IA 3K1JA 2RKOA 2N0SB 2BTEA 1VCBA 1I4QA 2R2OA 4WWOA 1IGDA 1I4RA 3K8UA 2ZW1A 1KHPA 3IG8A 2O01F 3HVZA 5J18A 4MH8A 3TRKA 3QYBA 1NY5A 4LG2A 1PPDA 3MHHA 2INPE 4NAWB 3AOEA 2CB5A 2XBBC 3LVWA 1R4NI 2KRKA 2JY8A 3P5WA 3AULA 4NJCA 1Q3CA 1GNUA 2KX3A 2N7JA 4DHZB 1PJIA 2YLMA 2D7GA 1BY8A 2SAKA 3Q3OC 2NTSA 3PHWB 3AEGB 4YWGG 4G3OA 2ZNVC 2DZKA 5L83A 3I01M 4BAXA 1THEA 1TDHA 4AW4A 3GRRA 3IOQA 4DR4M 2XZUA 1XB2B 2NBUA 4BBNF 3DHIC 4YL8A 2V0GA 3HRDD 2ZAMA 2HHHM 1FMAD 1ZMUA 3RVWA 2XK5B 3WAMA 3RNCC 3R66C 3RFWA 4ZYNA 3QYEA 2KFKA 1T6BX 5J94A 2K6QA 2LHEA 4L6V6 3FUXA 1KLGD 2HL7A 3PT2A 4K7SA 1K3XA 2YJCA 2ZBKB 1X37A 4G4OA 4FBJB 4PS3A 3U30A 1MEMA 2DLBA 3EECA 1L2DA 1MI0A 2ERCA 2HJ8A 2RPVA 1C77A 4Q8HA 3JR5A 2C9CA 1P9DU 2MBQA 2WU5B 1G59A 4MM3B 4I04A 2KDMA 1OEYJ 1PFDA 3AE6B 3N1ZC 2QMTA 1PRBA 5IREB 3A4RA 3PHUA 1V9JA 5EF4A 5MPOA 3AB5A 4ZUXU 1WM2A 1MIRA 3MP9A 4KLBA 2D3AA 1L7YA 1ME4A 3J2PB 2J0MA 2LEKA 2J4XA 2LD9A 1C7YA 2MR9A 3HHYA 4NOOB 4R71A 9PAPA 1WJ4A 3AE8B 1CS8A 2L4EA 4BKGA 5IN7A 1SIFA 1WGNA 2WXOA 3AE2B 1JWMD 3WA0A 4P16A 2AYOB 3PVLA 3GPUA 3QHTA 2LXEA 2BYTA 3ILKA 4CZWA 3KVFB 4XDCA 2KN5A 1IY0A 4DUZM 3NVYA 2EUCA 2DZZA 2REXA 1V8CA 4OVUA 2WDRB 1ZGUB 2RR9A 3A9JA 3PBHA 3GZNI 4ZOHC 3OJ4B 4KO8A 2KT7A 2RDHA 3H1UA 3IVFA 3M63B 4K7WA 1S3SA 2D7HA 1E7PB 1E8ZA 3BVZA 3UI3A 1GC7A 1SXJB 1JRPA 2GOWA 4JI7M 2J42A 3VDZA 2Z4RA 4W5WA 2UXCM 1DGJA 4EZJA 2O6VB 4L15A 5C18A 4DV0M 1QVRA 1WGRA 4ANXA 4DMXA 3WALA 2NTTA 3DOWA 2MH7A 1ISNA 4NQKE 4NAMA 2AIMA 5K16A 2IZVB 3OJ3A 1WIAA 2CHQA 5DPSA 1PPPA 2J7QB 1TGZB 3CF2A 3AE3B 1VEGA 5C1ZA 4XZXA 4EIWA 1OAIA 2OJWA 2DHYA 4GMVA 4RH6A 3ZNID 2J53A 4LZJA 4RNAA 2N4FA 4URKA 3D32A 1VR9A 1V33A 1N78A 2E5LM 1YJIA 3L0WB 3TWLA 3DBLI 2OEDA 2JRIB 3EFCA 3R9XB 1L1TA 4TQ1A 4KLNA 3KW6A 2DAIA 3HHAA 3DBRI 1RFAA 4II3B 2PBHA 2MGWA 2R2QA 2L4FA 4ARCA 2OOAA 2LVOA 2PADA 4FIPA 4I07A 1DGGA 2M5ZA 3EGRA 4G11A 3UQAA 3QARA 1N63A 1IBXB 3HWSA 3FTDA 2OQ4A 2ZCBA 3KLSX 1QZMA 4A8XC 5DNYA 4ZYSA 1SXJC 1B9RA 3OF9A 4IIWA 4F1IA 5BR8M 1AYWA 4JWSC 1U4AA 1XNQM 3MC9A 4YYVA 3UJNA 1TZ1A 4C7ZA 4RMAA 1R7SA 4KZ0A 3BBAA 2N35A 1QAMA 5IZ7D 3A1QB 3U6EA 1EWLA 3RZWC 5CHVA 1TL9A 3I4VA 2MA9B 3VK8A 2FBWB 1Q0WB 1I4WA 4ZTBA 1XXHA 1SJHD 5D3IB 2B1MA 1WJUA 1YX5B 1Z5AA 3ZC7B 2ZPYA 2WBFX 2EA0A 1EE8A 5E6JA 5IOIA 3ZLZA 4CDDB 5ITUA 2Z3XA 2R9CA 2WX1A 2INDC 2KRUA 3HX3A 4IBBA 1H8CA 4JXJA 4A20A 3BOSA 1EF5A 1XEEA 4EE2A 2JWSA 3DHGC 1JWSD 2C99A 4LFCM 4ASWC 4II2B 1I35A 2CHGA 2C0YA 1DO0A 3CF0A 4IOIE 2EKFA 2WXJA 2G8JA 4KDLB 5FTMA 2V6ZM 1WYGA 2XU4A 4FD2A 2VH2A 4IM3A 1E6EB 2G6DA 2C7HA 1DF0A 3L08A 4BSQA 5LMUM 2HDEA 2XFSA 1NL6A 3BZDB 4E3CA 2N1VA 3WIMA 4M9SA 2MBHA 3HM6X 5FTNA 2PLPA 3VTUA 1EFUB 2FFJA 2K9XA 2O2VA 4P7IA 3CTWB 2KFKB 1QUSA 4XDDA 1WGYA 3GP1A 4K3BA 4W9KA 3WCQA 3Q8GA 2UYZB 1Y56A 4OELA 2MCNB 1I4XA 1FNWA 3SC3A 1KRHA 4EZLA 4TSSA 2R9MA 4ICUA 2HHNA 2LNHC 4GDLA 3FRHA 1NJGA 4LCBA 4K3CA 3DF0A 1QDRA 4M9ZA 3W1YA 1BT0A 1NB5A 3TL5A 5AUIA 1JQJC 2KNVA 3F5VA 3KQ4A 3KP1E 3AOEC 2WXLA 2F5QA 3BCNA 3MORA 3KWLA 4LFAM 4NQLB 3ML9A 4CYEA 3U6QA 2MX2A 2KAJA 2KDFB 2WLBA 1J7CA 1ZOYB 3WAOA 2C5RA 1G6JA 3NHEB 2VRRB 1L4ZB 1L0YB 5EE9A 3VH3B 4GU2A 4B08A 1P1AA 2QCUA 3HHWA 2DAFA 2KWVB 3H6SA 4K7CA 1CVZA 4G50A 3GO8A 1F77A 2K3UA 2KC2A 2LWPA 2JXTA 1QOLA 3UGJA 2DAJA 1L0XB 4YTMB 2K0BX 4LF7M 2LASA 3OQCA 1TDZA 2NQAA 1IXSA 2DXIA 4GSWA 1L6UA 3GS2A 2Y20A 5EXSA 1C4CA 5BO4B 1N62A 1ACCA 5A24A 3FC4A 3IHPA 1V1PA 4PADA 4QBBA 4YHHM 2L05A 4WURA 2LVNC 2CHXA 3NWLA 4F8CB 5G2NA 1NBFC 1SG9A 2K1FA 1X1MA 4ZRJA 3ZQJA 4JLCA 4OZAA 3A9JB 5IWAM 3U6SA 3OTOM 1WX9A 2VIIA 2ZM6M 4GHLA 1Y08A 3A45A 2JX5A 3T15A 3PDFA 2WS3B 4PS7A 4XWWA 2KEBA 3RNVA 1WF9A 2YEPB 3EIHA 4FWGA 1OKSA 4D8IA 2AUZA 4YYUA 1TBEA 1DGHB 2DAGA 4KHPM 1FIQA 2DYOA 1Q39A 4ANVA 1R5LA 2C96A 1KOTA 4XBOA 4ICVA 2ARYA 2LUMA 3HM3A 1TYGB 3Q8BA 3Q3JA 4FJCA 4WIPA 4L4UA 3IG5A 2LFIA 2JQRB 4W9HA 1YN4A 4W9CA 3I51A 3N9YC 1UWXA 2WXMA 1WY8A 1WJ7A 2CU1A 4LJ8A 4XZ4A 4YYSA 4IW0A 2R18A 3T1HM 2QIEB 3GE3C 3MTVA 5KO3A 3I3TA 1HZ5A 1K50A 2DZIA 5AZHA 2IGHA 4RF1A 2QP9X 2NBVB 2VQEM 2BDLA 2KNAA 1LV7A 4IJEA 2PE6B 3GLHE 3AH7A 2VH1A 1PPNA 3CSFA 2DX5B 3PSEA 1LXDA 1EU4A 2CJNA 3HVDA 3W2DA 4AQ7A 4ZRIA 2KWDA 3K9OA 1K8RB 2GBJA 2B3TA 1UM8A 1EWCA 4N4ZA 2YJBA 3WXEA 4JI6M 3J27B 4PK1A 1TKGA 3U52E 4FADA 3MJ5A 2MBOA 4EUTA 4N79A 3K8ZA 1G41A 5IP4D 1CJLA 4AUQC 3ZDMC 1LFDA 3SMSA 2JUOA 3W5UB 2PW9A 2YNMD 2GBMA 1E7VA 4D8BA 2DZLA 1DOIA 5LLIA 4KODA 4TUWA 4JIOU 1Q1OA 4C4VB 2DOSA 1C79A 3L13A 4X6JA 4W9LA 2JQFR 4XC2A 2DNFA 4QOSA 5PADA 2KVRA 1IBLM 1L8QA 3BXWA 1MPEA 1OFFA 3RFZB 1HQYE 3R8FA 8CATA 4BS5A 4HWIB 5J17A 4AZFA 2MHJA 4HJKA 4AKIA 4AXMA 2Z4SA 4LDTD 1T6OA 2CV0A 2C60A 1XNRM 2N9LA 4QNMA 2NMQA 3AE9B 1FFVA 3BINA 4HEA1 2FO5A 2KHWB 2LVOC 3NS1A 2N9PC 2CP8A 4HEOA 5LMNM 3SBJA 1WRIA 3PHWA 1HZ6A 1F2BA 2DNAA 2IDYA 3GPXA 3UMMA 3DOAA 4LJ7A 3GQ5A 4FULA 4MJSA 4DQOC 4DBGB 1C78A 2IO0B 1M4VA 1NV9A 1HJPA 2LVAA 3LVVA 3GZNB 4XK8F 3K24A 1RAXA 4OU7A 3ZGZA 4B3RM 2L76A 1CQVA 2JYEA 1OQRA 1FEHA 2O2VB 3I57A 4MSXA 4NXNM 4H2AA 2KYWA 4MDKE 5CHVC 2UU9M 3H7PB 2DC8A 2KWCA 3NZSA 3NRZA 3ZTDA 4W5BA 2RGHA 2LVPC 3TMPA 5IO9A 3PZ8A 4GDLB 1BP4A 2I38A 2F7DA 3SAUA 3PS6A 2BVCA 4S0RA 2IY1B 1NY6A 1N60A 3PRPA 1JQPA 1E9SA 1TY0A 2X8XX 4FCTA 4MM3A 3MMPA 4LLGM 3B21A 2OJRA 1WMHA 3HZJA 4NJ7A 3Q2AC 4NJ6A 1E32A 4M8NA 3VK7A 4A3VB 3CH2X 3W68A 2GI9A 3OG5A 4WQMA 5GMVA 1C3TA 2E03A 2CS4A 1SNKA 3KH0A 1SBBB 4LRSA 5JI3E 2I7NA 1HTOA 2L3ZA 3URYA 3ECIA 3MFGA 2DAKA 2Z0EB 1A5RA 2Y5BB 3KXEC 1E0ZA 1KLVA 2K39A 4GLSC 4Z8XA 3DBRB 1FCLA 4MGYE 4IBJA 5BPVA 3RYTA 3VR8B 3BPFA 3JW0X 4RGOS 2APLA 2KOXA 3AU5A 1L4DB 2AYOA 3FUUA 2ZCCA 3ZUAA 1WYWB 3AE4B 1V1PB 3HHIA 4DMYA 1V1OA 1QYRA 3DVGX 1MHXA 2YQZA 2PKOA 1UD7A 4OVVA 3IECA 5C1BA 2P0RA 2ZW0A 4RY2A 1J7KA 2BYFA 2YJ8A 4G3XB 2H7JA 4LZZA 2ASQA 1OQQA 4P17A 2R44A 3NVVA 1A70A 1Q02A 3ERVA 1XC8A 1S3SG 3EUB2 1YVBA 4DR7M 1MDWA 4LNOA 3HJSA 1PJTA 4C80A 3QQ8B 1N32M 2QJLA 4ZRPA 1NI2A 1CTEA 1NYQA 1WGHA 3PZ7A 3TBLD 1L2CA 4FA6A 2AQ3B 3J7AS 3VTVA 2LHGA 2KMMA 1ITOA 1GUAB 4JL9A 4K1RB 2J7QA 4MGKE 2CU3A 4GIVA 3HU1A 2WWZA 3PTFC 3TPZA 1I4HA 4G6ZA 3GQ4A 2KK8A 5EE0A 2BYVE 4BOQA 3D8BA 2G45B 3V6EA 3BY4A 2FIDA 2JRIA 3B89A 3IHPC 5KPZA 3MC0B 2XU1A 4B3SM 3HGIA 1J5EM 3ZXRA 5D6JB 1JR3D 4OEMA 1PGBA 3I3TB 4GDKA 1GKIA 3GRUA 4P6EA 1NEKB 2LVQA 3BVMA 2QHOA 2L6OA 4REZA 1CMXB 2X49A 3Q6BA 1IBXA 3PO0A 2KZRA 3AE1B 2YVCA 4LGYA 2YJ2A 4RGTA 2VHSA 2Y0QA 3W67A 4FLHA 3QAQA 2CV1A 2NCNA 1U9WA 3QWZB 4GRIA 1CQDA 3HWNA 3C3DA 1IN6A 2C5LC 2G8LA 5CHFA 5F02A 4DV5M 2E3TA 4GKJM 3C9EA 3TEZA 2V1UA 2FAZA 2IPPB 4LJOB 4RF0A 4YYQA 3NY5A 1AARA 2JSVX 3T1YM 3DVNU 1GAQB 1J0GA 3CF6E 5EZSA 2MBEA 3V61A 3ZW3A 4IM0A 5HKHA 5E26A 4BLCA 1FNNA 2J7NA 2JVCA 2BT6A 1KF6B 2OPFA 2K8CA 3EHVA 2G5GX 2M60A 3OVZA 3MK6A 1IY1A 3UF8A 3QWLA 4BKSD 2JXNA 3KSJA 1WGLA 2XU5A 1XWIA 4G54A 4S17A 2OZ2A 3S3RA 3UIOB 2M4NA 1J09A 1OGWA 1RM6C 4WW0A 3DCGA 3MP2A 1WZ3A 4MH0E 2IBIA 4ITKA 4RM9A 4DR6M 1ZAEA 1XQQA 4Q8GA 2ICIA 1FPYA 3PW3A 1QF6A 4CDCB 2MRPA 4K7UA 1ME3A 1SP4B 2K47A 3UQBA 2BNKA
chains in the Genus database with same CATH topology
