3N3GA

4-(3-trifluoromethylphenyl)-pyrimidine-2-carbonitrile as cathepsin s inhibitors: n3, not n1 is critically important
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
217
structure length
217
Chain Sequence
LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 4-(3-Trifluoromethylphenyl)-pyrimidine-2-carbonitrile as cathepsin S inhibitors: N3, not N1 is critically important.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Cathepsin S
total genus 70
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2010-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3n3gA00
1U9QX 3TNXA 1NB5A 1Q6KA 2C0YA 2R9CA 4QBBA 1A6RA 1PPPA 3I06A 4MZOA 1AU4A 5JA7A 2NQIA 4BSQA 3H89A 1MDWA 3NHEA 2GFOA 4YYUA 2E00A 1KHPA 4PI3A 2DCAA 3BOWA 1X9YA 2G8JA 2P0RA 3OVXA 1ATKA 4MSXA 5CVMA 1YALA 4QRXA 3LFYA 4PP2E 1MEGA 2HXZA 1BY8A 5CVOB 3V6EA 1GECE 3OVZA 1NPZA 3KX1A 1TU6A 2YJCA 2JQFR 1F2BA 1U9VA 2FQ9A 2FTDA 3N4CA 1POPA 2F7DA 2O6XA 4ZUXU 3H6SA 1MHWA 1PCIA 2AIMA 4CDEB 4YVAA 2GHUA 2VHSA 2NQAA 1STFE 2OULA 1YK7A 4FJCA 3RVVA 3KKUA 3CH2X 4N4ZA 3MTNA 4X6IA 4N8WA 4AXMA 4BS5A 2PBHA 1ME3A 1IWDA 1AYWA 4I05A 2F1GA 1NB3A 2Y5BA 1GCBA 2AS8A 2XU3A 1JQPA 1Y08A 3N3GA 1U5IA 1QDQA 2HHNA 3WXFA 3KWBX 3LXSA 3PW3A 3HHAA 3GCBA 4PP1A 4YYWA 1CQDA 3AI8A 2VHFA 4CDCB 5JH3A 9PAPA 2DC6A 3O0UA 3S3RA 1AIMA 3OISA 5CHVA 1EWOA 4I07A 2AYOA 3HHIA 2R9MA 2ATOA 2DZYA 3PDFA 3QT4A 1TL9A 2XU1A 3D6SA 4AXLA 3F5VA 2XU5A 2R9OA 4YYVA 1CVZA 4YYSA 1FH0A 2FYEA 4BQVA 1M6DA 2PADA 1AYUA 3MHHA 5FPWA 1AU0A 1CB5A 3QSDA 2YJBA 1PIPA 5K16A 2Y6EA 3V6CA 2HH5A 1YK8A 4Q8GA 2R9NA 2YJ2A 2R6NA 4DMYA 2AUZA 3K8UA 1EWPA 1O0EA 4BPVA 4Q8HA 1CJLA 3RVWA 4QRGA 8PCHA 1TLOA 3QJ3A 1CPJA 2G7YA 1MS6A 3IV2A 4QH6A 4OEMA 1NLJA 2FRQA 2AVWA 2FRAA 2ACTA 3P5WA 1CSBB 1KFUL 2AUXA 4FK5A 2DCBA 3BPMA 5CHTA 4BS6A 4YYQA 4P6EA 3E1ZB 1AU2A 1PADA 2PREA 3IMAA 2DJGB 1ITOA 2FO5A 2CB5A 2WBFX 2DC7A 5A24A 2DZZA 2XU4A 3KFQA 1NL6A 5F02A 5PADA 1THEA 1GLOA 2OP3A 3IHPA 1EWLA 1KFXL 5EGWA 7PCKA 4X6JA 1BGOA 2G6DA 1CS8A 1CTEA 3M99A 1S4VA 1PPOA 1AU3A 1BQIA 4P6GA 3WXEA 3OF9A 4MZSA 1PE6A 2JQGR 1K3BB 3N3KA 4W5CA 3CBJA 4DMXA 4FIPA 3HWNA 1VSNA 2OZ2A 1AYVA 1PPDA 3K24A 3BWKA 2DCDA 1F2CA 3KSEA 1U9XA 3DF0A 2DCCA 4W4UA 3F75A 3P5XA 1EF7A 2CIOA 2E01A 2R9FA 1NQCA 3H8CA 1ZCMA 2DJFB 4WA6A 3KWZA 2FT2A 1EWMA 3U8EA 1U9WA 1XKGA 2IPPB 3BPFA 4PADA 1YVBA 3IUTA 4XR7A 1SP4B 2DC8A 1BP4A 4K7CA 2BDZA 3P5VA 1F2AA 3O1GA 5EF4A 3B79A 1MEMA 3ERVA 4RY2A 1QOLA 2NQGA 4CDFB 3ZUAA 1PXVA 4QRVA 3CH3X 2BDLA 1SNKA 2ARYA 4I04A 2AU1A 1VJVA 