3N3GA

4-(3-trifluoromethylphenyl)-pyrimidine-2-carbonitrile as cathepsin s inhibitors: n3, not n1 is critically important
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
217
structure length
217
Chain Sequence
LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin S
publication title 4-(3-Trifluoromethylphenyl)-pyrimidine-2-carbonitrile as cathepsin S inhibitors: N3, not N1 is critically important.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 70
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2010-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3n3gA00
2XU5A 1CTEA 5EF4A 2R9MA 4YYWA 4I07A 2PBHA 1M6DA 3QT4A 3MHHA 3CBJA 1CSBB 1TLOA 1VSNA 1CS8A 2DCAA 7PCKA 3MTNA 1ME4A 3F75A 3HHIA 3N3KA 4KLBA 3K8UA 1STFE 1CQDA 1F29A 1NPZA 3N3GA 4BS5A 3QJ3A 3H8CA 3IOQA 2R9NA 1EWLA 1PCIA 2DCCA 2AU1A 2DJGB 4OELA 2R9OA 3PNRA 1PPPA 4ZUXU 1PPOA 2DC6A 4YYVA 1AU2A 5CHTA 3ZUAA 1BQIA 2VHSA 4N79A 1DEUA 2P86A 2P0RA 1YK7A 1JQPA 1AU3A 1DF0A 4Q8HA 3QSDA 3P5UA 4P6EA 1MS6A 2NQDB 3S3RA 1S4VA 2YJ2A 1F2BA 1NL6A 3I3TA 1AYWA 1PADA 2AYOA 2PREA 3H8BA 1U9QX 3P5WA 2FTDA 3KFQA 3H6SA 2ACTA 5JA7A 4YYUA 4W4UA 3PDFA 2FO5A 2B1NA 3V6CA 1MHWA 4YYSA 3OF9A 2G8JA 1AU4A 3LFYA 1AECA 1QDQA 2YJ9A 4XR7A 1NB3A 1KXRA 3IV2A 1PE6A 3CH2X 1BP4A 1AIMA 1YK8A 2ATOA 1CJLA 2DC7A 2OULA 4QRGA 2AYNA 3PW3A 1QOLA 3HHAA 1MDWA 1ME3A 2G6DA 1A6RA 1NLJA 1F2CA 4X6JA 4QRVA 1Q6KA 2FYEA 4DMXA 3ERVA 9PAPA 2R9CA 4BSQA 2WBFX 3P5XA 3TNXA 5CVOB 2XU4A 2E01A 1ITOA 2OZ2A 4N8WA 3C9EA 1YALA 1ICFA 4K7CA 4CZWA 1KHPA 6PADA 3BCNA 4CDDB 3M99A 3N4CA 1ZCMA 3LXSA 3O0UA 1MEGA 3KW9A 2R9FA 4DMYA 5CVNB 1AYVA 1Y08A 4CDEB 2CB5A 1O0EA 1Y4HA 4I04A 3IMAA 3OISA 2JQFR 2HD5A 1BY8A 2DZZA 1U9WA 2E03A 3GCBA 3F5VA 8PCHA 2H7JA 3BPFA 4G54A 3B79A 2HHNA 4OEMA 4AXMA 3BOWA 2AS8A 3RVWA 1EWPA 1YVBA 3E1ZB 2AVWA 1BGOA 4FIPA 4N4ZA 1TL9A 2GHUA 1FH0A 1SP4B 1PIPA 4QBBA 4MZOA 3RVXA 3H7DA 4BS6A 3WXFA 1MEMA 3NHEA 2NQIA 5J94A 1TU6A 2AUZA 1K3BB 2YJBA 1GECE 1QXPA 2BDLA 1NB5A 4W5BA 3DF0A 2HXZA 1ATKA 4YYQA 2JQGR 1KFXL 4QRXA 3O1GA 3U8EA 3USVA 2OP3A 4X6HA 1GMYA 1QMYA 2Y6EA 2DC8A 2F1GA 1U5IA 3BWKA 