4JX1C 2L83A 4NRWA 3R2IA 1FD6A 1YMHE 1FJGM 4B7GA 2JWUA 2XNAC 2PTLA 4BB9A 4FCWA 1D2NA 2XEPA 3SR6A 1E10A 1DGBA 1P7FA 4IJFA 3PXGA 4AKHA 3SFZA 1L6VA 2LGIA 2K5PA 2WU2B 1XLOA 1NHGC 3Q8XA 1K53A 3GRVA 2BU3A 3IFUA 1C76A 3DA1A 1Q10A 1NHWC 2F5PA 2Y5CA 1L1ZA 2R4JA 4IBDA 2DYMA 4MT5A 3LB8C 4IKGA 1I4PA 3FYCA 5BYQA 2DWQA 5KPTA 2R62A 1I7HA 4K0KM 4ZHPA 1SE4A 4Z6YA 2AGAA 1K52A 1EWYC 4A9AA 3GLHB 2F5NA 2ACZB 4KGRA 1QANA 1VZ8A 4RFBA 3IT6B 2DZOB 1SB3C 3B9PA 2LHDA 1MVKA 1XHBA 2L1AA 3U6CA 1UNSA 4J3OD 4DR5M 1GB4A 1SIJA 2WXIA 1GPXA 3KP0E 4II7A 3RE8A 1NI3A 2XF3A 4YY3M 4D8EA 2XGNA 1DGHA 4MACA 1CJEA 1JCKB 2QENA 5JXVA 4AQYM 3L2AA 1NVMA 4JI4M 3RPFC 2VZKD 1SSNA 3CIRB 3FAHA 1PYWD 3P4PB 3SFEB 3FKEA 3AV0A 1T5XD 1IXRC 4X66M 3BK2A 4PT5A 3KS8A 3L27A 3BWUD 4OW0A 3TUOA 1N5WA 5EP2A 4HKZE 2Z84A 4X64M 4GDKB 3EIEA 4BBAA 5A2QS 1ZP0B 3T3NA 2H89B 4ITQA 3SHGB 2P5TA 2CE7A 4ZHOA 1NJFA 1ET6A 5ITQA 3AEBB 1GL6A 1ET9A 4LJ5A 5GXGB 4QHSA 2WXHA 4BOUA 2W54A 3B2GA 2KQ4X 2J7QC 3VFDA 4HRSA 2V1CA 2Y5PA 5EXTA 4JN6A 2WXNA 3OWEB 2BS3B 3SHFA 4PDGA 3FUTA 4NZLB 5EXXA 1ROEA 3K2LA 2QSDA 4OX9M 4S12A 4FWHA 3KWVA 3W9CB 4DV6M 3TEWA 3L25A 3ZJVA 3EA6A 4LJ4A 1K51A 2WDQB 3KOXE 1JWBD 4L16A 4RGNA 3U60B 2DWLA 3FTFA 2F5SA 2HCBA 3TL4X 1YUBA 2KXEA 2XSZA 1ZDXA 1F2RI 3KOZE 1HEZE 2L09A 1CK1A 1N34M 5EP4A 2LH0A 5EE1A 1GOZA 3H4MA 4R3DA 3AE5B 4B7FA 4LF5M 5I4DA 3IT4B 3PNVA 2R45A 1PJJA 3HU3A 1EU3A 5HI1A 3TE6A 1V97A 3VRAB 1VZ7A 3ZJTA 4IDIA 4N58A 1CZPA 3AKZA 3SYLA 3BYTB 1LO5D 1VZ6A 3TWKA 3Q69A 3VQIA 3AEAB 3UZUA 1HNWM 2IJ0A 5FR3A 5H8YE 4B0EA 4HKQA 1XLNA 4LJAA 2BBCA 3AM9A 3W1SA 3SARA 3SAWA 2X38A 2W3RA 3I9V1 2W82A 1T3TA 3HU2A 3NVZA 3U4EG 3U2SC 2R46A 1JQ4A 1QT9A 1BUIC 1PM5A 2H1RA 5TSSA 3U6LA 3PHXA 2M56B 4JYAM 1HR0M 2A5YB 4JV5M 1BMLC 3FUWA 1DYQA 3KVWA 1H6UA 5FLXS 2WXGA 4PDIA 2F5OA 4YXDB 1SXTA 2CJOA 1Z5CA 1YN5A 2D7EA 1UWMA 3DZDA 2EELA 3ZCBB 1BXTA 5G5GA 4LJ9A 1MHHE 2ZANA 4DV3M 1JROA 1IQPA 2L7HA 2J7OA 3R8BA 4RKXA 1P7EA 2BJWA 4BOZA 1IN5A 2C9OA 4IBCA 2UUAM 5D3DA 1N5XA 1YJJA 4G4NA 1Z5BA 3BB7A 4TQ0A 3U6OA 5FTJA 2TSSA 4DV2M 1WGKA 3P42A 3PFIA 3HJQA 5BYRA 3ZYYX 1HNZM 1PGAA 3GLFB 3P63A 3V05A 4DR1M 5D7GA 4CHTB 3H8HA 5EXPA 1ENFA 1PGXA 1NSFA 4CQNA 1SXJD 4FVMA 5ITYA 4GKKM 4X62M 3KOWE 3AEDB 1DGFA 3SATA 3BIID 4LTUA 1L0VB 5G5HA 4ARIA 3M6AA 3NBIA 4D81A 1VRAB 4NXMM 1IM2A 1FRRA 1C1KA 1STEA 5KPRA 1SF0A 4US9A 1D4BA 4YSZB 4P6VF 1QLBB 2HTME 2PIAA 3I4YA 2UZJA 5JZEA 4HROA 2XH9A 3TSSA 4A55A 3GLHA 1OJLA 2OHFA 2QILA 4DV1M 3GLGA 1YQ4B 3E4RA 2JZPA 3GP7A 3U5ZA 2H88B 4NRVA 2ON8A 3J9CA 4N59A 2R65A 7CATA 1QKZA 1GB1A 2XLJA 5FSWA 4L78A 4AG5A 1QOFA 2BS2B 1GL7A 1MU5A 1L2BA 1IN7A 1TKYA 2R61A 3DFZA 3KS4A 4JWUC 2WXQA 3U6MA 4LF4M 1XO3A 2BTWB 2BW2A 1UKFA 3J80S 3M0EA 4TMAB 1J7AA 3TEXA 2QPAA 3GLIB 3TWMA 1SEBD 2WXRA 4YSXB 1IUEA 1NVID 3AEEB 1E9RA 1TH3A 4JI5M 2K22A 3E9SA 1IN8A 1SJED 1ZDVA 2L32A 2SEBD 4NSOB 5KQ8A 3AL0C 1FFUA 1WWTA 2G1EA 1AYFA 3ZJUA 2W55A 3AFHA 1XLPA 5ITRA 2XFTA 2RDGA 3J81S 2F4VM 2LJIA 1HQCA 4OZBA 3U61B 3Q8CA 2KN4A 4KKJA 4NL4H 2AHMA 2JA2A 3FTCA 4MGIE 2UXBM 3M7GA 4O1NA 4FWDA 2I2YA 2LWXA 4LRTA 4YT0B 1YZBA 1FNVA 4IBGA 1HNXM 4OHJA 4AS1A 1D5XC 4GUAA 5EP1A 5HG2A 4WH4A 3C0RA 1YSYA 4GHAA 3VRBB 4JPSA 4I8OA 3R2TA 1D5MC 4LFBM 5HFYA 2XN9C 2L52A 2DBYA 1F2RC 3Q8FA 3ETRA 1PVJA 1OFHA 3A98B 2DHRA 5BMIA 4UDUC 3U60A 1N33M 3PNYA 3W31A 4D80A 4CGYB 3VDUA 4MI7A 2AX5A 4DV4M 2BS4B 3LQRA 1F0ZA 3B9JA 3L26A 4GH9A 4US8A 1IGCA 2ZAOA 5C3JB 3FYDA 3LQQA 5FKAC 1DKIA 2KA6B 2E6XA 5FTLA 2VQFM 2WQYB 4IBIA 1JR3A 4IBEA 1DOYA 1RWSA 3A42A 2NQ8C 3P4SB 2RGOA 2PVOD 5H37D 3LXFA 3ZQ4A 2WDVB 3BYYB 1QQWA 2AQ2B 2CUZA 1JALA 4B0MA 3GLGB 4B3TM 1HA5A 1TKEA 1FRDA 3U5ZB 1YNTE 3BVGA 2YFQA 2V3PA 4KGTA 4LK0M 1G8PA 1QILA 3P4RB 5C2TB 2WXKA 4DXFA 2WP9B 3VKHA 4L8RC 4NSRA 1UGJA 2N9KA 3FILA 4L2YA 1TH4A 2EO2A 1IN4A 1TH2A 3FD9A 4ZPXA 1VDVA 1OFIA 3IAM1 2FUG1 4FXCA 5EE3A 1R6BX 1L5PA 1KH0A 1RYJA 2IPKD 3A46A 1TJEA 4JI8M 4I5SA 2UUCM 2QBYA 4QNRA 3U6DA 3DWGC 2Z8LA 2XSZD 4JE3B 1W5TA 3VLFB 1C9FA 2I7PA 1G4AE 2KACA 4XE0A 3KOYE 3AE7B 1WXQA 3E56A 4LGMA 3L4PA 4I81A 2UUBM 3NUHB 5GKNA 2QZ4A 1TY2A 1FM0D 1R7RA 1FXAA 3L29A 1C4AA 1VJKA 4B3MM 2CV2A 2DWMA 2LMCA 3IXSA 3SASA 4C7YA 4KX6B 1ZQ9A 4DV7M 4MGZE 1ZUD2 1QAQA 1JWAD 5BMHA 3KFUG 1N75A 3P1MA 3W0LB 2C98A 2PVGC 1DO2A 1IXZA 4GIPA 2R4EA 3GLFA 5DYIA 3MHVC 3GPYA 2MEKA 3LYYA 2MJDA 2FOIC 1VDDA 2BB6A 4IBKA 5ITTA 3NVWA 4DXGA 4BOPA 2MJ3A 4IBFA 4AKGA 3PRMA 2O5RA 2KZUA 2JTCA 4DUYM 1HQRD 3WHKA 3AMZA 1JW9D 3U6PA 3TQSA 2V4IB 5BMGA 3P4QB 3UK6A 1NYRA 1ZE3D 4OZCA 2B76B 2FE8A 1C4PA 4QOZC 1UUPA 1FXIA 2WXPA 4N6EB 3Q8AA 2D5GA 1XF5L 4WAFA 1E94E 1MX0A 3VR9B 1DOXA 3SYKA 2AQ1B 1TS4A 1XMQM 2IGDA 2Y3AA 2K0PA 3LMMA 4L1BA 4YTPB 1D5ZC 2W3SA 1TGUA 5EQTA 3ZH9B 4KGSA 3SFDB 3L28A 1PDXA 4A5UA 4G4QA 3VDPA 4L23A 2G9HD 1ESFA 2J52A 5F3WA 4G4RA 2Q5WD 1FO4A 1QOBA 1GLNA 3B2FA 4JI2M 4X65M 2YR0A 2DWZB 4PD2A 4BOSA 4XWTA 2UXDM 1KYIA 2L7IA 3FILB 4GITA 4M0WA 4KKIA 2BTWA 1K82A 4B7HA 2YEPF 3RGPA 4YSYB 1IBKM 3GLIA 2QBYB 4GC9A 1YE9A 5T8IA 1JWUD 3TEYA 1N77A 1VLBA 4Q2JA 1I4GA 3W0FA 3U7ZA 2CEAA 1Q3BA 4GC5A 2JU6X 2GRIA 2CHVA 3VKGA 4R7GA 4D82A 1JMLA 1HT1E 4LF9M 4JI0M 3FTEA 1KFYB 3DWMA 3U61A 1EM7A 3AJIB 4AI6A 4MB7A 3AOGA 4USAA 4HXDB 1R2ZA 3ZNHA 2Z7JA 3IAS1 4JI1M 2HKJA 2JYTA 1QAOA 5ITXE 1KLUD 5DYGA 1KSFX 2BB5A 1ZXHA 1W5SA 4HL4A 5AUKA 3JAMS 3HUIA 1B1ZA 3O65A 4QHTA 1NNUC 4WWMA 3WHLA 4RCOA 4LY6A 1SXJE 3D8LA 1ZXIA 2DWNA 4OVZA 4MGHA 1XXHB 2X8AA 3QAUA 3W30A 3SEBA 1N61A 4LF8M 2PMVA 4IP3A 4I4LA 4JI3M 3V3XA 1NNJA 1I94M 1XXGA 4M9XA 2KW0A 3HJ8A 5BYSA 2VZKB 3GB1A 3Q8EA 4FCVA 4FW9A 3T38A 2V3NA 3GQ3A 4CISA 5EP3A 5EZQA 1SE3A 4PCZA 2X4AA 1Z59A 4M0DA 1XLQA 2MJEA 4HJGE 1R2YA 1AN8A 2IGGA 4AG6A 5LNK1 3SAVA 2XZFA 5H92C 3GRYA 1ORYB 2INNE 1TS5A 4GMQA 3JR4A 3GPPA 3THGA 2WNMA 5JI2E 4LF6M 1T3QA 1K3WA 3HHZA 1QOAA 2CFOA 3HHXA 2HWKA 3KSXA 2EKIA 1PUTA 5ITXA 5KQDA 1D6EC 4YTNB 4C56C 1IXSB 3J7BA 1YN3A 3KDSE 4LJ6A 1AW7A 1AWDA 2Y21A 2DVWB 3ABVB 2M0AA 1Z6TA 1QQRA 1XCTL 1SXJA 5HHDG 3K92A 1HT2E 1ZPSA 3PVSA 1TZOA 4DR3M 1RFKA 4A6QA 1YQ3B 2Y0TA 1XMOM 2RMMA 1IY2A 2BJVA 1QOGA 3O13A 3T3OA 1E9MA 2M19A 3NZ3A 3HKPA 3SMPA 1FCCC 1SE2A 3FUVA 3AECB 1WSPA 3C8YA 3W5VB 4D2KA 4IUMA 3C58A 3BK1A 3AN1A 1N36M 5IT9S 1KFVA 1XCQL 2KZSA 2QEJC 2ONQA 3AEFB 3RGSA 4ZRQA 2Q2EB 4HLQA 1FNUA 4DR2M 4XGIA 2GB1A 2WXFA 1TS3A 3CWIA 1HXYD 1TS2A 4A90A 1KTKA 5FTKA 1IBMM 1NENB 1GVNA 5FK9C 2DZNB 2FNAA 3MHZA 3AV8A 4RGMA 5EJCA 1J7BA 2BTEA 4OVZB 1G3IA 3K1JA 2RKOA 2N0SB 1I4QA 1IGDA 1I4RA 2ZW1A 3IG8A 3HVZA 3TRKA 4MH8A 1NY5A 4LG2A 2INPE 4NAWB 3AOEA 3LVWA 2KRKA 4NJCA 1Q3CA 2N7JA 1PJIA 2D7GA 2SAKA 2NTSA 3AEGB 4YWGG 1TDHA 4AW4A 3GRRA 4DR4M 2XZUA 2V0GA 3HRDD 2ZAMA 2HHHM 1FMAD 3RFWA 1T6BX 2LHEA 3FUXA 1KLGD 2HL7A 3PT2A 1K3XA 2ZBKB 1X37A 4G4OA 2DLBA 1L2DA 1MI0A 2ERCA 2RPVA 1C77A 3JR5A 2C9CA 2WU5B 1G59A 4MM3B 2KDMA 1PFDA 3AE6B 2QMTA 5IREB 3PHUA 5MPOA 3AB5A 3MP9A 3J2PB 2LEKA 2J4XA 3HHYA 4NOOB 3AE8B 2WXOA 3AE2B 1JWMD 4P16A 3GPUA 2LXEA 2BYTA 3ILKA 4XDCA 1IY0A 4DUZM 3NVYA 2EUCA 1V8CA 2WDRB 4ZOHC 4KO8A 2RDHA 1S3SA 2D7HA 1E7PB 3BVZA 3UI3A 1SXJB 1JRPA 4JI7M 2J42A 2Z4RA 4W5WA 2UXCM 1DGJA 4L15A 5C18A 4DV0M 1QVRA 2NTTA 2MH7A 4NAMA 2CHQA 3CF2A 3AE3B 4XZXA 4EIWA 4RH6A 2J53A 4LZJA 4RNAA 1VR9A 1N78A 1YJIA 2E5LM 3TWLA 2OEDA 3R9XB 1L1TA 4TQ1A 4KLNA 3KW6A 4ARCA 3EGRA 2M5ZA 1DGGA 1N63A 1IBXB 3HWSA 3FTDA 2OQ4A 3KLSX 4A8XC 1QZMA 4ZYSA 5DNYA 1B9RA 1SXJC 4IIWA 5BR8M 4JWSC 1XNQM 3UJNA 4C7ZA 1R7SA 3BBAA 1QAMA 5IZ7D 3U6EA 3I4VA 3VK8A 2FBWB 1I4WA 4ZTBA 1XXHA 1SJHD 5D3IB 1Z5AA 3ZC7B 2EA0A 1EE8A 5E6JA 5ITUA 2Z3XA 2KRUA 4IBBA 4JXJA 3BOSA 1XEEA 4EE2A 1JWSD 2C99A 4LFCM 2CHGA 1DO0A 3CF0A 4IOIE 2WXJA 5FTMA 2V6ZM 1WYGA 4FD2A 1E6EB 5LMUM 2HDEA 2XFSA 3BZDB 4M9SA 5FTNA 2PLPA 2FFJA 2K9XA 3CTWB 4XDDA 3GP1A 3WCQA 1Y56A 1I4XA 1FNWA 3SC3A 1KRHA 4TSSA 2LNHC 1NJGA 4LCBA 4M9ZA 5AUIA 1JQJC 3KQ4A 3KP1E 3AOEC 2WXLA 2F5QA 3KWLA 4LFAM 3U6QA 2KAJA 2WLBA 1J7CA 1ZOYB 2C5RA 1L4ZB 1L0YB 4B08A 2QCUA 3HHWA 3GO8A 1F77A 2K3UA 2JXTA 3UGJA 1L0XB 4YTMB 4LF7M 3OQCA 1TDZA 2DXIA 1L6UA 3GS2A 2Y20A 5EXSA 1C4CA 1N62A 1ACCA 3FC4A 1V1PA 4YHHM 4WURA 3NWLA 4OZAA 5IWAM 3U6SA 3OTOM 2VIIA 2ZM6M 4GHLA 3A45A 2JX5A 3T15A 2WS3B 4XWWA 2KEBA 3RNVA 2YEPB 3EIHA 4FWGA 4D8IA 1DGHB 4KHPM 1FIQA 2DYOA 1Q39A 2C96A 4XBOA 2LUMA 1TYGB 3Q8BA 4WIPA 4L4UA 3IG5A 2LFIA 2JQRB 1YN4A 3I51A 3N9YC 1UWXA 2WXMA 4LJ8A 2R18A 3T1HM 2QIEB 3MTVA 5KO3A 1HZ5A 1K50A 2IGHA 4RF1A 2QP9X 2VQEM 1LV7A 4IJEA 3AH7A 3PSEA 1EU4A 2CJNA 3HVDA 3W2DA 4AQ7A 2KWDA 