3H7DA 4OELA 2AYNA 3S3QA 4X6HA 1DF0A 1GMYA 2PNSA 1QMYA 2H7JA 5CVNB 4YV8A 2P7UA 3K9MA 3IEJA 3OF8A 1F29A 1PBHA 1YT7A 2B1MA 1HUCB 4KLBA 4XUIA 6PADA 2P86A 3C9EA 4G54A 2HD5A 2G8EA 3KW9A 3USVA 2B1NA 5J94A 1KHQA 3WXGA 1AECA 1DEUA 4CDDB 1MIRA 2IBIA 3HD3A 4YYRA 1ICFA 3IOQA 3BC3A 2FUDA 3CBKA 3P5UA 2DC9A 2E02A 1KXRA 1Y4HA 2YJ9A 3MHSA 2E03A 3PBHA 2YJ8A 1PPNA 4CZWA 3RVXA 1CV8A 1ZIVA 1ME4A 3H8BA 3MORA 2NQDB 4N79A 4HWYA 3I3TA 4W5BA 1QXPA 3PNRA 3BCNA
chains in the Genus database with same CATH superfamily
1U9QX 3TNXA 1NB5A 1Q6KA 2C0YA 2R9CA 4QBBA 3MP2A 1A6RA 1PPPA 3I06A 4MZOA 1AU4A 5JA7A 4P16A 2NQIA 4BSQA 3H89A 1MDWA 3NHEA 2GFOA 4YYUA 2E00A 1KHPA 4PI3A 2DCAA 3BOWA 1X9YA 2G8JA 2P0RA 3OVXA 1ATKA 4MSXA 5CVMA 1YALA 4QRXA 3LFYA 4PP2E 1MEGA 5EZQA 2BTWA 4GUAA 2HXZA 1BY8A 5CVOB 5KO3A 5E6JA 1UKFA 3V6EA 1GECE 3OVZA 1NPZA 3KX1A 3PRMA 1TU6A 2YJCA 2JQFR 1F2BA 1U9VA 3PSEA 2FQ9A 2FTDA 3N4CA 1POPA 2F7DA 2O6XA 4ZUXU 3H6SA 3O65A 2AGAA 1MHWA 1PCIA 2AIMA 4CDEB 4D8BA 4YVAA 2GHUA 2VHSA 2NQAA 2Z84A 1STFE 2OULA 4ZTBA 1YK7A 4FJCA 3RVVA 3KKUA 3CH2X 4N4ZA 3MTNA 4HXDB 4X6IA 4N8WA 4AXMA 4BS5A 2PBHA 1ME3A 1IWDA 1AYWA 4I05A 2F1GA 1NB3A 2Y5BA 1GCBA 2AS8A 5JZEA 2XU3A 1JQPA 1Y08A 3N3GA 4BOSA 1U5IA 1QDQA 4RF0A 2HHNA 3WXFA 3KWBX 3PRPA 3LXSA 3PW3A 3HHAA 4D8EA 3GCBA 4PP1A 4YYWA 1CQDA 3AI8A 2VHFA 4CDCB 5JH3A 3ZNHA 9PAPA 2DC6A 3O0UA 3S3RA 1AIMA 3OISA 4BOUA 4OVZA 5CHVA 5EZSA 1EWOA 4I07A 2AYOA 4M0WA 3HHIA 2R9MA 2ATOA 2DZYA 3PDFA 3QT4A 1TL9A 2XU1A 3D6SA 4AXLA 3F5VA 4OVZB 2XU5A 2R9OA 4YYVA 1CVZA 4YYSA 1FH0A 2FYEA 4BQVA 4RF1A 4IP3A 1M6DA 2PADA 1AYUA 2FE8A 3MHHA 5FPWA 1AU0A 1CB5A 3QSDA 2YJBA 1PIPA 5K16A 2Y6EA 3V6CA 2HH5A 4IUMA 1YK8A 4Q8GA 2R9NA 2YJ2A 2R6NA 4DMYA 2AUZA 3K8UA 1EWPA 3IFUA 1O0EA 4BPVA 4Q8HA 1CJLA 3RVWA 4QRGA 8PCHA 1TLOA 3QJ3A 1CPJA 2G7YA 1MS6A 3IV2A 1DKIA 4OEMA 4QH6A 1NLJA 2FRQA 2AVWA 2FRAA 2ACTA 3P5WA 1CSBB 1KFUL 3TMPA 2AUXA 4FK5A 2DCBA 3BPMA 5CHTA 4R3DA 1PVJA 4RNAA 4BS6A 3PHWA 3W31A 4RKXA 1YZBA 4YYQA 4P6EA 3E1ZB 1AU2A 1PADA 2PREA 3IMAA 2DJGB 2JTCA 1ITOA 2FO5A 2CB5A 2WBFX 2DC7A 5A24A 2DZZA 2XU4A 2JRIA 3KFQA 2BTWB 1NL6A 5F02A 5PADA 1THEA 3MJ5A 1GLOA 2OP3A 4MM3B 3IHPA 1EWLA 1KFXL 5EGWA 4MI7A 7PCKA 4X6JA 1BGOA 2G6DA 1CS8A 1CTEA 3W30A 3M99A 1S4VA 1PPOA 2HWKA 1AU3A 4BOZA 1BQIA 4P6GA 3WXEA 3OF9A 4MZSA 1PE6A 2JQGR 1K3BB 3N3KA 3CBJA 4W5CA 4DMXA 4FIPA 3HWNA 1VSNA 4D8IA 2OZ2A 3E9SA 1AYVA 1PPDA 3K24A 3BWKA 3PHUA 3PT2A 2DCDA 1F2CA 3KSEA 1U9XA 3DF0A 2DCCA 4PT5A 3MTVA 4W4UA 3F75A 3P5XA 3B21A 1EF7A 2CIOA 2E01A 2R9FA 1NQCA 