1CPJA 1X9YA 5PADA 2AUXA 2DCDA 1PXVA 2DC9A 5JH3A 2IPPB 3K24A 2DJFB 2E02A 5F02A 2DZYA 1U9XA 4PP1A 3MHSA 1NQCA 4MZSA 1SNKA 2CIOA 4AXLA 5CVMA 3P5VA 3MORA 2O6XA 2IBIA 3I06A 3OVZA 1CB5A 3PBHA 2GFOA 3KSEA 1EWOA 1KHQA 1AU0A 2FRQA 2PNSA 4YV8A 3AI8A 1MIRA 4YVAA 3BC3A 2Y5BA 4PI3A 4RY2A 4MSXA 1GCBA 2G7YA 2VHFA 3S3QA 4PADA 1ZIVA 1AYUA 3KWBX 5CHVA 2YJ8A 4FK5A 3KWZA 1PBHA 1EWMA 1U9VA 3RVVA 5A24A 3OF8A 4WA6A 2NQGA 1PPDA 2R6NA 5K16A 3CBKA 1CV8A 5FPWA 3OVXA 4W5CA 2XU1A 1F2AA 2XU3A 1CVZA 3D6SA 3IUTA 1PPNA 2BDZA 4Q8GA 2FRAA 4CDCB 2NQAA 3H89A 4XUIA 4BQVA 2HH5A 2DCBA 3IHPA 4I05A 1GLOA 1XKGA 2G8EA 2C0YA 4X6IA 3CH3X 5EGWA 4FJCA 2FUDA 3KKUA 4YYRA 1POPA 2AIMA 2B1MA 2ARYA 2FQ9A 3WXEA 3V6EA 3HWNA 1KFUL 2YJCA 4BPVA 4QH6A 1EF7A 1HUCB 2P7UA 3K9MA 3HD3A 2F7DA 4CDFB 3KX1A 2E00A 3WXGA 1YT7A 4PP2E 1IWDA 4P6GA 1VJVA 2PADA 1THEA 4HWYA 3BPMA 3IEJA 2FT2A
chains in the Genus database with same CATH superfamily
2XU5A 1CTEA 5EF4A 2R9MA 4YYWA 2J7QC 2PBHA 4I07A 1M6DA 3QT4A 3MHHA 3CBJA 1CSBB 1TLOA 3BB7A 1VSNA 1CS8A 2DCAA 7PCKA 3MTNA 1ME4A 3F75A 3HHIA 3N3KA 4KLBA 3K8UA 1STFE 1CQDA 1F29A 1NPZA 3N3GA 4BS5A 3QJ3A 3H8CA 3IOQA 2R9NA 1EWLA 4BOSA 1PCIA 3PHUA 2DCCA 2AU1A 2DJGB 4BOPA 4OELA 2R9OA 2HWKA 4R3DA 3TMPA 3PNRA 1PPPA 4ZUXU 1PPOA 2DC6A 4YYVA 1AU2A 5CHTA 3ZUAA 1BQIA 2VHSA 4N79A 1DEUA 2P86A 2P0RA 1YK7A 3O65A 1JQPA 3W30A 1AU3A 1DF0A 2FE8A 4Q8HA 3QSDA 3PT2A 3P5UA 4P6EA 3BY4A 1MS6A 3PHWA 2NQDB 3S3RA 1S4VA 2YJ2A 1F2BA 1NL6A 3I3TA 4M0WA 2AGAA 1AYWA 1PADA 2AYOA 2PREA 3H8BA 4RNAA 4D8BA 1U9QX 3P5WA 4P16A 2FTDA 3MJ5A 3KFQA 4D8IA 3H6SA 2ACTA 4OW0A 5JA7A 4YYUA 4W4UA 3PDFA 2FO5A 2B1NA 3V6CA 1MHWA 4YYSA 3OF9A 2G8JA 1AU4A 3LFYA 1AECA 1QDQA 2Z84A 2YJ9A 4XR7A 3MP2A 4ZTBA 1NB3A 1KXRA 3IV2A 1PE6A 3CH2X 1BP4A 1AIMA 1YK8A 2BTWB 2ATOA 1CJLA 2DC7A 2OULA 4QRGA 2AYNA 3PW3A 1QOLA 3HHAA 1MDWA 3W31A 1ME3A 2G6DA 1A6RA 1NLJA 1F2CA 4X6JA 4QRVA 3C0RA 1Q6KA 2FYEA 4DMXA 3ERVA 9PAPA 2R9CA 4BSQA 2WBFX 3P5XA 3TNXA 5CVOB 2XU4A 4OVZB 2E01A 1ITOA 2OZ2A 4N8WA 4BOUA 5KO3A 3C9EA 1YALA 1ICFA 4K7CA 4CZWA 1KHPA 6PADA 3BCNA 4CDDB 3M99A 3N4CA 1DKIA 1ZCMA 3LXSA 3O0UA 1MEGA 