1UM8A 1EWCA 4JI6M 3J27B 1TKGA 3U52E 3MJ5A 3K8ZA 1G41A 3SMSA 3W5UB 2PW9A 2YNMD 4D8BA 1DOIA 4KODA 4TUWA 2DOSA 1C79A 4QOSA 1IBLM 1L8QA 1MPEA 1OFFA 3RFZB 1HQYE 3R8FA 8CATA 4AZFA 4AKIA 2Z4SA 2CV0A 2N9LA 1XNRM 3AE9B 4QNMA 2NMQA 4HEA1 1FFVA 5EE9A 3NS1A 5LMNM 3SBJA 1WRIA 3PHWA 1HZ6A 2IDYA 3GPXA 3UMMA 3DOAA 4LJ7A 3GQ5A 4DQOC 1C78A 1M4VA 3LVVA 4OU7A 3ZGZA 4B3RM 1CQVA 2JYEA 1OQRA 1FEHA 3I57A 4NXNM 4H2AA 2UU9M 3NRZA 3TMPA 2RGHA 3PZ8A 4GDLB 2I38A 3SAUA 1NY6A 1N60A 3PRPA 1E9SA 1TY0A 4FCTA 4LLGM 3B21A 1E32A 3VK7A 4A3VB 2GI9A 4WQMA 1SBBB 4LRSA 5JI3E 2I7NA 3URYA 3MFGA 1E0ZA 3KXEC 4GLSC 4Z8XA 1FCLA 4MGYE 4IBJA 5BPVA 3VR8B 4RGOS 1L4DB 3FUUA 3AE4B 1V1PB 1V1OA 1QYRA 1MHXA 2YQZA 2PKOA 5C1BA 2ZW0A 1J7KA 4LZZA 1OQQA 3NVVA 1A70A 1XC8A 3EUB2 4DR7M 3HJSA 4C80A 1N32M 2QJLA 4ZRPA 1NYQA 3PZ7A 1L2CA 2AQ3B 3J7AS 2KMMA 2J7QA 4MGKE 2CU3A 3HU1A 3TPZA 1I4HA 4G6ZA 3GQ4A 5EE0A 4BOQA 3D8BA 3BY4A 2JRIA 3MC0B 5KPZA 4B3SM 3HGIA 1J5EM 1JR3D 1PGBA 1GKIA 3GRUA 1NEKB 3BVMA 2L6OA 4REZA 2X49A 1IBXA 3PO0A 3AE1B 4LGYA 4RGTA 2Y0QA 2CV1A 4GRIA 1IN6A 2G8LA 4DV5M 2E3TA 4GKJM 3TEZA 2V1UA 4RF0A 2JSVX 3T1YM 1GAQB 3CF6E 5EZSA 5E26A 4BLCA 1FNNA 2J7NA 2BT6A 2OPFA 1KF6B 2G5GX 2M60A 3MK6A 1IY1A 3QWLA 3KSJA 1XWIA 1J09A 1RM6C 4WW0A 3MP2A 4MH0E 4ITKA 4DR6M 1ZAEA 2ICIA 1QF6A 2K47A 2BNKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OVZ B;  4REZ A;  2FE8 A;  4RNA A;  5E6J A;  4P16 A;  3E9S A;  4PT5 A;  4MM3 B;  4OW0 A;  3MJ5 A;  4RF0 A;  4M0W A;  3MP2 A;  5KO3 A;  4WUR A;  4RF1 A;  4R3D A;  4OVZ A; 
#chains in the Genus database with same CATH topology
 3DBH B;  2A5U A;  4JX1 C;  4ANR A;  1ICF A;  2L83 A;  1F4I A;  3UIP B;  4ANW A;  4NRW A;  3QCA A;  1P3Q U;  3R2I A;  1FD6 A;  5IA7 A;  1YMH E;  3M62 B;  4J6I A;  4MJS B;  1FJG M;  1VSN A;  4B7G A;  2JWU A;  2KJH B;  2XNA C;  1WIV A;  2PTL A;  1NPZ A;  1PJS A;  4FCW A;  4BB9 A;  2Z0D B;  1D2N A;  2XEP A;  3SR6 A;  4BPV A;  3N30 A;  1E10 A;  3MTN A;  3Q3N C;  1DGB A;  1P7F A;  1M94 A;  2BWF A;  1NV8 A;  3WAN A;  4IJF A;  5JHB A;  3PXG A;  4AKH A;  3SFZ A;  1L6V A;  2LGI A;  5CX3 A;  2V4L A;  4WJO A;  3TMP B;  4X6I A;  2K5P A;  2WU2 B;  5DPR A;  2BYE A;  4YVA A;  1XLO A;  1NHG C;  3Q8X A;  1K53 A;  3GRV A;  2DHZ A;  3APD A;  1PJQ A;  3QX1 A;  1BGO A;  2BU3 A;  3IFU A;  1C76 A;  3B7Z A;  2KD0 A;  3DA1 A;  1J19 A;  2FIF A;  3PRP B;  2QCZ A;  4W9G A;  2ATO A;  1WRD B;  1Q10 A;  2FCQ A;  2LTU A;  2K25 A;  4Q7J A;  2INC C;  1NHW C;  4GEW A;  5L8R F;  2F5P A;  1EO6 A;  1WMH B;  2R0I A;  5FPW A;  2Y5C A;  3OLM D;  1L1Z A;  2R4J A;  4IBD A;  1V2Y A;  2DYM A;  2HE7 A;  2MSE D;  3KYD D;  4MT5 A;  2Y6E A;  3LB8 C;  4LNI A;  4IKG A;  1I4P A;  3FYC A;  4WJP A;  3NHE A;  1WGG A;  5BYQ A;  2DWQ A;  5KPT A;  4MZS A;  2R62 A;  1I7H A;  5JH5 C;  4K0K M;  4ZHP A;  1SE4 A;  4Z6Y A;  2AGA A;  2GLS A;  2UU7 A;  3GLF E;  1EWY C;  1K52 A;  2LRW A;  2D10 A;  1NLJ A;  1AU3 A;  4AXL A;  4A9A A;  3GLH B;  3NZU A;  4N8W A;  4JQW C;  2BPS A;  2F5N A;  2ACZ B;  2N9E B;  2RGF A;  4KGR A;  1QAN A;  1VZ8 A;  3E21 A;  4RFB A;  1WJN A;  2DZO B;  3IT6 B;  3ZNG C;  3HK0 A;  1SB3 C;  2PEA A;  3B9P A;  2LHD A;  1MVK A;  4BBN C;  4DWF A;  2CWB A;  2LI5 A;  1XHB A;  2L1A A;  2KLC A;  3U6C A;  1UNS A;  3B7Q A;  4J3O D;  2KMA A;  4DR5 M;  1GB4 A;  4BKT A;  1WM3 A;  1SIJ A;  2WXI A;  1JRU A;  2CHZ A;  3NG0 A;  2KQ7 A;  1GPX A;  3KP0 E;  4II7 A;  4HDO A;  3RE8 A;  1NI3 A;  2XF3 A;  3I04 M;  4W9E A;  3ZKJ C;  4YY3 M;  4D8E A;  2L8J A;  2XGN A;  3N32 A;  3U8Z A;  5J2R A;  3Q14 C;  3IMA A;  1DGH A;  4MAC A;  1CJE A;  1JCK B;  2DCA A;  2QEN A;  5JXV A;  3T9L A;  4AQY M;  1CB5 A;  3L2A A;  1NVM A;  1T0R C;  4JI4 M;  1HE8 A;  2RRU A;  2VZK D;  1SSN A;  3CIR B;  3RPF C;  3FAH A;  2R9N A;  1PYW D;  3P4P B;  1OQY A;  2ZPN A;  1GJT A;  3FKE A;  3SFE B;  3AV0 A;  2K8B A;  1WGD A;  1AU4 A;  1T5X D;  1IXR C;  4X66 M;  2JT4 B;  4FK5 A;  3BK2 A;  4TV3 A;  3PRZ A;  4LCD E;  4PT5 A;  3KS8 A;  3SDL C;  4HPP A;  3L27 A;  3BWU D;  4OW0 A;  3TUO A;  1N5W A;  3V6E B;  4I6L B;  3BY4 B;  5EP2 A;  2KVZ A;  4HKZ E;  4IG7 B;  4KVG B;  5FR6 A;  2Z84 A;  4X64 M;  4GDK B;  4LJP B;  3MJW A;  2VHF A;  2KDE B;  3EIE A;  4BBA A;  4FJZ A;  2QHO B;  5A2Q S;  2GBN A;  1EF7 A;  4CJ6 A;  1ZP0 B;  3I5J C;  3KWB X;  3T3N A;  2H89 B;  3PLV A;  4ITQ A;  3SHG B;  5AZF A;  1F52 A;  2P5T A;  2CE7 A;  4ZHO A;  2DCC A;  3KSE A;  1NJF A;  1ET6 A;  1WX8 A;  1V34 A;  3L10 B;  5ITQ A;  3AEB B;  4PYU A;  1GL6 A;  2LGD A;  1ET9 A;  4LJ5 A;  4KSL C;  5GXG B;  4QHS A;  4FJV B;  3KX1 A;  2WXH A;  4BOU A;  2W54 A;  3B2G A;  3I06 A;  2KQ4 X;  2J7Q C;  3VFD A;  4HRS A;  2V1C A;  2Y5P A;  4C4V A;  3H8B A;  3O1G A;  2D07 B;  5EXT A;  4JN6 A;  2WXN A;  3C19 A;  2XU3 A;  3Q3F A;  3OWE B;  2BS3 B;  2JWZ A;  3SHF A;  1IYF A;  4PDG A;  2MJ5 B;  3FUT A;  3TNX A;  4NZL B;  5EXX A;  1ROE A;  3K2L A;  3GLI E;  3UIN B;  3QC8 B;  2QSD A;  2CRU A;  4OX9 M;  3BBZ A;  2IBI B;  3ALB A;  1TU6 A;  4S12 A;  4FWH A;  3KWV A;  3W9C B;  4DV6 M;  3E1Z B;  4YV8 A;  3TEW A;  4MSQ B;  2IO3 B;  3L25 A;  1WE7 A;  3ZJV A;  4C00 A;  2DI0 A;  4QAY A;  4IC7 B;  2D11 A;  3EA6 A;  4LJ4 A;  1K51 A;  2WDQ B;  5G55 A;  3KOX E;  3KUC B;  4KSK C;  1JWB D;  4RKU F;  1Y4H A;  4L16 A;  4RGN A;  3VUW A;  3U60 B;  4DBG A;  2DWL A;  1OIP A;  3FTF A;  1J8C A;  2F5S A;  2HCB A;  3TL4 X;  1YUB A;  2KXE A;  2XSZ A;  2KO3 A;  2NR2 A;  1F2C A;  1ZDX A;  1F2R I;  2Z59 B;  3KOZ E;  1HEZ E;  2N9X A;  2L09 A;  4FHJ A;  2FCM A;  3MTN B;  1CK1 A;  1N34 M;  3T6P A;  5EP4 A;  2LH0 A;  1OAO C;  2LJ5 A;  5EE1 A;  3USV A;  1GOZ A;  3H4M A;  4R3D A;  3VVW B;  2FT2 A;  3AE5 B;  3H7P A;  4B7F A;  2N7E A;  3RUL A;  4LF5 M;  5I4D A;  3IT4 B;  3PNV A;  2R45 A;  1PJJ A;  3HU3 A;  1EU3 A;  5HI1 A;  3TE6 A;  4IWP A;  1V97 A;  3C9P A;  3VRA B;  3QA8 A;  1VZ7 A;  3ZJT A;  2JZ3 B;  4IDI A;  4F1S A;  3D6S A;  2KLG A;  4N58 A;  3JVZ X;  4PYZ A;  5TR5 A;  5DFL A;  2M0X A;  1CUK A;  1CZP A;  2BF8 B;  3AKZ A;  3SYL A;  2DC9 A;  2KTF A;  4PS8 A;  3HD3 A;  3A33 B;  3BYT B;  2Y5B A;  2LZ6 A;  1LO5 D;  4JGH B;  3RVX A;  1VZ6 A;  1LQB A;  1TR8 A;  2WGS A;  3GOE A;  3TWK A;  3Q69 A;  3VQI A;  1AU2 A;  3AEA B;  4I05 A;  1PXV A;  4DXA B;  3UZU A;  1HNW M;  2IJ0 A;  5FR3 A;  5H8Y E;  1S1Q B;  4I6N B;  4B0E A;  4HKQ A;  1XLN A;  2O6X A;  3IUT A;  4F2L A;  4LJA A;  2BBC A;  3DBH I;  3AM9 A;  3W1S A;  3SAR A;  3SAW A;  2X38 A;  2EJS A;  2JZZ A;  1YJ1 A;  3IBE A;  2W3R A;  3I9V 1;  2W82 A;  1T3T A;  3HU2 A;  1PQS A;  3NVZ A;  3QJZ A;  3U4E G;  4MSM B;  3LFY A;  3U2S C;  3F92 A;  2R46 A;  1OTR A;  3H7S A;  4KDI C;  2KJR A;  1JQ4 A;  1QT9 A;  1BUI C;  1PM5 A;  2H1R A;  5TSS A;  5CVM A;  3U6L A;  1ZMV A;  3PHX A;  2M56 B;  4KZC A;  4JYA M;  3H8C A;  1PGY A;  1HR0 M;  2AL3 A;  1MHW A;  2A5Y B;  4JV5 M;  4NC6 A;  4XR7 A;  1BML C;  3FUW A;  1DYQ A;  2G4D B;  2J0K A;  3PPA A;  5JH3 A;  3KVW A;  1H6U A;  1R4G A;  5FLX S;  2WXG A;  4PDI A;  2F5O A;  1FXT B;  4YXD B;  1SXT A;  2CJO A;  1Z5C A;  1YN5 A;  3H7D A;  2JQG R;  2D7E A;  1YQB A;  5EDS A;  1UWM A;  3N3K B;  1E90 A;  2LXC A;  3DZD A;  1MFW A;  2EEL A;  2EMT A;  3ZCB B;  2DC7 A;  3LJ3 A;  1BXT A;  2RPQ A;  3GLG E;  5G5G A;  4LJ9 A;  4DDG D;  1MHH E;  5C23 A;  4AJY B;  3N1Y C;  2FTD A;  2GMI C;  3B0A A;  2ZAN A;  3SHQ A;  4DV3 M;  3H4J A;  1JRO A;  1IQP A;  3A4S C;  4NY0 A;  3ZUN A;  1N6Z A;  2QDF A;  1O0E A;  1ATK A;  2L7H A;  3P5V A;  2J7O A;  3FKY A;  3R8B A;  3KUD B;  4RKX A;  3N20 C;  1P7E A;  4EZK A;  1V92 A;  2BJW A;  4BOZ A;  1GC6 A;  1IN5 A;  2C9O A;  4IBC A;  2UUA M;  4W4U A;  3OF8 A;  4F7Z A;  4HPL B;  2QC8 A;  2FH0 A;  