3H8CA 1ZCMA 2DJFB 4WA6A 3KWZA 2FT2A 4REZA 1EWMA 3U8EA 1U9WA 1XKGA 2IPPB 3BPFA 3C0RA 4PADA 1YVBA 3IUTA 4XR7A 3BY4A 1SP4B 2DC8A 2J7QA 3OQCA 2BU3A 1BP4A 4K7CA 2BDZA 3P5VA 1F2AA 3O1GA 5EF4A 3B79A 1MEMA 3ERVA 4RY2A 1QOLA 4A5UA 2NQGA 4CDFB 3ZUAA 1PXVA 4QRVA 3CH3X 2BDLA 1SNKA 2ARYA 4I04A 2AU1A 1VJVA 3H7DA 4OELA 2AYNA 3S3QA 4X6HA 1DF0A 1GMYA 2PNSA 1QMYA 2H7JA 5CVNB 4YV8A 2DOSA 2P7UA 3K9MA 3IEJA 3OF8A 3RNVA 1F29A 1PBHA 1YT7A 2B1MA 1HUCB 4KLBA 4XUIA 6PADA 2P86A 3C9EA 4G54A 2HD5A 2G8EA 3KW9A 3USVA 2B1NA 5J94A 3PHXA 3BB7A 4WURA 1KHQA 3WXGA 1AECA 1DEUA 4BOQA 2UZJA 4CDDB 1MIRA 2IBIA 3HD3A 4YYRA 1ICFA 2J7QC 3TRKA 3IOQA 3BC3A 4OW0A 2FUDA 3BBAA 3CBKA 3P5UA 2DC9A 2E02A 1KXRA 1Y4HA 2YJ9A 3MHSA 2E03A 3PBHA 2YJ8A 1PPNA 4CZWA 3RVXA 1CV8A 1ZIVA 1ME4A 3H8BA 3MORA 2NQDB 4BOPA 4N79A 4HWYA 4XZXA 3I3TA 4W5BA 1QXPA 3PNRA 3BCNA
chains in the Genus database with same CATH topology
1U9QX 3TNXA 1NB5A 1Q6KA 2C0YA 2R9CA 4QBBA 1A6RA 1PPPA 3I06A 4MZOA 1AU4A 5JA7A 2NQIA 4BSQA 3H89A 1MDWA 3NHEA 2GFOA 4C5PA 4YYUA 2E00A 1KHPA 4PI3A 2DCAA 3BOWA 1X9YA 2G8JA 2P0RA 3OVXA 1ATKA 4MSXA 5CVMA 1YALA 4QRXA 3LFYA 4PP2E 1MEGA 2HXZA 4GUZA 1BY8A 5CVOB 3V6EA 1GECE 3OVZA 1NPZA 3KX1A 1TU6A 2YJCA 2JQFR 1F2BA 1U9VA 2FQ9A 2FTDA 3N4CA 1POPA 2F7DA 2O6XA 4ZUXU 3H6SA 1MHWA 1PCIA 2AIMA 4CDEB 4YVAA 2GHUA 2VHSA 2NQAA 1STFE 2VFBA 2OULA 1YK7A 4FJCA 3RVVA 3KKUA 3CH2X 4N4ZA 3MTNA 4X6IA 4N8WA 4AXMA 4BS5A 2PBHA 1ME3A 1IWDA 1AYWA 4I05A 2F1GA 1NB3A 2Y5BA 1GCBA 2AS8A 2XU3A 1JQPA 1Y08A 3N3GA 1U5IA 1QDQA 2HHNA 3WXFA 3KWBX 3LXSA 3PW3A 3HHAA 3GCBA 4PP1A 4YYWA 1CQDA 1GX3A 3AI8A 2VHFA 4CDCB 5JH3A 9PAPA 2DC6A 3O0UA 3S3RA 1AIMA 3OISA 5CHVA 1EWOA 4I07A 2AYOA 3HHIA 2R9MA 2ATOA 2DZYA 3PDFA 3QT4A 1TL9A 2BSZA 2XU1A 3D6SA 4AXLA 3F5VA 2XU5A 2R9OA 4YYVA 1CVZA 4YYSA 1FH0A 2FYEA 4BQVA 1M6DA 2PADA 1AYUA 3MHHA 5FPWA 1AU0A 1CB5A 3QSDA 2YJBA 1PIPA 5K16A 2Y6EA 3V6CA 1W5RA 2HH5A 1YK8A 4Q8GA 2R9NA 2YJ2A 2R6NA 4DMYA 2AUZA 3K8UA 1EWPA 4B55A 1O0EA 4BPVA 4Q8HA 1CJLA 3RVWA 4QRGA 8PCHA 1TLOA 3QJ3A 1CPJA 2G7YA 1MS6A 1W6FA 3IV2A 4QH6A 4OEMA 1NLJA 2FRQA 2AVWA 2FRAA 2ACTA 3P5WA 1CSBB 1KFUL 2AUXA 4FK5A 2DCBA 3BPMA 5CHTA 1W4TA 4BS6A 4YYQA 4P6EA 3E1ZB 1AU2A 1PADA 2PREA 3IMAA 2DJGB 1ITOA 2FO5A 2CB5A 2WBFX 2DC7A 5A24A 2DZZA 2XU4A 3KFQA 4NV7A 1NL6A 5F02A 5PADA 1THEA 1GLOA 2OP3A 3IHPA 1EWLA 1KFXL 5EGWA 7PCKA 4X6JA 1BGOA 2G6DA 1CS8A 1CTEA 3M99A 1E2TA 1S4VA 1PPOA 1AU3A 1BQIA 4P6GA 3WXEA 3OF9A 4MZSA 1PE6A 2JQGR 1K3BB 3N3KA 4W5CA 3CBJA 4DMXA 4FIPA 3HWNA 1VSNA 2OZ2A 2VFCA 1AYVA 