3KW9A 2R9FA 4DMYA 5CVNB 1AYVA 1Y08A 4CDEB 2CB5A 1O0EA 1Y4HA 4I04A 1YZBA 3IMAA 4HXDB 3OISA 2JQFR 2HD5A 3TRKA 1BY8A 2DZZA 1U9WA 2E03A 3GCBA 3F5VA 8PCHA 4MI7A 3B21A 2H7JA 3BPFA 4G54A 3B79A 2HHNA 4OEMA 4AXMA 3BOWA 2AS8A 3RVWA 1EWPA 1YVBA 3E1ZB 2AVWA 1BGOA 4FIPA 4REZA 4N4ZA 1TL9A 2GHUA 1FH0A 1SP4B 1PIPA 4QBBA 5EZSA 4MZOA 3RVXA 3H7DA 4BS6A 3WXFA 1MEMA 3NHEA 2NQIA 5J94A 3MTVA 1TU6A 2AUZA 1K3BB 2YJBA 1GECE 1QXPA 2BDLA 4RF1A 1NB5A 4W5BA 3DF0A 2HXZA 1ATKA 4YYQA 2JQGR 1KFXL 4QRXA 3O1GA 3U8EA 2BTWA 3USVA 2OP3A 4X6HA 1GMYA 1QMYA 2Y6EA 2DC8A 2F1GA 1U5IA 3BWKA 1CPJA 1X9YA 5PADA 2AUXA 2DCDA 1PXVA 2DC9A 2J7QA 5JH3A 2IPPB 3K24A 2DJFB 2E02A 5F02A 3PSEA 3PRPA 2DZYA 1U9XA 4PP1A 3MHSA 3ZNHA 1NQCA 4MZSA 1SNKA 2CIOA 4OVZA 4AXLA 5CVMA 3P5VA 3MORA 2O6XA 4A5UA 2IBIA 3I06A 3OVZA 1CB5A 3PBHA 2GFOA 5JZEA 3KSEA 1EWOA 3IFUA 3PRMA 1KHQA 1AU0A 2FRQA 2PNSA 4YV8A 3AI8A 1MIRA 4YVAA 1PVJA 3BC3A 2JTCA 2UZJA 2Y5BA 4PI3A 4RY2A 4MSXA 1GCBA 3OQCA 2G7YA 2VHFA 4IUMA 3S3QA 4PADA 1ZIVA 4RF0A 1AYUA 3KWBX 5CHVA 4XZXA 2YJ8A 4FK5A 3KWZA 1PBHA 1EWMA 1U9VA 3RVVA 5A24A 3OF8A 4WA6A 2NQGA 1PPDA 5E6JA 2R6NA 5K16A 2BU3A 3CBKA 1CV8A 5FPWA 3OVXA 4W5CA 2XU1A 1F2AA 2XU3A 4BOQA 1CVZA 3D6SA 3IUTA 4MM3B 1PPNA 2BDZA 4RKXA 4Q8GA 2FRAA 4CDCB 4GUAA 2NQAA 3H89A 4PT5A 4XUIA 4BQVA 2HH5A 2DCBA 3IHPA 4I05A 1GLOA 1XKGA 2G8EA 2C0YA 4X6IA 3CH3X 5EGWA 3PHXA 2DOSA 4FJCA 2FUDA 3KKUA 5EZQA 4BOZA 4YYRA 1POPA 2AIMA 2B1MA 2ARYA 2FQ9A 4IP3A 3WXEA 3V6EA 3HWNA 1KFUL 2YJCA 4BPVA 4QH6A 1UKFA 3E9SA 1EF7A 1HUCB 2P7UA 3BBAA 3K9MA 3HD3A 4WURA 2F7DA 4CDFB 3KX1A 2E00A 2JRIA 3WXGA 1YT7A 4PP2E 1IWDA 4P6GA 1VJVA 2PADA 1THEA 4HWYA 3BPMA 3IEJA 4D8EA 3RNVA 2FT2A
chains in the Genus database with same CATH topology
3D9WA 2XU5A 1CTEA 5EF4A 2R9MA 4YYWA 4I07A 2PBHA 1M6DA 3QT4A 3MHHA 1GX3A 3CBJA 1CSBB 1TLOA 1VSNA 1CS8A 2DCAA 7PCKA 3MTNA 1ME4A 3F75A 3HHIA 3N3KA 4KLBA 3K8UA 1STFE 1CQDA 1F29A 1NPZA 3N3GA 4GUZA 4BS5A 3QJ3A 3H8CA 3IOQA 2R9NA 1EWLA 1PCIA 2DCCA 2AU1A 2DJGB 4OELA 2R9OA 3PNRA 1PPPA 4ZUXU 1PPOA 2DC6A 4YYVA 1AU2A 5CHTA 3ZUAA 1BQIA 2VHSA 4N79A 1DEUA 2P86A 2P0RA 1YK7A 1JQPA 