2E01 A;  5D3D A;  1HUC B;  2FRQ A;  3B74 A;  1N5X A;  1YJJ A;  4XGA B;  3AI5 A;  4G4N A;  1Z5B A;  3BB7 A;  2KJ6 A;  4TQ0 A;  3A9K A;  3U6O A;  3B7N A;  5FTJ A;  2TSS A;  2GNO A;  4DV2 M;  1WGK A;  3P42 A;  1P98 A;  3PFI A;  1YX6 B;  3ZO5 B;  3HJQ A;  5BYR A;  4A3P A;  1X9Y A;  3ZYY X;  1A5T A;  1HNZ M;  1PGA A;  4UN2 B;  1UF0 A;  4GGQ A;  4WQO B;  3GLF B;  1K3B B;  3P63 A;  3V05 A;  4DR1 M;  5D7G A;  3M99 A;  4QH6 A;  4CHT B;  3H8H A;  1YD8 U;  5EXP A;  3WAP A;  4P6G A;  2C7M B;  1ENF A;  5D94 A;  1PGX A;  1NSF A;  4CQN A;  1SXJ D;  1WXV A;  3PZD A;  4FVM A;  5ITY A;  4GKK M;  3PRM B;  2R6N A;  4BS6 A;  1CPJ A;  2J5Y A;  2O6V D;  4X62 M;  2I1J A;  1WXM A;  4QRG A;  3AXC A;  3KOW E;  3AED B;  1DGF A;  4A3O A;  1UEL A;  3SAT A;  1VEK A;  3BII D;  2DC6 A;  4LTU A;  1FH0 A;  1L0V B;  5G5H A;  4ARI A;  4GB9 A;  3ZRC A;  1I42 A;  3WXF A;  3M6A A;  3NBI A;  3M3J A;  2AEH A;  1WH3 A;  4W9D A;  5E6P A;  1GMY A;  4D81 A;  2KX0 A;  4IWO A;  1VRA B;  2NPT A;  5DPW A;  1P0R A;  4NXM M;  1IM2 A;  2XEW A;  3O0U A;  2IO2 B;  2UWQ A;  1FRR A;  3S2A A;  1C1K A;  1STE A;  2RSU A;  3P5U A;  4CHK A;  2FCN A;  5KPR A;  4DHJ D;  1SF0 A;  2ZTC A;  2C7N B;  4US9 A;  1D4B A;  4YSZ B;  5EGW A;  2HWJ A;  2OOB B;  1EWP A;  1F2A A;  4P6V F;  1QLB B;  2HTM E;  2PIA A;  2D2Q A;  2WZJ A;  3I4Y A;  2KTR B;  2UZJ A;  5JZE A;  4HRO A;  2MQJ A;  2XH9 A;  1QMY A;  3TSS A;  4A55 A;  2LGX A;  1GLO A;  1EIJ A;  1D0L A;  3GLH A;  1OJL A;  2OHF A;  2QIL A;  4TKN A;  2N7D A;  4DV1 M;  3GLG A;  1WX7 A;  1YQ4 B;  3RCZ A;  1NB3 A;  3E4R A;  2DCB A;  2JZP A;  3GP7 A;  3MHS A;  1R4M B;  3U5Z A;  3ZXV A;  2H88 B;  2AS8 A;  4NRV A;  2ON8 A;  3J9C A;  2P7U A;  4N59 A;  1U9V A;  2R65 A;  2B1N A;  2OO9 A;  3PRE A;  3NJT A;  7CAT A;  1E7U A;  1QKZ A;  1GB1 A;  2BKR B;  2GFO A;  2XLJ A;  2DAM A;  1DEU A;  5FSW A;  4GN1 A;  3RI7 C;  4L78 A;  4AG5 A;  1QOF A;  2BS2 B;  2YJ9 A;  1GL7 A;  1CSB B;  1MU5 A;  1L2B A;  3V76 A;  1IN7 A;  1TKY A;  2G7Y A;  5KHO A;  3APF A;  2R61 A;  2HD5 A;  1OTR B;  3DFZ A;  3KS4 A;  4CO7 A;  4JWU C;  2WXQ A;  2BGF A;  3U6M A;  4LF4 M;  3RMK C;  4AWJ A;  1XO3 A;  2M1M A;  2KMC A;  2BTW B;  2BW2 A;  3SD5 A;  3J80 S;  1UKF A;  2JNH A;  3M0E A;  4TMA B;  2GQF A;  1GCB A;  1J7A A;  2GBR A;  3PGE A;  3PHX B;  3TEX A;  1QDT A;  2CR5 A;  2J0J A;  2DZJ A;  2QPA A;  3GLI B;  1WXA A;  3TWM A;  2EKE C;  1SEB D;  2WXR A;  4YSX B;  2R9O A;  1IUE A;  1NVI D;  3AEE B;  1E9R A;  1TH3 A;  4JI5 M;  2K22 A;  3E9S A;  1IN8 A;  2L00 B;  1SJE D;  1JR3 E;  1ZDV A;  2L32 A;  2SEB D;  4WWN A;  4NSO B;  5KQ8 A;  3AL0 C;  2LGS A;  1AU0 A;  2BDZ A;  1FFU A;  1WWT A;  1UBQ A;  2G1E A;  1AYF A;  2PPH A;  3ZJU A;  3W1S C;  3KKU A;  1ZMW A;  1D0M A;  2W55 A;  3AFH A;  1XLP A;  3ZVV A;  3L17 A;  5ITR A;  2XFT A;  2RDG A;  3J81 S;  2F4V M;  2IO1 B;  3C3E A;  4FHK A;  3LDZ E;  1V6E A;  2LJI A;  2L2D A;  1HQC A;  2FYE A;  4IM2 A;  4OZB A;  3U61 B;  3Q8C A;  2KN4 A;  2KDL A;  2MRO B;  4KKJ A;  4NL4 H;  1YK8 A;  2LRU A;  2AHM A;  2JA2 A;  3FTC A;  4MGI E;  1F1H A;  2UXB M;  3M7G A;  4O1N A;  3ZNH B;  4FWD A;  1LGR A;  4ZRK A;  2I2Y A;  2F1G A;  2LWX A;  2ZTD A;  1KJT A;  1Q6K A;  2AVW A;  4LRT A;  4YT0 B;  2JPH A;  3GE8 C;  1TF0 B;  2BWE S;  1FNV A;  1YZB A;  4BOZ B;  3KFQ A;  4IBG A;  1HNX M;  4NNJ B;  4OHJ A;  3DVN V;  3L54 A;  2ZJD A;  4AS1 A;  1D5X C;  4GUA A;  5EP1 A;  5DPT A;  2RDB C;  5HG2 A;  2MBB B;  4WH4 A;  3C0R A;  1YSY A;  4GHA A;  1G71 A;  1QZE A;  1S4V A;  3A9K B;  3N1X C;  2KKC A;  2C9W B;  3VRB B;  1KXR A;  1XT9 B;  1MN3 A;  4JPS A;  2G3Q B;  2FS1 A;  4I8O A;  3ENE A;  5CHT A;  3R2T A;  1D5M C;  4LFB M;  5HFY A;  2XN9 C;  3IEJ A;  2L52 A;  3N3G A;  2DBY A;  1F2R C;  3Q8F A;  3ETR A;  1PVJ A;  3SU8 X;  3RVV A;  1M6D A;  2PRE A;  1T0Q C;  1E8W A;  1OFH A;  1XKG A;  2JZ1 A;  3A98 B;  2DHR A;  3BOW A;  1Q5W B;  5BMI A;  4WJQ A;  4UDU C;  3RNA C;  3U60 A;  1N33 M;  3PNY A;  1MG4 A;  2MP2 A;  2AUX A;  3W31 A;  4D80 A;  4CGY B;  2HJ1 A;  3VDU A;  4MI7 A;  2AX5 A;  4W9F A;  1UZX B;  2E02 A;  4DV4 M;  3QIJ A;  2BS4 B;  1KFU L;  3LQR A;  1YAL A;  1F0Z A;  1T43 A;  3Q3M C;  1NO1 A;  1RRB A;  2R9F A;  1KM7 A;  2WSC F;  2ZVO A;  2LGY A;  3B9J A;  3R3M A;  2DAE A;  3L26 A;  4B95 A;  4GH9 A;  1WFY A;  2V1Y A;  4US8 A;  1IGC A;  3ZRF A;  2NPT B;  4M02 A;  1PIP A;  3LCV B;  1Y8R C;  2IY0 B;  2ZAO A;  1GG3 A;  5C3J B;  3FYD A;  3LQQ A;  2QNJ A;  1WR1 A;  5FKA C;  3RNE C;  1DKI A;  4CDF B;  2KA6 B;  3H9D A;  2E6X A;  1MJG M;  2K9D A;  5FTL A;  5AZG A;  2VQF M;  2B3A A;  4IBI A;  2WQY B;  1JR3 A;  4IBE A;  1DOY A;  1RWS A;  3A42 A;  2I1K A;  2DZM A;  4E74 A;  4EOY A;  4CDE B;  2NQ8 C;  5IAA C;  3KWZ A;  3P4S B;  2RGO A;  2PVO D;  1QDQ A;  5H37 D;  5JZE B;  3LXF A;  2BWE A;  1UFZ A;  3ZQ4 A;  2WDV B;  3IG3 A;  4MEL A;  2KXJ A;  4XYC A;  4AOF A;  1EWO A;  2EKK A;  3JSV B;  3BYY B;  1QQW A;  2AQ2 B;  1XXH E;  2CUZ A;  1JAL A;  4B0M A;  3VAW A;  3GLG B;  4B3T M;  1HA5 A;  3U8E A;  1TKE A;  2MH8 A;  2VDB B;  1FRD A;  2G4S A;  3U5Z B;  1YNT E;  3BVG A;  2YFQ A;  2V3P A;  4KGT A;  4LK0 M;  4NPN A;  2ZEQ A;  3VXW A;  1G8P A;  1QIL A;  2MLB A;  3P4R B;  1PE6 A;  2JY6 B;  2WXK A;  1MJD A;  5C2T B;  4DXF A;  3CST A;  3IFW B;  2OUL A;  2WP9 B;  3VKH A;  2WYQ A;  1ZIV A;  1Y8G A;  4L8R C;  4NSR A;  4BKS A;  1PCI A;  1UGJ A;  2HD5 B;  2N9K A;  3BPM A;  3UGB B;  3FIL A;  4L2Y A;  1LM8 B;  1TH4 A;  2EO2 A;  2L7R A;  8PCH A;  1IN4 A;  1TH2 A;  3FD9 A;  4ZPX A;  1VDV A;  1OFI A;  3IAM 1;  2FUG 1;  4FXC A;  3EC8 A;  1R6B X;  5DCN A;  5EE3 A;  1RYJ A;  1KH0 A;  1L5P A;  4AP4 C;  2IPK D;  3A46 A;  1TJE A;  1WXS A;  3PV1 A;  4LDT B;  2GBK A;  2KDI A;  4JI8 M;  2MWS B;  2VF8 A;  4I5S A;  3RN9 C;  2UUC M;  2FRA A;  2HXZ A;  3ONS A;  4EEW A;  2QBY A;  4QNR A;  1WHC A;  3U6D A;  4IWQ A;  3DWG C;  2Z8L A;  2XSZ D;  4JE3 B;  3T8M A;  2L0T A;  1W5T A;  3VLF B;  1C9F A;  4Y28 F;  2I7P A;  1G4A E;  2KQS A;  2O25 A;  2KAC A;  4XE0 A;  2FQ9 A;  2BKF A;  3KOY E;  3AE7 B;  1WXQ A;  2DEN B;  3E56 A;  4LGM A;  3H6N A;  3L4P A;  3N3K A;  4I81 A;  2UUB M;  4KV2 A;  3QK0 A;  1VD2 A;  3NUH B;  5GKN A;  2P86 A;  4K81 A;  2QZ4 A;  1TY2 A;  3N4C A;  1FM0 D;  3V62 A;  2CIO A;  2WSF F;  4HXD A;  1R4M I;  3CMM B;  2Z8Y M;  1R7R A;  2KAN A;  2DZY A;  1FXA A;  4IUM B;  3L29 A;  1ZV1 A;  1C4A A;  2DJG B;  1VJK A;  1A6R A;  4DHJ B;  4B3M M;  4QRV A;  4BQV A;  2CV2 A;  2DWM A;  2LMC A;  2HTH A;  3CGW A;  1WI0 A;  3IXS A;  3SAS A;  1AUA A;  4C7Y A;  1T0Y A;  4KX6 B;  1ZQ9 A;  3WXG A;  3M95 A;  3V60 A;  2LHC A;  2AL6 A;  3I63 C;  4DV7 M;  4MGZ E;  1XD3 B;  3C0R B;  1TT5 B;  2JY5 A;  1GAB A;  1ZUD 2;  1QAQ A;  1JWA D;  5BMH A;  3KFU G;  1N75 A;  3P1M A;  4HCN B;  3W0L B;  3VUY A;  2C98 A;  3ZTC A;  2PVG C;  1DO2 A;  4ZDV A;  1IXZ A;  4G0N B;  1E8Y A;  4GIP A;  4HPM B;  2R4E A;  2ZVN A;  3GLF A;  1BVS A;  5DYI A;  3MHV C;  3GPY A;  1EWM A;  2MEK A;  4WWP A;  3DHH C;  3VH4 B;  3LYY A;  2MJD A;  4M01 A;  2FOI C;  2LVP A;  1VDD A;  1H4R A;  2BB6 A;  1V49 A;  3FE3 A;  3HY5 A;  4IBK A;  5ITT A;  3NVW A;  4DXG A;  2BWB A;  2LBC A;  4BOP A;  2MJ3 A;  6PAD A;  4IBF A;  1TLO A;  4AKG A;  3PRM A;  2O5R A;  2KZU A;  1QXP A;  2JTC A;  1PAD A;  4DUY M;  1UGM A;  2OP3 A;  1HQR D;  1YOV B;  2MP2 B;  4AJW A;  3RD2 A;  3WHK A;  3AMZ A;  1MEG A;  1JW9 D;  3U6P A;  3TQS A;  2V4I B;  2FUH B;  5CVO B;  4HK2 A;  5BMG A;  4WP2 A;  3P4Q B;  3OVX A;  3UK6 A;  1NYR A;  4B6W A;  1ZE3 D;  1WZ0 A;  4OZC A;  3U7D A;  1VJV A;  2B76 B;  1C1Y B;  1QUT A;  3QJ3 A;  2FE8 A;  1C4P A;  4QOZ C;  2NQI A;  1UUP A;  1F29 A;  1FXI