1PPDA 3K24A 3BWKA 2DCDA 1F2CA 3KSEA 1U9XA 3DF0A 2DCCA 4W4UA 3F75A 3P5XA 1EF7A 2CIOA 2E01A 2R9FA 1NQCA 3H8CA 1ZCMA 2DJFB 4WA6A 3KWZA 2FT2A 1EWMA 3U8EA 1U9WA 1XKGA 2IPPB 3BPFA 4BGFA 4PADA 1YVBA 3IUTA 4XR7A 1SP4B 3LTWA 2DC8A 1BP4A 4K7CA 2BDZA 3P5VA 1F2AA 3O1GA 5EF4A 3B79A 1MEMA 3D9WA 3ERVA 4RY2A 1QOLA 2NQGA 4CDFB 3ZUAA 1PXVA 4QRVA 3CH3X 2BDLA 1SNKA 2ARYA 4I04A 2AU1A 1VJVA 3H7DA 4OELA 2AYNA 3S3QA 4X6HA 1DF0A 1GMYA 2PNSA 1QMYA 2H7JA 5CVNB 4YV8A 2P7UA 3K9MA 3IEJA 3OF8A 1F29A 1PBHA 1YT7A 2B1MA 1HUCB 4KLBA 4XUIA 6PADA 2P86A 3C9EA 4G54A 2HD5A 2G8EA 3KW9A 3USVA 2B1NA 5J94A 1KHQA 3WXGA 1AECA 1DEUA 4CDDB 1MIRA 2IBIA 3HD3A 4YYRA 1ICFA 3IOQA 3BC3A 2FUDA 3CBKA 3P5UA 2DC9A 2E02A 1KXRA 1Y4HA 2YJ9A 3MHSA 2E03A 3PBHA 2YJ8A 1PPNA 4CZWA 3RVXA 4NV8A 1CV8A 1ZIVA 1ME4A 3H8BA 3MORA 2NQDB 4N79A 4HWYA 3I3TA 4W5BA 1QXPA 3PNRA 3BCNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U9Q X;  3TNX A;  1NB5 A;  1Q6K A;  2C0Y A;  2R9C A;  4QBB A;  1A6R A;  1PPP A;  3I06 A;  4MZO A;  1AU4 A;  5JA7 A;  2NQI A;  4BSQ A;  3H89 A;  1MDW A;  3NHE A;  2GFO A;  4YYU A;  2E00 A;  1KHP A;  4PI3 A;  2DCA A;  3BOW A;  1X9Y A;  2G8J A;  2P0R A;  3OVX A;  1ATK A;  4MSX A;  5CVM A;  1YAL A;  4QRX A;  3LFY A;  4PP2 E;  1MEG A;  2HXZ A;  1BY8 A;  5CVO B;  3V6E A;  1GEC E;  3OVZ A;  1NPZ A;  3KX1 A;  1TU6 A;  2YJC A;  2JQF R;  1F2B A;  1U9V A;  2FQ9 A;  2FTD A;  3N4C A;  1POP A;  2F7D A;  2O6X A;  4ZUX U;  3H6S A;  1MHW A;  1PCI A;  2AIM A;  4CDE B;  4YVA A;  2GHU A;  2VHS A;  2NQA A;  1STF E;  2OUL A;  1YK7 A;  4FJC A;  3RVV A;  3KKU A;  3CH2 X;  4N4Z A;  3MTN A;  4X6I A;  4N8W A;  4AXM A;  4BS5 A;  2PBH A;  1ME3 A;  1IWD A;  1AYW A;  4I05 A;  2F1G A;  1NB3 A;  2Y5B A;  1GCB A;  2AS8 A;  2XU3 A;  1JQP A;  1Y08 A;  3N3G A;  1U5I A;  1QDQ A;  2HHN A;  3WXF A;  3KWB X;  3LXS A;  3PW3 A;  3HHA A;  3GCB A;  4PP1 A;  4YYW A;  1CQD A;  3AI8 A;  2VHF A;  4CDC B;  5JH3 A;  9PAP A;  2DC6 A;  3O0U A;  3S3R A;  1AIM A;  3OIS A;  5CHV A;  1EWO A;  4I07 A;  2AYO A;  3HHI A;  2R9M A;  2ATO A;  2DZY A;  3PDF A;  3QT4 A;  1TL9 A;  2XU1 A;  3D6S A;  4AXL A;  3F5V A;  2XU5 A;  2R9O A;  4YYV A;  1CVZ A;  4YYS A;  1FH0 A;  2FYE A;  4BQV A;  1M6D A;  2PAD A;  1AYU A;  3MHH A;  5FPW A;  1AU0 A;  1CB5 A;  3QSD A;  2YJB A;  1PIP A;  5K16 A;  2Y6E A;  3V6C A;  2HH5 A;  1YK8 A;  4Q8G A;  2R9N A;  2YJ2 A;  2R6N A;  4DMY A;  2AUZ A;  3K8U A;  1EWP A;  1O0E A;  4BPV A;  4Q8H A;  1CJL A;  3RVW A;  4QRG A;  8PCH A;  1TLO A;  3QJ3 A;  1CPJ A;  