1AU3A 1DF0A 4Q8HA 1W6FA 3QSDA 3P5UA 4P6EA 1MS6A 2NQDB 3S3RA 1S4VA 2YJ2A 1F2BA 1NL6A 3I3TA 1AYWA 1PADA 2AYOA 2PREA 3H8BA 1U9QX 3P5WA 2FTDA 3KFQA 3H6SA 2ACTA 3LTWA 5JA7A 4YYUA 4W4UA 3PDFA 2FO5A 2B1NA 3V6CA 1MHWA 4YYSA 3OF9A 2G8JA 1AU4A 3LFYA 1AECA 1QDQA 2YJ9A 4XR7A 1NB3A 1KXRA 3IV2A 1PE6A 3CH2X 1BP4A 1AIMA 1YK8A 2ATOA 1W5RA 1CJLA 2VFBA 1E2TA 2DC7A 2OULA 4QRGA 2AYNA 3PW3A 1QOLA 3HHAA 1MDWA 1ME3A 2G6DA 1A6RA 1NLJA 1F2CA 4X6JA 4QRVA 2BSZA 1Q6KA 2FYEA 4DMXA 3ERVA 9PAPA 2R9CA 4BSQA 2WBFX 3P5XA 3TNXA 5CVOB 2XU4A 2E01A 1ITOA 2OZ2A 4N8WA 3C9EA 1YALA 1ICFA 4K7CA 4CZWA 1KHPA 6PADA 3BCNA 4CDDB 3M99A 3N4CA 1ZCMA 3LXSA 3O0UA 1MEGA 3KW9A 2R9FA 4DMYA 4NV8A 5CVNB 1AYVA 1Y08A 4CDEB 2CB5A 1O0EA 1Y4HA 4I04A 3IMAA 3OISA 2JQFR 2HD5A 1BY8A 2DZZA 4C5PA 1U9WA 2E03A 3GCBA 3F5VA 8PCHA 2H7JA 3BPFA 4G54A 3B79A 2HHNA 4OEMA 4AXMA 3BOWA 2AS8A 3RVWA 1EWPA 1YVBA 3E1ZB 1W4TA 2AVWA 1BGOA 4FIPA 4N4ZA 1TL9A 2GHUA 4B55A 1FH0A 1SP4B 1PIPA 4QBBA 4MZOA 3RVXA 3H7DA 4BS6A 3WXFA 1MEMA 3NHEA 2NQIA 5J94A 1TU6A 2AUZA 1K3BB 2YJBA 1GECE 1QXPA 2BDLA 1NB5A 4W5BA 3DF0A 2HXZA 1ATKA 4YYQA 2JQGR 1KFXL 4QRXA 3O1GA 3U8EA 3USVA 2OP3A 4X6HA 1GMYA 1QMYA 2Y6EA 2DC8A 2F1GA 1U5IA 3BWKA 1CPJA 4BGFA 1X9YA 5PADA 2AUXA 2DCDA 1PXVA 2DC9A 5JH3A 2IPPB 3K24A 2DJFB 2E02A 5F02A 2DZYA 1U9XA 4PP1A 3MHSA 2VFCA 1NQCA 4MZSA 1SNKA 2CIOA 4AXLA 5CVMA 3P5VA 3MORA 2O6XA 2IBIA 3I06A 3OVZA 1CB5A 3PBHA 2GFOA 3KSEA 1EWOA 1KHQA 1AU0A 2FRQA 2PNSA 4YV8A 3AI8A 1MIRA 4YVAA 3BC3A 2Y5BA 4PI3A 4RY2A 4MSXA 1GCBA 2G7YA 2VHFA 3S3QA 4NV7A 4PADA 1ZIVA 1AYUA 3KWBX 5CHVA 2YJ8A 4FK5A 3KWZA 1PBHA 1EWMA 1U9VA 3RVVA 5A24A 3OF8A 4WA6A 2NQGA 1PPDA 2R6NA 5K16A 3CBKA 1CV8A 5FPWA 3OVXA 4W5CA 2XU1A 1F2AA 2XU3A 1CVZA 3D6SA 3IUTA 1PPNA 2BDZA 4Q8GA 2FRAA 4CDCB 2NQAA 3H89A 4XUIA 4BQVA 2HH5A 2DCBA 3IHPA 4I05A 1GLOA 1XKGA 2G8EA 2C0YA 4X6IA 3CH3X 5EGWA 4FJCA 2FUDA 3KKUA 4YYRA 1POPA 2AIMA 2B1MA 2ARYA 2FQ9A 3WXEA 3V6EA 3HWNA 1KFUL 2YJCA 4BPVA 4QH6A 1EF7A 1HUCB 2P7UA 3K9MA 3HD3A 2F7DA 4CDFB 3KX1A 2E00A 3WXGA 1YT7A 4PP2E 1IWDA 4P6GA 1VJVA 2PADA 1THEA 4HWYA 3BPMA 3IEJA 2FT2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XU5 