A;  2WXP A;  4N6E B;  3Q8A A;  4WAA A;  3IV2 A;  2NS5 A;  2D5G A;  1XF5 L;  1WR1 B;  3VFK A;  4WAF A;  4LNN A;  1E94 E;  1MX0 A;  3VR9 B;  1DOX A;  4HWY A;  3SYK A;  1WJ6 A;  5JA7 A;  2OOB A;  2AQ1 B;  5IKC M;  1TS4 A;  1XMQ M;  2IGD A;  3PT2 B;  2KTR A;  2Y3A A;  4W9I A;  1SGH A;  2K0P A;  4LNF A;  3LMM A;  3V6C A;  4L1B A;  4YTP B;  1D5Z C;  3H89 A;  2W3S A;  1TGU A;  2KDB A;  1U9X A;  5EQT A;  3ZH9 B;  4KGS A;  3SFD B;  3L28 A;  2FUD A;  3JYU A;  1PDX A;  2H5X A;  2ZZP B;  4A5U A;  3PLU A;  3K9M A;  2FNJ B;  4PP2 E;  4G4Q A;  3VDP A;  4L23 A;  1PBH A;  4HCP B;  3DDC B;  2G9H D;  1ESF A;  5L95 C;  2J52 A;  5F3W A;  1V5T A;  4G4R A;  1YT7 A;  4KT0 F;  2Q5W D;  4WJN A;  5CHW A;  1FO4 A;  4CIZ A;  1QOB A;  1GLN A;  3B2F A;  3K9P A;  3L16 A;  4JI2 M;  4X65 M;  2YR0 A;  4DK5 A;  2DWZ B;  4PD2 A;  3NOB A;  4DHZ E;  1AYV A;  3DVG Y;  2NQG A;  4BOS A;  4XWT A;  2UXD M;  1KYI A;  2L7I A;  4GIT A;  4M0W A;  3FIL B;  2KNZ A;  3FRI A;  5CTR C;  4ACF A;  4KIK A;  2MW5 A;  3BWK A;  4KKI A;  2BTW A;  1K82 A;  1WR6 E;  4B7H A;  2YEP F;  4BVU C;  1GO5 A;  3RGP A;  4EFO A;  3KYC D;  4YSY B;  1U5I A;  1V86 A;  2AU1 A;  2BQQ A;  1IBK M;  2DYB A;  1OEY A;  3GLI A;  1UH6 A;  2CKH B;  2QBY B;  1IPG A;  2PE9 A;  4DDI D;  4RM8 A;  1VG5 A;  2IYD B;  4GC9 A;  1YE9 A;  1NDD A;  1T0S C;  5T8I A;  1EUV B;  2HH5 A;  3X0W A;  1JWU D;  3TEY A;  1N77 A;  1VLB A;  3VTW A;  4Q2J A;  1I4G A;  4TUU A;  3W0F A;  3U7Z A;  2CEA A;  1Q3B A;  1V80 A;  1HTQ A;  1JB0 F;  4GC5 A;  2D3G A;  2JU6 X;  5D2M B;  2GRI A;  2CHV A;  3VKG A;  4R7G A;  1R4N B;  4D82 A;  1GJS A;  1JML A;  3RNG C;  1HT1 E;  4LF9 M;  3ZNZ B;  4JI0 M;  3KUZ A;  3FTE A;  1KFY B;  2JY7 A;  3DWM A;  3U61 A;  2DCD A;  1EM7 A;  3S3Q A;  3AJI B;  4AI6 A;  4MB7 A;  2NQD B;  1DV0 A;  3AOG A;  2V9H A;  4N9F 4;  4USA A;  4HXD B;  4WA6 A;  1R2Z A;  2PNS A;  2Z7J A;  3ZNH A;  1V81 A;  4JI1 M;  3B08 A;  2HKJ A;  3IAS 1;  1Z2M A;  1ZW7 A;  4I6P A;  2JYT A;  1QAO A;  5ITX E;  1KLU D;  5DYG A;  1KSF X;  2V3S A;  3KW9 A;  2BB5 A;  1EF1 A;  1ZXH A;  1E8X A;  1IP9 A;  4HVB A;  2M8S A;  1W5S A;  4HL4 A;  5AUK A;  2NVU I;  3JAM S;  4FN2 A;  3HUI A;  1GJZ A;  1B1Z A;  3GCB A;  3O65 A;  2JZ0 A;  4QHT A;  1NNU C;  4P1B C;  3MHS D;  4HLE A;  2G3Q A;  4WWM A;  2QQ8 A;  3WHL A;  4RCO A;  3AI8 A;  4LY6 A;  4W9J A;  3R7Q A;  1SXJ E;  3X23 A;  2K6B A;  3NS8 A;  3D8L A;  1ZXI A;  7PCK A;  2DWN A;  4OVZ A;  4MGH A;  5LXI B;  1XXH B;  3TIX A;  2X8A A;  1GEC E;  3QAU A;  3W30 A;  3SEB A;  3MC8 A;  4XUI A;  1N61 A;  4LF8 M;  2PMV A;  2LXA A;  2JP7 A;  3RNB C;  5E6N A;  4IP3 A;  2D3B A;  2JF5 A;  4NAW A;  4I4L A;  4JI3 M;  3V3X A;  1NNJ A;  3B1L X;  1I94 M;  4W5C A;  1XXG A;  1Z5S B;  3DBS A;  2W9N A;  4M9X A;  1KHQ A;  2KW0 A;  3HJ8 A;  5BYS A;  3ML8 A;  2EMS A;  2VZK B;  3GB1 A;  3Q8E A;  4FCV A;  4FW9 A;  3T38 A;  3F75 A;  2V3N A;  3GQ3 A;  4CIS A;  5EP3 A;  5CVN B;  5EZQ A;  1SE3 A;  4PCZ A;  3TJP A;  3BC3 A;  2X4A A;  1RU3 A;  2A4Z A;  2XK5 A;  1Z59 A;  4M0D A;  1XLQ A;  2MJE A;  3DPD A;  4HJG E;  1IWD A;  4HDQ A;  4GXB A;  1AYU A;  1R2Y A;  3NBX X;  1AN8 A;  2IGG A;  2WDT B;  4AG6 A;  5LNK 1;  2LVQ D;  2KNB A;  3SAV A;  2XZF A;  5H92 C;  3E46 A;  3GRY A;  2DJF B;  1ORY B;  2E00 A;  2INN E;  1TS5 A;  1TTE A;  4XX5 A;  3CBK A;  2FCS A;  3RNF C;  4GMQ A;  3JR4 A;  3GPP A;  1L2N A;  3V6C B;  4BFR A;  3THG A;  2WNM A;  5JI2 E;  4LF6 M;  3JSV A;  1MS6 A;  1T3Q A;  1ZKH A;  3HHM A;  3B79 A;  2M17 A;  2WSE F;  1U9Q X;  1VQ1 A;  2NBW B;  1YK7 A;  1K3W A;  4E71 A;  3ZIM A;  2RD0 A;  3HHZ A;  3DBL B;  1AIM A;  2JUJ A;  1QOA A;  1YIW A;  3QT4 A;  2CFO A;  3HHX A;  2HWK A;  3HIZ A;  2JY6 A;  1BQI A;  3KSX A;  2KFJ A;  2EKI A;  1PUT A;  5ITX A;  4ANU A;  5KQD A;  4MEM A;  1D6E C;  1VEJ A;  3K9P B;  1AIP C;  3P2B A;  1MG8 A;  3KW5 B;  3LXS A;  4YTN B;  4C56 C;  4EKU A;  4FJY A;  1KFX L;  1P3Q Q;  1IXS B;  4QRX A;  3TCA A;  3LCU A;  1UBI A;  3J7B A;  1YN3 A;  3KDS E;  4LJ6 A;  1WE6 A;  1POP A;  1AW7 A;  1AWD A;  4M8M A;  4M0W B;  2Y21 A;  4KIK B;  1LTM A;  2DVW B;  3VHT C;  3ABV B;  4X57 B;  2N1W A;  2R6F A;  2CHW A;  3EFU A;  1SE9 A;  2M0A A;  4M00 A;  3P5X A;  2DKL A;  3VUX A;  1Z6T A;  1QQR A;  2LUE A;  3LW5 F;  4B9K A;  3RT3 B;  1XCT L;  2WX0 A;  2JXX A;  1SXJ A;  3RZF A;  5HHD G;  5E6O A;  3K92 A;  2O6V A;  1HT2 E;  4LNK A;  1F9J A;  1ZPS A;  3PVS A;  1TZO A;  4DR3 M;  4YYR A;  2HAK A;  5KHQ A;  1RFK A;  3AU4 A;  4A6Q A;  1YQ3 B;  2Y0T A;  1XMO M;  2RMM A;  3CBJ A;  2DEN A;  2AYN A;  1IY2 A;  2QSF X;  2ACT A;  1D0K A;  1YLA A;  2BJV A;  2WHI A;  1QOG A;  3ZDT A;  3O13 A;  3APC A;  2JRH A;  3T3O A;  1E9M A;  2M19 A;  3NZ3 A;  2KHH A;  2K8H A;  2GHU A;  2KWU B;  3OAW A;  3HKP A;  2KC1 A;  3SMP A;  1FCC C;  1SE2 A;  5AEK B;  3FUV A;  3AEC B;  1TIF A;  1WSP A;  4BOS C;  1D3Z A;  3C8Y A;  3W5V B;  4D2K A;  4IUM A;  3C58 A;  3BK1 A;  3AN1 A;  1N36 M;  5IT9 S;  2D3C A;  1KFV A;  1XCQ L;  4P1C C;  2KZS A;  1CV8 A;  2QEJ C;  2ONQ A;  4X6H A;  4YYW A;  3AEF B;  1IFY A;  3R7R A;  1STF E;  3RGS A;  4MZO A;  4PI3 A;  1TTN A;  3OIS A;  4ZRQ A;  3CH3 X;  2Q2E B;  1RLF A;  2AWT A;  4HLQ A;  3PSE B;  2ZNV B;  4BZA A;  1FNU A;  1E5W A;  4DR2 M;  3K9O B;  4XGI A;  2GB1 A;  2G8E A;  2WXF A;  1TS3 A;  3CWI A;  1HXY D;  1PPO A;  5LXH A;  1TS2 A;  3RUI B;  3O65 B;  1OIZ A;  3PNR A;  2PJH A;  1VDL A;  4A90 A;  1KTK A;  1NEN B;  5FTK A;  1IBM M;  1V5O A;  3QSD A;  1GVN A;  5FK9 C;  2DZN B;  2FNA A;  1ZCM A;  3MHZ A;  4PP1 A;  1NQC A;  3A1Q A;  1AEC A;  4GOC A;  5JHA A;  3AV8 A;  4RGM A;  2VF7 A;  5EJC A;  2L0F A;  2K6D B;  1J7B A;  3DQV A;  4OVZ B;  1G3I A;  3K1J A;  2RKO A;  2N0S B;  2BTE A;  1VCB A;  1I4Q A;  2R2O A;  4WWO A;  1IGD A;  1I4R A;  3K8U A;  2ZW1 A;  1KHP A;  3IG8 A;  2O01 F;  3HVZ A;  5J18 A;  4MH8 A;  3TRK A;  3QYB A;  1NY5 A;  4LG2 A;  1PPD A;  3MHH A;  2INP E;  4NAW B;  3AOE A;  2CB5 A;  2XBB C;  3LVW A;  1R4N I;  2KRK A;  2JY8 A;  3P5W A;  3AUL A;  4NJC A;  1Q3C A;  1GNU A;  2KX3 A;  2N7J A;  4DHZ B;  1PJI A;  2YLM A;  2D7G A;  1BY8 A;  2SAK A;  3Q3O C;  2NTS A;  3PHW B;  3AEG B;  4YWG G;  4G3O A;  2ZNV C;  2DZK A;  5L83 A;  3I01 M;  4BAX A;  1THE A;  1TDH A;  4AW4 A;  3GRR A;  3IOQ A;  4DR4 M;  2XZU A;  1XB2 B;  2NBU A;  4BBN F;  3DHI C;  4YL8 A;  2V0G A;  3HRD D;  2ZAM A;  2HHH M;  1FMA D;  1ZMU A;  3RVW A;  2XK5 B;  3WAM A;  3RNC C;  3R66 C;  3RFW A;  4ZYN A;  3QYE A;  2KFK A;  1T6B X;  5J94 A;  2K6Q A;  2LHE A;  4L6V 6;  3FUX A;  1KLG D;  2HL7 A;  3PT2 A;  4K7S A;  1K3X A;  2YJC A;  2ZBK B;  1X37 A;  4G4O A;  4FBJ B;  4PS3 A;  3U30 A;  1MEM A;  2DLB A;  3EEC A;  1L2D A;  1MI0 A;  2ERC A;  2HJ8 A;  2RPV A;  1C77 A;  4Q8H A;  3JR5 A;  2C9C A;  1P9D U;  2MBQ A;  2WU5 B;  1G59 A;  4MM3 B;  4I04 A;  2KDM A;  1OEY J;  1PFD A;  3AE6 B;  3N1Z C;  2QMT A;  1PRB A;  5IRE B;  3A4R A;  3PHU A;  1V9J A;  5EF4 A;  5MPO A;  3AB5 A;  4ZUX U;  1WM2 A;  1MIR A;  3MP9 A;  4KLB A;  2D3A A;  1L7Y A;  1ME4 A;  3J2P B;  2J0M A;  2LEK A;  2J4X A;  2LD9 A;  1C7Y A;  2MR9 A;  3HHY A;  4NOO B;  4R71 A;  9PAP A;  1WJ4 A;  3AE8 B;  1CS8 A;  2L4E A;  4BKG A;  5IN7 A;  1SIF A;  1WGN A;  2WXO A;  3AE2 B;  1JWM D;  3WA0 A;  4P16 A;  2AYO B;  3PVL A;  3GPU A;  3QHT A;  2LXE A;  2BYT A;  3ILK A;  4CZW A;  3KVF B;  4XDC A;  2KN5 A;  1IY0 A;  4DUZ M;  3NVY A;  2EUC A;  2DZZ A;  2REX A;  1V8C A;  4OVU A;  2WDR B;  1ZGU B;  2RR9 A;  3A9J A;  3PBH A;  3GZN I;  4ZOH C;  3OJ4 B;  4KO8 A;  2KT7 A;  2RDH A;  3H1U A;  3IVF A;  3M63 B;  4K7W A;  1S3S A;  2D7H A;  1E7P B;  1E8Z A;  3BVZ A;  3UI3 A;  1GC7 A;  1SXJ B;  1JRP A;  2GOW