2G7Y A;  1MS6 A;  3IV2 A;  4QH6 A;  4OEM A;  1NLJ A;  2FRQ A;  2AVW A;  2FRA A;  2ACT A;  3P5W A;  1CSB B;  1KFU L;  2AUX A;  4FK5 A;  2DCB A;  3BPM A;  5CHT A;  4BS6 A;  4YYQ A;  4P6E A;  3E1Z B;  1AU2 A;  1PAD A;  2PRE A;  3IMA A;  2DJG B;  1ITO A;  2FO5 A;  2CB5 A;  2WBF X;  2DC7 A;  5A24 A;  2DZZ A;  2XU4 A;  3KFQ A;  1NL6 A;  5F02 A;  5PAD A;  1THE A;  1GLO A;  2OP3 A;  3IHP A;  1EWL A;  1KFX L;  5EGW A;  7PCK A;  4X6J A;  1BGO A;  2G6D A;  1CS8 A;  1CTE A;  3M99 A;  1S4V A;  1PPO A;  1AU3 A;  1BQI A;  4P6G A;  3WXE A;  3OF9 A;  4MZS A;  1PE6 A;  2JQG R;  1K3B B;  3N3K A;  4W5C A;  3CBJ A;  4DMX A;  4FIP A;  3HWN A;  1VSN A;  2OZ2 A;  1AYV A;  1PPD A;  3K24 A;  3BWK A;  2DCD A;  1F2C A;  3KSE A;  1U9X A;  3DF0 A;  2DCC A;  4W4U A;  3F75 A;  3P5X A;  1EF7 A;  2CIO A;  2E01 A;  2R9F A;  1NQC A;  3H8C A;  1ZCM A;  2DJF B;  4WA6 A;  3KWZ A;  2FT2 A;  1EWM A;  3U8E A;  1U9W A;  1XKG A;  2IPP B;  3BPF A;  4PAD A;  1YVB A;  3IUT A;  4XR7 A;  1SP4 B;  2DC8 A;  1BP4 A;  4K7C A;  2BDZ A;  3P5V A;  1F2A A;  3O1G A;  5EF4 A;  3B79 A;  1MEM A;  3ERV A;  4RY2 A;  1QOL A;  2NQG A;  4CDF B;  3ZUA A;  1PXV A;  4QRV A;  3CH3 X;  2BDL A;  1SNK A;  2ARY A;  4I04 A;  2AU1 A;  1VJV A;  3H7D A;  4OEL A;  2AYN A;  3S3Q A;  4X6H A;  1DF0 A;  1GMY A;  2PNS A;  1QMY A;  2H7J A;  5CVN B;  4YV8 A;  2P7U A;  3K9M A;  3IEJ A;  3OF8 A;  1F29 A;  1PBH A;  1YT7 A;  2B1M A;  1HUC B;  4KLB A;  4XUI A;  6PAD A;  2P86 A;  3C9E A;  4G54 A;  2HD5 A;  2G8E A;  3KW9 A;  3USV A;  2B1N A;  5J94 A;  1KHQ A;  3WXG A;  1AEC A;  1DEU A;  4CDD B;  1MIR A;  2IBI A;  3HD3 A;  4YYR A;  1ICF A;  3IOQ A;  3BC3 A;  2FUD A;  3CBK A;  3P5U A;  2DC9 A;  2E02 A;  1KXR A;  1Y4H A;  2YJ9 A;  3MHS A;  2E03 A;  3PBH A;  2YJ8 A;  1PPN A;  4CZW A;  3RVX A;  1CV8 A;  1ZIV A;  1ME4 A;  3H8B A;  3MOR A;  2NQD B;  4N79 A;  4HWY A;  3I3T A;  4W5B A;  1QXP A;  3PNR A;  3BCN A; 
#chains in the Genus database with same CATH topology
 1U9Q X;  3TNX A;  1NB5 A;  1Q6K A;  2C0Y A;  2R9C A;  4QBB A;  3MP2 A;  1A6R A;  1PPP A;  3I06 A;  4MZO A;  1AU4 A;  5JA7 A;  4P16 A;  2NQI A;  4BSQ A;  3H89 A;  1MDW A;  3NHE A;  2GFO A;  4YYU A;  2E00 A;  1KHP A;  4PI3 A;  2DCA A;  3BOW A;  1X9Y A;  2G8J A;  2P0R A;  3OVX A;  1ATK A;  4MSX A;  5CVM A;  1YAL A;  4QRX A;  3LFY A;  4PP2 E;  1MEG A;  5EZQ A;  2BTW A;  4GUA A;  2HXZ A;  1BY8 A;  5CVO B;  5KO3 A;  5E6J A;  1UKF A;  3V6E A;  1GEC E;  3OVZ A;  1NPZ A;  3KX1 A;  3PRM A;  1TU6 A;  2YJC A;  2JQF R;  1F2B A;  1U9V A;  3PSE A;  2FQ9 A;  2FTD A;  3N4C A;  1POP A;  2F7D A;  2O6X A;  4ZUX U;  3H6S A;  3O65 A;  2AGA A;  1MHW A;  1PCI A;  2AIM A;  4CDE B;  4D8B A;  4YVA A;  2GHU A;  2VHS A;  2NQA A;  2Z84 A;  1STF E;  2OUL A;  4ZTB A;  1YK7 A;  4FJC A;  3RVV A;  3KKU A;  3CH2 X;  4N4Z A;  3MTN A;  4HXD B;  4X6I A;  4N8W A;  4AXM A;  4BS5 A;  2PBH A;  1ME3 A;  1IWD A;  1AYW A;  4I05 A;  2F1G A;  1NB3 A;  2Y5B A;  1GCB A;  2AS8 A;  5JZE A;  2XU3 A;  1JQP A;  1Y08 A;  3N3G A;  4BOS A;  1U5I A;  1QDQ A;  4RF0 A;  2HHN A;  3WXF A;  3KWB X;  3PRP A;  3LXS A;  3PW3 A;  3HHA A;  4D8E A;  3GCB A;  4PP1 A;  4YYW A;  1CQD A;  3AI8 A;  2VHF A;  4CDC B;  5JH3 A;  3ZNH A;  9PAP A;  2DC6 A;  3O0U A;  3S3R A;  1AIM A;  3OIS A;  4BOU A;  4OVZ A;  5CHV A;  5EZS A;  1EWO A;  4I07 A;  2AYO A;  4M0W A;  3HHI A;  2R9M A;  2ATO A;  2DZY A;  3PDF A;  3QT4 A;  1TL9 A;  2XU1 A;  3D6S A;  4AXL A;  3F5V A;  4OVZ B;  2XU5 A;  2R9O A;  4YYV A;  1CVZ A;  4YYS A;  1FH0 A;  2FYE A;  4BQV A;  4RF1 A;  4IP3 A;  1M6D A;  2PAD A;  1AYU A;  2FE8 A;  3MHH A;  5FPW A;  1AU0 A;  1CB5 A;  3QSD A;  2YJB A;  1PIP A;  5K16 A;  2Y6E A;  3V6C A;  2HH5 A;  4IUM A;  1YK8 A;  4Q8G A;  2R9N A;  2YJ2 A;  2R6N A;  4DMY A;  2AUZ A;  3K8U A;  1EWP A;  3IFU A;  1O0E A;  4BPV A;  4Q8H A;  1CJL A;  3RVW A;  4QRG A;  8PCH A;  1TLO A;  3QJ3 A;  1CPJ A;  2G7Y A;  1MS6 A;  3IV2 A;  1DKI A;  4OEM A;  4QH6 A;  1NLJ A;  2FRQ A;  2AVW A;  2FRA A;  2ACT A;  3P5W A;  1CSB B;  1KFU L;  3TMP A;  2AUX A;  4FK5 A;  2DCB A;  3BPM A;  5CHT A;  4R3D A;  1PVJ A;  4RNA A;  4BS6 A;  3PHW A;  3W31 A;  4RKX A;  1YZB A;  4YYQ A;  4P6E A;  3E1Z B;  1AU2 A;  1PAD A;  2PRE A;  3IMA A;  2DJG B;  2JTC A;  1ITO A;  2FO5 A;  2CB5 A;  2WBF X;  2DC7 A;  5A24 A;  2DZZ A;  2XU4 A;  2JRI A;  3KFQ A;  2BTW B;  1NL6 A;  5F02 A;  5PAD A;  1THE A;  3MJ5 A;  1GLO A;  2OP3 A;  4MM3 B;  3IHP A;  1EWL A;  1KFX L;  5EGW A;  4MI7 A;  7PCK A;  4X6J A;  1BGO A;  2G6D A;  1CS8 A;  1CTE A;  3W30 A;  3M99 A;  1S4V A;  1PPO A;  2HWK A;  1AU3 A;  4BOZ A;  1BQI A;  4P6G A;  3WXE A;  3OF9 A;  4MZS A;  1PE6 A;  2JQG R;  1K3B B;  3N3K A;  3CBJ A;  4W5C A;  4DMX A;  4FIP A;  3HWN A;  1VSN A;  4D8I A;  2OZ2 A;  3E9S A;  1AYV A;  1PPD A;  3K24 A;  3BWK A;  3PHU A;  3PT2 A;  2DCD A;  1F2C A;  3KSE A;  1U9X A;  3DF0 A;  2DCC A;  4PT5 A;  3MTV A;  4W4U A;  3F75 A;  3P5X A;  3B21 A;  1EF7 A;  2CIO A;  2E01 A;  2R9F A;  1NQC A;  3H8C A;  1ZCM A;  2DJF B;  4WA6 A;  3KWZ A;  