A;  4JI7 M;  2J42 A;  3VDZ A;  2Z4R A;  4W5W A;  2UXC M;  1DGJ A;  4EZJ A;  2O6V B;  4L15 A;  5C18 A;  4DV0 M;  1QVR A;  1WGR A;  4ANX A;  4DMX A;  3WAL A;  2NTT A;  3DOW A;  2MH7 A;  1ISN A;  4NQK E;  4NAM A;  2AIM A;  5K16 A;  2IZV B;  3OJ3 A;  1WIA A;  2CHQ A;  5DPS A;  1PPP A;  2J7Q B;  1TGZ B;  3CF2 A;  3AE3 B;  1VEG A;  5C1Z A;  4XZX A;  4EIW A;  1OAI A;  2OJW A;  2DHY A;  4GMV A;  4RH6 A;  3ZNI D;  2J53 A;  4LZJ A;  4RNA A;  2N4F A;  4URK A;  3D32 A;  1VR9 A;  1V33 A;  1N78 A;  2E5L M;  1YJI A;  3L0W B;  3TWL A;  3DBL I;  2OED A;  2JRI B;  3EFC A;  3R9X B;  1L1T A;  4TQ1 A;  4KLN A;  3KW6 A;  2DAI A;  3HHA A;  3DBR I;  1RFA A;  4II3 B;  2PBH A;  2MGW A;  2R2Q A;  2L4F A;  4ARC A;  2OOA A;  2LVO A;  2PAD A;  4FIP A;  4I07 A;  1DGG A;  2M5Z A;  3EGR A;  4G11 A;  3UQA A;  3QAR A;  1N63 A;  1IBX B;  3HWS A;  3FTD A;  2OQ4 A;  2ZCB A;  3KLS X;  1QZM A;  4A8X C;  5DNY A;  4ZYS A;  1SXJ C;  1B9R A;  3OF9 A;  4IIW A;  4F1I A;  5BR8 M;  1AYW A;  4JWS C;  1U4A A;  1XNQ M;  3MC9 A;  4YYV A;  3UJN A;  1TZ1 A;  4C7Z A;  4RMA A;  1R7S A;  4KZ0 A;  3BBA A;  2N35 A;  1QAM A;  5IZ7 D;  3A1Q B;  3U6E A;  1EWL A;  3RZW C;  5CHV A;  1TL9 A;  3I4V A;  2MA9 B;  3VK8 A;  2FBW B;  1Q0W B;  1I4W A;  4ZTB A;  1XXH A;  1SJH D;  5D3I B;  2B1M A;  1WJU A;  1YX5 B;  1Z5A A;  3ZC7 B;  2ZPY A;  2WBF X;  2EA0 A;  1EE8 A;  5E6J A;  5IOI A;  3ZLZ A;  4CDD B;  5ITU A;  2Z3X A;  2R9C A;  2WX1 A;  2IND C;  2KRU A;  3HX3 A;  4IBB A;  1H8C A;  4JXJ A;  4A20 A;  3BOS A;  1EF5 A;  1XEE A;  4EE2 A;  2JWS A;  3DHG C;  1JWS D;  2C99 A;  4LFC M;  4ASW C;  4II2 B;  1I35 A;  2CHG A;  2C0Y A;  1DO0 A;  3CF0 A;  4IOI E;  2EKF A;  2WXJ A;  2G8J A;  4KDL B;  5FTM A;  2V6Z M;  1WYG A;  2XU4 A;  4FD2 A;  2VH2 A;  4IM3 A;  1E6E B;  2G6D A;  2C7H A;  1DF0 A;  3L08 A;  4BSQ A;  5LMU M;  2HDE A;  2XFS A;  1NL6 A;  3BZD B;  4E3C A;  2N1V A;  3WIM A;  4M9S A;  2MBH A;  3HM6 X;  5FTN A;  2PLP A;  3VTU A;  1EFU B;  2FFJ A;  2K9X A;  2O2V A;  4P7I A;  3CTW B;  2KFK B;  1QUS A;  4XDD A;  1WGY A;  3GP1 A;  4K3B A;  4W9K A;  3WCQ A;  3Q8G A;  2UYZ B;  1Y56 A;  4OEL A;  2MCN B;  1I4X A;  1FNW A;  3SC3 A;  1KRH A;  4EZL A;  4TSS A;  2R9M A;  4ICU A;  2HHN A;  2LNH C;  4GDL A;  3FRH A;  1NJG A;  4LCB A;  4K3C A;  3DF0 A;  1QDR A;  4M9Z A;  3W1Y A;  1BT0 A;  1NB5 A;  3TL5 A;  5AUI A;  1JQJ C;  2KNV A;  3F5V A;  3KQ4 A;  3KP1 E;  3AOE C;  2WXL A;  2F5Q A;  3BCN A;  3MOR A;  3KWL A;  4LFA M;  4NQL B;  3ML9 A;  4CYE A;  3U6Q A;  2MX2 A;  2KAJ A;  2KDF B;  2WLB A;  1J7C A;  1ZOY B;  3WAO A;  2C5R A;  1G6J A;  3NHE B;  2VRR B;  1L4Z B;  1L0Y B;  5EE9 A;  3VH3 B;  4GU2 A;  4B08 A;  1P1A A;  2QCU A;  3HHW A;  2DAF A;  2KWV B;  3H6S A;  4K7C A;  1CVZ A;  4G50 A;  3GO8 A;  1F77 A;  2K3U A;  2KC2 A;  2LWP A;  2JXT A;  1QOL A;  3UGJ A;  2DAJ A;  1L0X B;  4YTM B;  2K0B X;  4LF7 M;  2LAS A;  3OQC A;  1TDZ A;  2NQA A;  1IXS A;  2DXI A;  4GSW A;  1L6U A;  3GS2 A;  2Y20 A;  5EXS A;  1C4C A;  5BO4 B;  1N62 A;  1ACC A;  5A24 A;  3FC4 A;  3IHP A;  1V1P A;  4PAD A;  4QBB A;  4YHH M;  2L05 A;  4WUR A;  2LVN C;  2CHX A;  3NWL A;  4F8C B;  5G2N A;  1NBF C;  1SG9 A;  2K1F A;  1X1M A;  4ZRJ A;  3ZQJ A;  4JLC A;  4OZA A;  3A9J B;  5IWA M;  3U6S A;  3OTO M;  1WX9 A;  2VII A;  2ZM6 M;  4GHL A;  1Y08 A;  3A45 A;  2JX5 A;  3T15 A;  3PDF A;  2WS3 B;  4PS7 A;  4XWW A;  2KEB A;  3RNV A;  1WF9 A;  2YEP B;  3EIH A;  4FWG A;  1OKS A;  4D8I A;  2AUZ A;  4YYU A;  1TBE A;  1DGH B;  2DAG A;  4KHP M;  1FIQ A;  2DYO A;  1Q39 A;  4ANV A;  1R5L A;  2C96 A;  1KOT A;  4XBO A;  4ICV A;  2ARY A;  2LUM A;  3HM3 A;  1TYG B;  3Q8B A;  3Q3J A;  4FJC A;  4WIP A;  4L4U A;  3IG5 A;  2LFI A;  2JQR B;  4W9H A;  1YN4 A;  4W9C A;  3I51 A;  3N9Y C;  1UWX A;  2WXM A;  1WY8 A;  1WJ7 A;  2CU1 A;  4LJ8 A;  4XZ4 A;  4YYS A;  4IW0 A;  2R18 A;  3T1H M;  2QIE B;  3GE3 C;  3MTV A;  5KO3 A;  3I3T A;  1HZ5 A;  1K50 A;  2DZI A;  5AZH A;  2IGH A;  4RF1 A;  2QP9 X;  2NBV B;  2VQE M;  2BDL A;  2KNA A;  1LV7 A;  4IJE A;  2PE6 B;  3GLH E;  3AH7 A;  2VH1 A;  1PPN A;  3CSF A;  2DX5 B;  3PSE A;  1LXD A;  1EU4 A;  2CJN A;  3HVD A;  3W2D A;  4AQ7 A;  4ZRI A;  2KWD A;  3K9O A;  1K8R B;  2GBJ A;  2B3T A;  1UM8 A;  1EWC A;  4N4Z A;  2YJB A;  3WXE A;  4JI6 M;  3J27 B;  4PK1 A;  1TKG A;  3U52 E;  4FAD A;  3MJ5 A;  2MBO A;  4EUT A;  4N79 A;  3K8Z A;  1G41 A;  5IP4 D;  1CJL A;  4AUQ C;  3ZDM C;  1LFD A;  3SMS A;  2JUO A;  3W5U B;  2PW9 A;  2YNM D;  2GBM A;  1E7V A;  4D8B A;  2DZL A;  1DOI A;  5LLI A;  4KOD A;  4TUW A;  4JIO U;  1Q1O A;  4C4V B;  2DOS A;  1C79 A;  3L13 A;  4X6J A;  4W9L A;  2JQF R;  4XC2 A;  2DNF A;  4QOS A;  5PAD A;  2KVR A;  1IBL M;  1L8Q A;  3BXW A;  1MPE A;  1OFF A;  3RFZ B;  1HQY E;  3R8F A;  8CAT A;  4BS5 A;  4HWI B;  5J17 A;  4AZF A;  2MHJ A;  4HJK A;  4AKI A;  4AXM A;  2Z4S A;  4LDT D;  1T6O A;  2CV0 A;  2C60 A;  1XNR M;  2N9L A;  4QNM A;  2NMQ A;  3AE9 B;  1FFV A;  3BIN A;  4HEA 1;  2FO5 A;  2KHW B;  2LVO C;  3NS1 A;  2N9P C;  2CP8 A;  4HEO A;  5LMN M;  3SBJ A;  1WRI A;  3PHW A;  1HZ6 A;  1F2B A;  2DNA A;  2IDY A;  3GPX A;  3UMM A;  3DOA A;  4LJ7 A;  3GQ5 A;  4FUL A;  4MJS A;  4DQO C;  4DBG B;  1C78 A;  2IO0 B;  1M4V A;  1NV9 A;  1HJP A;  2LVA A;  3LVV A;  3GZN B;  4XK8 F;  3K24 A;  1RAX A;  4OU7 A;  3ZGZ A;  4B3R M;  2L76 A;  1CQV A;  2JYE A;  1OQR A;  1FEH A;  2O2V B;  3I57 A;  4MSX A;  4NXN M;  4H2A A;  2KYW A;  4MDK E;  5CHV C;  2UU9 M;  3H7P B;  2DC8 A;  2KWC A;  3NZS A;  3NRZ A;  3ZTD A;  4W5B A;  2RGH A;  2LVP C;  3TMP A;  5IO9 A;  3PZ8 A;  4GDL B;  1BP4 A;  2I38 A;  2F7D A;  3SAU A;  3PS6 A;  2BVC A;  4S0R A;  2IY1 B;  1NY6 A;  1N60 A;  3PRP A;  1JQP A;  1E9S A;  1TY0 A;  2X8X X;  4FCT A;  4MM3 A;  3MMP A;  4LLG M;  3B21 A;  2OJR A;  1WMH A;  3HZJ A;  4NJ7 A;  3Q2A C;  4NJ6 A;  1E32 A;  4M8N A;  3VK7 A;  4A3V B;  3CH2 X;  3W68 A;  2GI9 A;  3OG5 A;  4WQM A;  5GMV A;  1C3T A;  2E03 A;  2CS4 A;  1SNK A;  3KH0 A;  1SBB B;  4LRS A;  5JI3 E;  2I7N A;  1HTO A;  2L3Z A;  3URY A;  3ECI A;  3MFG A;  2DAK A;  2Z0E B;  1A5R A;  2Y5B B;  3KXE C;  1E0Z A;  1KLV A;  2K39 A;  4GLS C;  4Z8X A;  3DBR B;  1FCL A;  4MGY E;  4IBJ A;  5BPV A;  3RYT A;  3VR8 B;  3BPF A;  3JW0 X;  4RGO S;  2APL A;  2KOX A;  3AU5 A;  1L4D B;  2AYO A;  3FUU A;  2ZCC A;  3ZUA A;  1WYW B;  3AE4 B;  1V1P B;  3HHI A;  4DMY A;  1V1O A;  1QYR A;  3DVG X;  1MHX A;  2YQZ A;  2PKO A;  1UD7 A;  4OVV A;  3IEC A;  5C1B A;  2P0R A;  2ZW0 A;  4RY2 A;  1J7K A;  2BYF A;  2YJ8 A;  4G3X B;  2H7J A;  4LZZ A;  2ASQ A;  1OQQ A;  4P17 A;  2R44 A;  3NVV A;  1A70 A;  1Q02 A;  3ERV A;  1XC8 A;  1S3S G;  3EUB 2;  1YVB A;  4DR7 M;  1MDW A;  4LNO A;  3HJS A;  1PJT A;  4C80 A;  3QQ8 B;  1N32 M;  2QJL A;  4ZRP A;  1NI2 A;  1CTE A;  1NYQ A;  1WGH A;  3PZ7 A;  3TBL D;  1L2C A;  4FA6 A;  2AQ3 B;  3J7A S;  3VTV A;  2LHG A;  2KMM A;  1ITO A;  1GUA B;  4JL9 A;  4K1R B;  2J7Q A;  4MGK E;  2CU3 A;  4GIV A;  3HU1 A;  2WWZ A;  3PTF C;  3TPZ A;  1I4H A;  4G6Z A;  3GQ4 A;  2KK8 A;  5EE0 A;  2BYV E;  4BOQ A;  3D8B A;  2G45 B;  3V6E A;  3BY4 A;  2FID A;  2JRI A;  3B89 A;  3IHP C;  5KPZ A;  3MC0 B;  2XU1 A;  4B3S M;  3HGI A;  1J5E M;  3ZXR A;  5D6J B;  1JR3 D;  4OEM A;  1PGB A;  3I3T B;  4GDK A;  1GKI A;  3GRU A;  4P6E A;  1NEK B;  2LVQ A;  3BVM A;  2QHO A;  2L6O A;  4REZ A;  1CMX B;  2X49 A;  3Q6B A;  1IBX A;  3PO0 A;  2KZR A;  3AE1 B;  2YVC A;  4LGY A;  2YJ2 A;  4RGT A;  2VHS A;  2Y0Q A;  3W67 A;  4FLH A;  3QAQ A;  2CV1 A;  2NCN A;  1U9W A;  3QWZ B;  4GRI A;  1CQD A;  3HWN A;  3C3D A;  1IN6 A;  2C5L C;  2G8L A;  5CHF A;  5F02 A;  4DV5 M;  2E3T A;  4GKJ M;  3C9E A;  3TEZ A;  2V1U A;  2FAZ A;  2IPP B;  4LJO B;  4RF0 A;  4YYQ A;  3NY5 A;  1AAR A;  2JSV X;  3T1Y M;  3DVN U;  1GAQ B;  1J0G A;  3CF6 E;  5EZS A;  2MBE A;  3V61 A;  3ZW3 A;  4IM0 A;  5HKH A;  5E26 A;  4BLC A;  1FNN A;  2J7N A;  2JVC A;  2BT6 A;  1KF6 B;  2OPF A;  2K8C A;  3EHV A;  2G5G X;  2M60 A;  3OVZ A;  3MK6 A;  1IY1 A;  3UF8 A;  3QWL A;  4BKS D;  2JXN A;  3KSJ A;  1WGL A;  2XU5 A;  1XWI A;  4G54 A;  4S17 A;  2OZ2 A;  3S3R A;  3UIO B;  2M4N A;  1J09 A;  1OGW A;  1RM6 C;  4WW0 A;  3DCG A;  3MP2 A;  1WZ3 A;  4MH0 E;  2IBI A;  4ITK A;  4RM9 A;  4DR6 M;  1ZAE A;  1XQQ A;  4Q8G A;  2ICI A;  1FPY A;  3PW3 A;  1QF6 A;  4CDC B;  2MRP A;  4K7U A;  1ME3 A;  1SP4 B;  2K47 A;  3UQB A;  2BNK A; 
#chains in the Genus database with same CATH homology
 4JX1 C;  2L83 A;  4NRW A;  3R2I A;  1FD6 A;  1YMH E;  1FJG M;  4B7G A;  2JWU A;  2XNA C;  2PTL A;  4BB9 A;  4FCW A;  1D2N A;  2XEP A;  3SR6 A;  1E10 A;  1DGB A;  1P7F A;  4IJF A;  3PXG A;  4AKH A;  3SFZ A;  1L6V A;  2LGI A;  2K5P A;  2WU2 B;  1XLO A;  1NHG C;  3Q8X A;  1K53 A;  3GRV A;  2BU3 A;  3IFU A;  1C76 A;  3DA1 A;  1Q10 A;  1NHW C;  2F5P A;  2Y5C A;  1L1Z A;  2R4J A;  4IBD A;  2DYM A;  4MT5 A;  3LB8 C;  4IKG A;  1I4P A;  3FYC A;  5BYQ A;  2DWQ A;  5KPT A;  2R62 A;  1I7H A;  4K0K M;  4ZHP A;  1SE4 A;  4Z6Y A;  2AGA A;  1K52 A;  1EWY C;  4A9A A;  3GLH B;  2F5N A;  2ACZ B;  4KGR A;  1QAN A;  1VZ8 A;  4RFB A;  3IT6 B;  2DZO B;  1SB3 C;  3B9P A;  2LHD A;  1MVK A;  1XHB A;  2L1A A;  3U6C A;  1UNS A;  4J3O D;  4DR5 M;  1GB4 A;  1SIJ A;  2WXI A;  1GPX A;  3KP0 E;  4II7 A;  3RE8 A;  1NI3 A;  2XF3 A;  4YY3 M;  4D8E A;  2XGN A;  1DGH A;  4MAC A;  1CJE A;  1JCK B;  2QEN A;  5JXV A;  4AQY M;  3L2A A;  1NVM A;  4JI4 M;  3RPF C;  2VZK D;  1SSN A;  3CIR B;  3FAH A;  1PYW D;  3P4P B;  3SFE B;  3FKE A;  3AV0 A;  1T5X D;  1IXR C;  4X66 M;  3BK2 A;  4PT5 A;  3KS8 A;  3L27 A;  3BWU D;  4OW0 A;  3TUO A;  1N5W A;  5EP2 A;  4HKZ E;  2Z84 A;  4X64 M;  4GDK B;  3EIE A;  4BBA A;  5A2Q S;  1ZP0 B;  3T3N A;  2H89 B;  4ITQ A;  3SHG B;  2P5T A;  2CE7 A;  4ZHO A;  1NJF A;  1ET6 A;  5ITQ A;  3AEB B;  1GL6 A;  1ET9 A;  4LJ5 A;  5GXG B;  4QHS A;  2WXH A;  4BOU A;  2W54 A;  3B2G A;  2KQ4 X;  2J7Q C;  3VFD A;  4HRS A;  2V1C A;  2Y5P A;  5EXT A;  4JN6 A;  2WXN A;  3OWE B;  2BS3 B;  3SHF A;  4PDG A;  3FUT A;  4NZL B;  5EXX A;  1ROE A;  3K2L A;  2QSD A;  4OX9 M;  4S12 A;  4FWH A;  3KWV A;  3W9C B;  4DV6 M;  3TEW A;  3L25 A;  3ZJV A;  3EA6 A;  4LJ4 A;  1K51 A;  2WDQ B;  3KOX E;  1JWB D;  4L16 A;  4RGN A;  3U60 B;  2DWL A;  3FTF A;  2F5S A;  2HCB A;  3TL4 X;  1YUB A;  2KXE A;  2XSZ A;  1ZDX A;  1F2R I;  3KOZ E;  1HEZ E;  2L09 A;  1CK1 A;  1N34 M;  5EP4 A;  2LH0 A;  5EE1 A;  1GOZ A;  3H4M A;  4R3D A;  3AE5 B;  4B7F A;  4LF5 M;  5I4D A;  3IT4 B;  3PNV A;  2R45 A;  1PJJ A;  3HU3 A;  1EU3 A;  5HI1 A;  3TE6 A;  1V97 A;  3VRA B;  1VZ7 A;  3ZJT A;  4IDI A;  4N58 A;  1CZP A;  3AKZ A;  3SYL A;  3BYT B;  1LO5 D;  1VZ6 A;  3TWK A;  3Q69 A;  3VQI A;  3AEA B;  3UZU A;  1HNW M;  2IJ0 A;  5FR3 A;  5H8Y E;  4B0E A;  4HKQ A;  1XLN A;  4LJA A;  2BBC A;  3AM9 A;  3W1S A;  3SAR A;  3SAW A;  2X38 A;  2W3R A;  3I9V 1;  2W82 A;  1T3T A;  3HU2 A;  3NVZ A;  3U4E G;  3U2S C;  2R46 A;  1JQ4 A;  1QT9 A;  1BUI C;  1PM5 A;  2H1R A;  5TSS A;  3U6L A;  3PHX A;  2M56 B;  4JYA M;  1HR0 M;  2A5Y B;  4JV5 M;  1BML C;  3FUW A;  1DYQ A;  3KVW A;  1H6U A;  5FLX S;  2WXG A;  4PDI A;  2F5O A;  4YXD B;  1SXT A;  2CJO A;  1Z5C A;  1YN5 A;  2D7E A;  1UWM A;  3DZD A;  2EEL A;  3ZCB B;  1BXT A;  5G5G A;  4LJ9 A;  1MHH E;  2ZAN A;  4DV3 M;  1JRO A;  1IQP A;  2L7H A;  2J7O A;  3R8B A;  4RKX A;  1P7E A;  2BJW A;  4BOZ A;  1IN5 A;  2C9O A;  4IBC A;  2UUA M;  5D3D A;  1N5X A;  1YJJ A;  4G4N A;  1Z5B A;  3BB7 A;  4TQ0 A;  3U6O A;  5FTJ A;  2TSS A;  4DV2 M;  1WGK A;  3P42 A;  3PFI A;  3HJQ A;  5BYR A;  3ZYY X;  1HNZ M;  1PGA A;  3GLF B;  3P63 A;  3V05 A;  4DR1 M;  5D7G A;  4CHT B;  3H8H A;  5EXP A;  1ENF A;  1PGX A;  1NSF A;  4CQN A;  1SXJ D;  4FVM A;  5ITY A;  4GKK M;  4X62 M;  3KOW E;  3AED B;  1DGF A;  3SAT A;  3BII D;  4LTU A;  1L0V B;  5G5H A;  4ARI A;  3M6A A;  3NBI A;  4D81 A;  1VRA B;  4NXM M;  1IM2 A;  1FRR A;  1C1K A;  1STE A;  5KPR A;  1SF0 A;  4US9 A;  1D4B A;  4YSZ B;  4P6V F;  1QLB B;  2HTM E;  2PIA A;  3I4Y A;  2UZJ A;  5JZE A;  4HRO A;  2XH9 A;  3TSS A;  4A55 A;  3GLH A;  1OJL A;  2OHF A;  2QIL A;  4DV1 M;  3GLG A;  1YQ4 B;  3E4R A;  2JZP A;  3GP7 A;  3U5Z A;  2H88 B;  4NRV A;  2ON8 A;  3J9C A;  4N59 A;  2R65 A;  7CAT A;  1QKZ A;  1GB1 A;  2XLJ A;  5FSW A;  4L78 A;  4AG5 A;  1QOF A;  2BS2 B;  1GL7 A;  1MU5 A;  1L2B A;  1IN7 A;  1TKY A;  2R61 A;  3DFZ A;  3KS4 A;  4JWU C;  2WXQ A;  3U6M A;  4LF4 M;  1XO3 A;  2BTW B;  2BW2 A;  1UKF A;  3J80 S;  3M0E A;  4TMA B;  1J7A A;  3TEX A;  2QPA A;  3GLI B;  3TWM A;  1SEB D;  2WXR A;  4YSX B;  1IUE A;  1NVI D;  3AEE B;  1E9R A;  1TH3 A;  4JI5 M;  2K22 A;  3E9S A;  1IN8 A;  1SJE D;  1ZDV A;  2L32 A;  2SEB D;  4NSO B;  5KQ8 A;  3AL0 C;  1FFU A;  1WWT A;  2G1E A;  1AYF A;  3ZJU A;  2W55 A;  3AFH A;  1XLP A;  5ITR A;  2XFT A;  2RDG A;  3J81 S;  2F4V M;  2LJI A;  1HQC A;  4OZB A;  3U61 B;  3Q8C A;  2KN4 A;  4KKJ A;  4NL4 H;  2AHM A;  2JA2 A;  3FTC A;  4MGI E;  2UXB M;  3M7G A;  4O1N A;  4FWD A;  2I2Y A;  2LWX A;  4LRT A;  4YT0 B;  1YZB A;  1FNV A;  4IBG A;  1HNX M;  4OHJ A;  4AS1 A;  1D5X C;  4GUA A;  5EP1 A;  5HG2 A;  4WH4 A;  3C0R A;  1YSY A;  4GHA A;  3VRB B;  4JPS A;  4I8O A;  3R2T A;  1D5M C;  4LFB M;  5HFY A;  2XN9 C;  2L52 A;  2DBY A;  1F2R C;  3Q8F A;  3ETR A;  1PVJ A;  1OFH A;  3A98 B;  2DHR A;  5BMI A;  4UDU C;  3U60 A;  1N33 M;  3PNY A;  3W31 A;  4D80 A;  4CGY B;  3VDU A;  4MI7 A;  2AX5 A;  4DV4 M;  2BS4 B;  3LQR A;  1F0Z A;  3B9J A;  3L26 A;  4GH9 A;  4US8 A;  1IGC A;  2ZAO A;  5C3J B;  3FYD A;  3LQQ A;  5FKA C;  1DKI A;  2KA6 B;  2E6X A;  5FTL A;  2VQF M;  2WQY B;  4IBI A;  1JR3 A;  4IBE A;  1DOY A;  1RWS A;  3A42 A;  2NQ8 C;  3P4S B;  2RGO A;  2PVO D;  5H37 D;  3LXF A;  3ZQ4 A;  2WDV B;  3BYY B;  1QQW A;  2AQ2 B;  2CUZ A;  1JAL A;  4B0M A;  3GLG B;  4B3T M;  1HA5 A;  1TKE A;  1FRD A;  3U5Z B;  1YNT E;  3BVG A;  2YFQ A;  2V3P A;  4KGT A;  4LK0 M;  1G8P A;  1QIL A;  3P4R B;  5C2T B;  2WXK A;  4DXF A;  2WP9 B;  3VKH A;  4L8R C;  4NSR A;  1UGJ A;  2N9K A;  3FIL A;  4L2Y A;  1TH4 A;  2EO2 A;  1IN4 A;  1TH2 A;  3FD9 A;  4ZPX A;  1VDV A;  1OFI A;  3IAM 1;  2FUG 1;  4FXC A;  5EE3 A;  1R6B X;  1L5P A;  1KH0 A;  1RYJ A;  2IPK D;  3A46 A;  1TJE A;  4JI8 M;  4I5S A;  2UUC M;  2QBY A;  4QNR A;  3U6D A;  3DWG C;  2Z8L A;  2XSZ D;  4JE3 B;  1W5T A;  3VLF B;  1C9F A;  2I7P A;  1G4A E;  2KAC A;  4XE0 A;  3KOY E;  3AE7 B;  1WXQ A;  3E56 A;  4LGM A;  3L4P A;  4I81 A;  2UUB M;  3NUH B;  5GKN A;  2QZ4 A;  1TY2 A;  1FM0 D;  1R7R A;  1FXA A;  3L29 A;  1C4A A;  1VJK A;  4B3M M;  2CV2 A;  2DWM A;  2LMC A;  3IXS A;  3SAS A;  4C7Y A;  4KX6 B;  1ZQ9 A;  4DV7 M;  4MGZ E;  1ZUD 2;  1QAQ A;  1JWA D;  5BMH A;  3KFU G;  1N75 A;  3P1M A;  3W0L B;  2C98 A;  2PVG C;  1DO2 A;  1IXZ A;  4GIP A;  2R4E A;  3GLF A;  5DYI A;  3MHV C;  3GPY A;  2MEK A;  3LYY A;  2MJD A;  2FOI C;  1VDD A;  2BB6 A;  4IBK A;  5ITT A;  3NVW A;  4DXG A;  4BOP A;  2MJ3 A;  4IBF A;  4AKG A;  3PRM A;  2O5R A;  2KZU A;  2JTC A;  4DUY M;  1HQR D;  3WHK A;  3AMZ A;  1JW9 D;  3U6P A;  3TQS A;  2V4I B;  5BMG A;  3P4Q B;  3UK6 A;  1NYR A;  1ZE3 D;  4OZC A;  2B76 B;  2FE8 A;  1C4P A;  4QOZ C;  1UUP A;  1FXI A;  2WXP A;  4N6E B;  3Q8A A;  2D5G A;  1XF5 L;  4WAF A;  1E94 E;  1MX0 A;  3VR9 B;  1DOX A;  3SYK A;  2AQ1 B;  1TS4 A;  1XMQ M;  2IGD A;  2Y3A A;  2K0P A;  3LMM A;  4L1B A;  4YTP B;  1D5Z C;  2W3S A;  1TGU A;  5EQT A;  3ZH9 B;  4KGS A;  3SFD B;  3L28 A;  1PDX A;  4A5U A;  4G4Q A;  3VDP A;  4L23 A;  2G9H D;  1ESF A;  2J52 A;  5F3W A;  4G4R A;  2Q5W D;  1FO4 A;  1QOB A;  1GLN A;  3B2F A;  4JI2 M;  4X65 M;  2YR0 A;  2DWZ B;  4PD2 A;  4BOS A;  4XWT A;  2UXD M;  1KYI A;  2L7I A;  3FIL B;  4GIT A;  4M0W A;  4KKI A;  2BTW A;  1K82 A;  4B7H A;  2YEP F;  3RGP A;  4YSY B;  1IBK M;  3GLI A;  2QBY B;  4GC9 A;  1YE9 A;  5T8I A;  1JWU D;  3TEY A;  1N77 A;  1VLB A;  4Q2J A;  1I4G A;  3W0F A;  3U7Z A;  2CEA A;  1Q3B A;  4GC5 A;  2JU6 X;  2GRI A;  2CHV A;  3VKG A;  4R7G A;  4D82 A;  1JML A;  1HT1 E;  4LF9 M;  4JI0 M;  3FTE A;  1KFY B;  3DWM A;  3U61 A;  1EM7 A;  3AJI B;  4AI6 A;  4MB7 A;  3AOG A;  4USA A;  4HXD B;  1R2Z A;  3ZNH A;  2Z7J A;  3IAS 1;  4JI1 M;  2HKJ A;  2JYT A;  1QAO A;  5ITX E;  1KLU D;  5DYG A;  1KSF X;  2BB5 A;  1ZXH A;  1W5S A;  4HL4 A;  5AUK A;  3JAM S;  3HUI A;  1B1Z A;  3O65 A;  4QHT A;  1NNU C;  4WWM A;  3WHL A;  4RCO A;  4LY6 A;  1SXJ E;  3D8L A;  1ZXI A;  2DWN A;  4OVZ A;  4MGH A;  1XXH B;  2X8A A;  3QAU A;  3W30 A;  3SEB A;  1N61 A;  4LF8 M;  2PMV A;  4IP3 A;  4I4L A;  4JI3 M;  3V3X A;  1NNJ A;  1I94 M;  1XXG A;  4M9X A;  2KW0 A;  3HJ8 A;  5BYS A;  2VZK B;  3GB1 A;  3Q8E A;  4FCV A;  4FW9 A;  3T38 A;  2V3N A;  3GQ3 A;  4CIS A;  5EP3 A;  5EZQ A;  1SE3 A;  4PCZ A;  2X4A A;  1Z59 A;  4M0D A;  1XLQ A;  2MJE A;  4HJG E;  1R2Y A;  1AN8 A;  2IGG A;  4AG6 A;  5LNK 1;  3SAV A;  2XZF A;  5H92 C;  3GRY A;  1ORY B;  2INN E;  1TS5 A;  4GMQ A;  3JR4 A;  3GPP A;  3THG A;  2WNM A;  5JI2 E;  4LF6 M;  1T3Q A;  1K3W A;  3HHZ A;  1QOA A;  2CFO A;  3HHX A;  2HWK A;  3KSX A;  2EKI A;  1PUT A;  5ITX A;  5KQD A;  1D6E C;  4YTN B;  4C56 C;  1IXS B;  3J7B A;  1YN3 A;  3KDS E;  4LJ6 A;  1AW7 A;  1AWD A;  2Y21 A;  2DVW B;  3ABV B;  2M0A A;  1Z6T A;  1QQR A;  1XCT L;  1SXJ A;  5HHD G;  3K92 A;  1HT2 E;  1ZPS A;  3PVS A;  1TZO A;  4DR3 M;  1RFK A;  4A6Q A;  1YQ3 B;  2Y0T A;  1XMO M;  2RMM A;  1IY2 A;  2BJV A;  1QOG A;  3O13 A;  3T3O A;  1E9M A;  2M19 A;  3NZ3 A;  3HKP A;  3SMP A;  1FCC C;  1SE2 A;  3FUV A;  3AEC B;  1WSP A;  3C8Y A;  3W5V B;  4D2K A;  4IUM A;  3C58 A;  3BK1 A;  3AN1 A;  1N36 M;  5IT9 S;  1KFV A;  1XCQ L;  2KZS A;  2QEJ C;  2ONQ A;  3AEF B;  3RGS A;  4ZRQ A;  2Q2E B;  4HLQ A;  1FNU A;  4DR2 M;  4XGI A;  2GB1 A;  2WXF A;  1TS3 A;  3CWI A;  1HXY D;  1TS2 A;  4A90 A;  1KTK A;  5FTK A;  1IBM M;  1NEN B;  1GVN A;  5FK9 C;  2DZN B;  2FNA A;  3MHZ A;  3AV8 A;  4RGM A;  5EJC A;  1J7B A;  2BTE A;  4OVZ B;  1G3I A;  3K1J A;  2RKO A;  2N0S B;  1I4Q A;  1IGD A;  1I4R A;  2ZW1 A;  3IG8 A;  3HVZ A;  3TRK A;  4MH8 A;  1NY5 A;  4LG2 A;  2INP E;  4NAW B;  3AOE A;  3LVW A;  2KRK A;  4NJC A;  1Q3C A;  2N7J A;  1PJI A;  2D7G A;  2SAK A;  2NTS A;  3AEG B;  4YWG G;  1TDH A;  4AW4 A;  3GRR A;  4DR4 M;  2XZU A;  2V0G A;  3HRD D;  2ZAM A;  2HHH M;  1FMA D;  3RFW A;  1T6B X;  2LHE A;  3FUX A;  1KLG D;  2HL7 A;  3PT2 A;  1K3X A;  2ZBK B;  1X37 A;  4G4O A;  2DLB A;  1L2D A;  1MI0 A;  2ERC A;  2RPV A;  1C77 A;  3JR5 A;  2C9C A;  2WU5 B;  1G59 A;  4MM3 B;  2KDM A;  1PFD A;  3AE6 B;  2QMT A;  5IRE B;  3PHU A;  5MPO A;  3AB5 A;  3MP9 A;  3J2P B;  2LEK A;  2J4X A;  3HHY A;  4NOO B;  3AE8 B;  2WXO A;  3AE2 B;  1JWM D;  4P16 A;  3GPU A;  2LXE A;  2BYT A;  3ILK A;  4XDC A;  1IY0 A;  4DUZ M;  3NVY A;  2EUC A;  1V8C A;  2WDR B;  4ZOH C;  4KO8 A;  2RDH A;  1S3S A;  2D7H A;  1E7P B;  3BVZ A;  3UI3 A;  1SXJ B;  1JRP A;  4JI7 M;  2J42 A;  2Z4R A;  4W5W A;  2UXC M;  1DGJ A;  4L15 A;  5C18 A;  4DV0 M;  1QVR A;  2NTT A;  2MH7 A;  4NAM A;  2CHQ A;  3CF2 A;  3AE3 B;  4XZX A;  4EIW A;  4RH6 A;  2J53 A;  4LZJ A;  4RNA A;  1VR9 A;  1N78 A;  1YJI A;  2E5L M;  3TWL A;  2OED A;  3R9X B;  1L1T A;  4TQ1 A;  4KLN A;  3KW6 A;  4ARC A;  3EGR A;  2M5Z A;  1DGG A;  1N63 A;  1IBX B;  3HWS A;  3FTD A;  2OQ4 A;  3KLS X;  4A8X C;  1QZM A;  4ZYS A;  5DNY A;  1B9R A;  1SXJ C;  4IIW A;  5BR8 M;  4JWS C;  1XNQ M;  3UJN A;  4C7Z A;  1R7S A;  3BBA A;  1QAM A;  5IZ7 D;  3U6E A;  3I4V A;  3VK8 A;  2FBW B;  1I4W A;  4ZTB A;  1XXH A;  1SJH D;  5D3I B;  1Z5A A;  3ZC7 B;  2EA0 A;  1EE8 A;  5E6J A;  5ITU A;  2Z3X A;  2KRU A;  4IBB A;  4JXJ A;  3BOS A;  1XEE A;  4EE2 A;  1JWS D;  2C99 A;  4LFC M;  2CHG A;  1DO0 A;  3CF0 A;  4IOI E;  2WXJ A;  5FTM A;  2V6Z M;  1WYG A;  4FD2 A;  1E6E B;  5LMU M;  2HDE A;  2XFS A;  3BZD B;  4M9S A;  5FTN A;  2PLP A;  2FFJ A;  2K9X A;  3CTW B;  4XDD A;  3GP1 A;  3WCQ A;  1Y56 A;  1I4X A;  1FNW A;  3SC3 A;  1KRH A;  4TSS A;  2LNH C;  1NJG A;  4LCB A;  4M9Z A;  5AUI A;  1JQJ C;  3KQ4 A;  3KP1 E;  3AOE C;  2WXL A;  2F5Q A;  3KWL A;  4LFA M;  3U6Q A;  2KAJ A;  2WLB A;  1J7C A;  1ZOY B;  2C5R A;  1L4Z B;  1L0Y B;  4B08 A;  2QCU A;  3HHW A;  3GO8 A;  1F77 A;  2K3U A;  2JXT A;  3UGJ A;  1L0X B;  4YTM B;  4LF7 M;  3OQC A;  1TDZ A;  2DXI A;  1L6U A;  3GS2 A;  2Y20 A;  5EXS A;  1C4C A;  1N62 A;  1ACC A;  3FC4 A;  1V1P A;  4YHH M;  4WUR A;  3NWL A;  4OZA A;  5IWA M;  3U6S A;  3OTO M;  2VII A;  2ZM6 M;  4GHL A;  3A45 A;  2JX5 A;  3T15 A;  2WS3 B;  4XWW A;  2KEB A;  3RNV A;  2YEP B;  3EIH A;  4FWG A;  4D8I A;  1DGH B;  4KHP M;  1FIQ A;  2DYO A;  1Q39 A;  2C96 A;  4XBO A;  2LUM A;  1TYG B;  3Q8B A;  4WIP A;  4L4U A;  3IG5 A;  2LFI A;  2JQR B;  1YN4 A;  3I51 A;  3N9Y C;  1UWX A;  2WXM A;  4LJ8 A;  2R18 A;  3T1H M;  2QIE B;  3MTV A;  5KO3 A;  1HZ5 A;  1K50 A;  2IGH A;  4RF1 A;  2QP9 X;  2VQE M;  1LV7 A;  4IJE A;  3AH7 A;  3PSE A;  1EU4 A;  2CJN A;  3HVD A;  3W2D A;  4AQ7 A;  2KWD A;  1UM8 A;  1EWC A;  4JI6 M;  3J27 B;  1TKG A;  3U52 E;  3MJ5 A;  3K8Z A;  1G41 A;  3SMS A;  3W5U B;  2PW9 A;  2YNM D;  4D8B A;  1DOI A;  4KOD A;  4TUW A;  2DOS A;  1C79 A;  4QOS A;  1IBL M;  1L8Q A;  1MPE A;  1OFF A;  3RFZ B;  1HQY E;  3R8F A;  8CAT A;  4AZF A;  4AKI A;  2Z4S A;  2CV0 A;  2N9L A;  1XNR M;  3AE9 B;  4QNM A;  2NMQ A;  4HEA 1;  1FFV A;  5EE9 A;  3NS1 A;  5LMN M;  3SBJ A;  1WRI A;  3PHW A;  1HZ6 A;  2IDY A;  3GPX A;  3UMM A;  3DOA A;  4LJ7 A;  3GQ5 A;  4DQO C;  1C78 A;  1M4V A;  3LVV A;  4OU7 A;  3ZGZ A;  4B3R M;  1CQV A;  2JYE A;  1OQR A;  1FEH A;  3I57 A;  4NXN M;  4H2A A;  2UU9 M;  3NRZ A;  3TMP A;  2RGH A;  3PZ8 A;  4GDL B;  2I38 A;  3SAU A;  1NY6 A;  1N60 A;  3PRP A;  1E9S A;  1TY0 A;  4FCT A;  4LLG M;  3B21 A;  1E32 A;  3VK7 A;  4A3V B;  2GI9 A;  4WQM A;  1SBB B;  4LRS A;  5JI3 E;  2I7N A;  3URY A;  3MFG A;  1E0Z A;  3KXE C;  4GLS C;  4Z8X A;  1FCL A;  4MGY E;  4IBJ A;  5BPV A;  3VR8 B;  4RGO S;  1L4D B;  3FUU A;  3AE4 B;  1V1P B;  1V1O A;  1QYR A;  1MHX A;  2YQZ A;  2PKO A;  5C1B A;  2ZW0 A;  1J7K A;  4LZZ A;  1OQQ A;  3NVV A;  1A70 A;  1XC8 A;  3EUB 2;  4DR7 M;  3HJS A;  4C80 A;  1N32 M;  2QJL A;  4ZRP A;  1NYQ A;  3PZ7 A;  1L2C A;  2AQ3 B;  3J7A S;  2KMM A;  2J7Q A;  4MGK E;  2CU3 A;  3HU1 A;  3TPZ A;  1I4H A;  4G6Z A;  3GQ4 A;  5EE0 A;  4BOQ A;  3D8B A;  3BY4 A;  2JRI A;  3MC0 B;  5KPZ A;  4B3S M;  3HGI A;  1J5E M;  1JR3 D;  1PGB A;  1GKI A;  3GRU A;  1NEK B;  3BVM A;  2L6O A;  4REZ A;  2X49 A;  1IBX A;  3PO0 A;  3AE1 B;  4LGY A;  4RGT A;  2Y0Q A;  2CV1 A;  4GRI A;  1IN6 A;  2G8L A;  4DV5 M;  2E3T A;  4GKJ M;  3TEZ A;  2V1U A;  4RF0 A;  2JSV X;  3T1Y M;  1GAQ B;  3CF6 E;  5EZS A;  5E26 A;  4BLC A;  1FNN A;  2J7N A;  2BT6 A;  2OPF A;  1KF6 B;  2G5G X;  2M60 A;  3MK6 A;  1IY1 A;  3QWL A;  3KSJ A;  1XWI A;  1J09 A;  1RM6 C;  4WW0 A;  3MP2 A;  4MH0 E;  4ITK A;  4DR6 M;  1ZAE A;  2ICI A;  1QF6 A;  2K47 A;  2BNK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...