2FT2 A;  4REZ A;  1EWM A;  3U8E A;  1U9W A;  1XKG A;  2IPP B;  3BPF A;  3C0R A;  4PAD A;  1YVB A;  3IUT A;  4XR7 A;  3BY4 A;  1SP4 B;  2DC8 A;  2J7Q A;  3OQC A;  2BU3 A;  1BP4 A;  4K7C A;  2BDZ A;  3P5V A;  1F2A A;  3O1G A;  5EF4 A;  3B79 A;  1MEM A;  3ERV A;  4RY2 A;  1QOL A;  4A5U A;  2NQG A;  4CDF B;  3ZUA A;  1PXV A;  4QRV A;  3CH3 X;  2BDL A;  1SNK A;  2ARY A;  4I04 A;  2AU1 A;  1VJV A;  3H7D A;  4OEL A;  2AYN A;  3S3Q A;  4X6H A;  1DF0 A;  1GMY A;  2PNS A;  1QMY A;  2H7J A;  5CVN B;  4YV8 A;  2DOS A;  2P7U A;  3K9M A;  3IEJ A;  3OF8 A;  3RNV A;  1F29 A;  1PBH A;  1YT7 A;  2B1M A;  1HUC B;  4KLB A;  4XUI A;  6PAD A;  2P86 A;  3C9E A;  4G54 A;  2HD5 A;  2G8E A;  3KW9 A;  3USV A;  2B1N A;  5J94 A;  3PHX A;  3BB7 A;  4WUR A;  1KHQ A;  3WXG A;  1AEC A;  1DEU A;  4BOQ A;  2UZJ A;  4CDD B;  1MIR A;  2IBI A;  3HD3 A;  4YYR A;  1ICF A;  2J7Q C;  3TRK A;  3IOQ A;  3BC3 A;  4OW0 A;  2FUD A;  3BBA A;  3CBK A;  3P5U A;  2DC9 A;  2E02 A;  1KXR A;  1Y4H A;  2YJ9 A;  3MHS A;  2E03 A;  3PBH A;  2YJ8 A;  1PPN A;  4CZW A;  3RVX A;  1CV8 A;  1ZIV A;  1ME4 A;  3H8B A;  3MOR A;  2NQD B;  4BOP A;  4N79 A;  4HWY A;  4XZX A;  3I3T A;  4W5B A;  1QXP A;  3PNR A;  3BCN A; 
#chains in the Genus database with same CATH homology
 1U9Q X;  3TNX A;  1NB5 A;  1Q6K A;  2C0Y A;  2R9C A;  4QBB A;  1A6R A;  1PPP A;  3I06 A;  4MZO A;  1AU4 A;  5JA7 A;  2NQI A;  4BSQ A;  3H89 A;  1MDW A;  3NHE A;  2GFO A;  4C5P A;  4YYU A;  2E00 A;  1KHP A;  4PI3 A;  2DCA A;  3BOW A;  1X9Y A;  2G8J A;  2P0R A;  3OVX A;  1ATK A;  4MSX A;  5CVM A;  1YAL A;  4QRX A;  3LFY A;  4PP2 E;  1MEG A;  2HXZ A;  4GUZ A;  1BY8 A;  5CVO B;  3V6E A;  1GEC E;  3OVZ A;  1NPZ A;  3KX1 A;  1TU6 A;  2YJC A;  2JQF R;  1F2B A;  1U9V A;  2FQ9 A;  2FTD A;  3N4C A;  1POP A;  2F7D A;  2O6X A;  4ZUX U;  3H6S A;  1MHW A;  1PCI A;  2AIM A;  4CDE B;  4YVA A;  2GHU A;  2VHS A;  2NQA A;  1STF E;  2VFB A;  2OUL A;  1YK7 A;  4FJC A;  3RVV A;  3KKU A;  3CH2 X;  4N4Z A;  3MTN A;  4X6I A;  4N8W A;  4AXM A;  4BS5 A;  2PBH A;  1ME3 A;  1IWD A;  1AYW A;  4I05 A;  2F1G A;  1NB3 A;  2Y5B A;  1GCB A;  2AS8 A;  2XU3 A;  1JQP A;  1Y08 A;  3N3G A;  1U5I A;  1QDQ A;  2HHN A;  3WXF A;  3KWB X;  3LXS A;  3PW3 A;  3HHA A;  3GCB A;  4PP1 A;  4YYW A;  1CQD A;  1GX3 A;  3AI8 A;  2VHF A;  4CDC B;  5JH3 A;  9PAP A;  2DC6 A;  3O0U A;  3S3R A;  1AIM A;  3OIS A;  5CHV A;  1EWO A;  4I07 A;  2AYO A;  3HHI A;  2R9M A;  2ATO A;  2DZY A;  3PDF A;  3QT4 A;  1TL9 A;  2BSZ A;  2XU1 A;  3D6S A;  4AXL A;  3F5V A;  2XU5 A;  2R9O A;  4YYV A;  1CVZ A;  4YYS A;  1FH0 A;  2FYE A;  4BQV A;  1M6D A;  2PAD A;  1AYU A;  3MHH A;  5FPW A;  1AU0 A;  1CB5 A;  3QSD A;  2YJB A;  1PIP A;  5K16 A;  2Y6E A;  3V6C A;  1W5R A;  2HH5 A;  1YK8 A;  4Q8G A;  2R9N A;  2YJ2 A;  2R6N A;  4DMY A;  2AUZ A;  3K8U A;  1EWP A;  4B55 A;  1O0E A;  4BPV A;  4Q8H A;  1CJL A;  3RVW A;  4QRG A;  8PCH A;  1TLO A;  3QJ3 A;  1CPJ A;  2G7Y A;  1MS6 A;  1W6F A;  3IV2 A;  4QH6 A;  4OEM A;  1NLJ A;  2FRQ A;  2AVW A;  2FRA A;  2ACT A;  3P5W A;  1CSB B;  1KFU L;  2AUX A;  4FK5 A;  2DCB A;  3BPM A;  5CHT A;  1W4T A;  4BS6 A;  4YYQ A;  4P6E A;  3E1Z B;  1AU2 A;  1PAD A;  2PRE A;  3IMA A;  2DJG B;  1ITO A;  2FO5 A;  2CB5 A;  2WBF X;  2DC7 A;  5A24 A;  2DZZ A;  2XU4 A;  3KFQ A;  4NV7 A;  1NL6 A;  5F02 A;  5PAD A;  1THE A;  1GLO A;  2OP3 A;  3IHP A;  1EWL A;  1KFX L;  5EGW A;  7PCK A;  4X6J A;  1BGO A;  2G6D A;  1CS8 A;  1CTE A;  3M99 A;  1E2T A;  1S4V A;  1PPO A;  1AU3 A;  1BQI A;  4P6G A;  3WXE A;  3OF9 A;  4MZS A;  1PE6 A;  2JQG R;  1K3B B;  3N3K A;  4W5C A;  3CBJ A;  4DMX A;  4FIP A;  3HWN A;  1VSN A;  2OZ2 A;  2VFC A;  1AYV A;  1PPD A;  3K24 A;  3BWK A;  2DCD A;  1F2C A;  3KSE A;  1U9X A;  3DF0 A;  2DCC A;  4W4U A;  3F75 A;  3P5X A;  1EF7 A;  2CIO A;  2E01 A;  2R9F A;  1NQC A;  3H8C A;  1ZCM A;  2DJF B;  4WA6 A;  3KWZ A;  2FT2 A;  1EWM A;  3U8E A;  1U9W A;  1XKG A;  2IPP B;  3BPF A;  4BGF A;  4PAD A;  1YVB A;  3IUT A;  4XR7 A;  1SP4 B;  3LTW A;  2DC8 A;  1BP4 A;  4K7C A;  2BDZ A;  3P5V A;  1F2A A;  3O1G A;  5EF4 A;  3B79 A;  1MEM A;  3D9W A;  3ERV A;  4RY2 A;  1QOL A;  2NQG A;  4CDF B;  3ZUA A;  1PXV A;  4QRV A;  3CH3 X;  2BDL A;  1SNK A;  2ARY A;  4I04 A;  2AU1 A;  1VJV A;  3H7D A;  4OEL A;  2AYN A;  3S3Q A;  4X6H A;  1DF0 A;  1GMY A;  2PNS A;  1QMY A;  2H7J A;  5CVN B;  4YV8 A;  2P7U A;  3K9M A;  3IEJ A;  3OF8 A;  1F29 A;  1PBH A;  1YT7 A;  2B1M A;  1HUC B;  4KLB A;  4XUI A;  6PAD A;  2P86 A;  3C9E A;  4G54 A;  2HD5 A;  2G8E A;  3KW9 A;  3USV A;  2B1N A;  5J94 A;  1KHQ A;  3WXG A;  1AEC A;  1DEU A;  4CDD B;  1MIR A;  2IBI A;  3HD3 A;  4YYR A;  1ICF A;  3IOQ A;  3BC3 A;  2FUD A;  3CBK A;  3P5U A;  2DC9 A;  2E02 A;  1KXR A;  1Y4H A;  2YJ9 A;  3MHS A;  2E03 A;  3PBH A;  2YJ8 A;  1PPN A;  4CZW A;  3RVX A;  4NV8 A;  1CV8 A;  1ZIV A;  1ME4 A;  3H8B A;  3MOR A;  2NQD B;  4N79 A;  4HWY A;  3I3T A;  4W5B A;  1QXP A;  3PNR A;  3BCN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...