A;  1CTE A;  5EF4 A;  2R9M A;  4YYW A;  4I07 A;  2PBH A;  1M6D A;  3QT4 A;  3MHH A;  3CBJ A;  1CSB B;  1TLO A;  1VSN A;  1CS8 A;  2DCA A;  7PCK A;  3MTN A;  1ME4 A;  3F75 A;  3HHI A;  3N3K A;  4KLB A;  3K8U A;  1STF E;  1CQD A;  1F29 A;  1NPZ A;  3N3G A;  4BS5 A;  3QJ3 A;  3H8C A;  3IOQ A;  2R9N A;  1EWL A;  1PCI A;  2DCC A;  2AU1 A;  2DJG B;  4OEL A;  2R9O A;  3PNR A;  1PPP A;  4ZUX U;  1PPO A;  2DC6 A;  4YYV A;  1AU2 A;  5CHT A;  3ZUA A;  1BQI A;  2VHS A;  4N79 A;  1DEU A;  2P86 A;  2P0R A;  1YK7 A;  1JQP A;  1AU3 A;  1DF0 A;  4Q8H A;  3QSD A;  3P5U A;  4P6E A;  1MS6 A;  2NQD B;  3S3R A;  1S4V A;  2YJ2 A;  1F2B A;  1NL6 A;  3I3T A;  1AYW A;  1PAD A;  2AYO A;  2PRE A;  3H8B A;  1U9Q X;  3P5W A;  2FTD A;  3KFQ A;  3H6S A;  2ACT A;  5JA7 A;  4YYU A;  4W4U A;  3PDF A;  2FO5 A;  2B1N A;  3V6C A;  1MHW A;  4YYS A;  3OF9 A;  2G8J A;  1AU4 A;  3LFY A;  1AEC A;  1QDQ A;  2YJ9 A;  4XR7 A;  1NB3 A;  1KXR A;  3IV2 A;  1PE6 A;  3CH2 X;  1BP4 A;  1AIM A;  1YK8 A;  2ATO A;  1CJL A;  2DC7 A;  2OUL A;  4QRG A;  2AYN A;  3PW3 A;  1QOL A;  3HHA A;  1MDW A;  1ME3 A;  2G6D A;  1A6R A;  1NLJ A;  1F2C A;  4X6J A;  4QRV A;  1Q6K A;  2FYE A;  4DMX A;  3ERV A;  9PAP A;  2R9C A;  4BSQ A;  2WBF X;  3P5X A;  3TNX A;  5CVO B;  2XU4 A;  2E01 A;  1ITO A;  2OZ2 A;  4N8W A;  3C9E A;  1YAL A;  1ICF A;  4K7C A;  4CZW A;  1KHP A;  6PAD A;  3BCN A;  4CDD B;  3M99 A;  3N4C A;  1ZCM A;  3LXS A;  3O0U A;  1MEG A;  3KW9 A;  2R9F A;  4DMY A;  5CVN B;  1AYV A;  1Y08 A;  4CDE B;  2CB5 A;  1O0E A;  1Y4H A;  4I04 A;  3IMA A;  3OIS A;  2JQF R;  2HD5 A;  1BY8 A;  2DZZ A;  1U9W A;  2E03 A;  3GCB A;  3F5V A;  8PCH A;  2H7J A;  3BPF A;  4G54 A;  3B79 A;  2HHN A;  4OEM A;  4AXM A;  3BOW A;  2AS8 A;  3RVW A;  1EWP A;  1YVB A;  3E1Z B;  2AVW A;  1BGO A;  4FIP A;  4N4Z A;  1TL9 A;  2GHU A;  1FH0 A;  1SP4 B;  1PIP A;  4QBB A;  4MZO A;  3RVX A;  3H7D A;  4BS6 A;  3WXF A;  1MEM A;  3NHE A;  2NQI A;  5J94 A;  1TU6 A;  2AUZ A;  1K3B B;  2YJB A;  1GEC E;  1QXP A;  2BDL A;  1NB5 A;  4W5B A;  3DF0 A;  2HXZ A;  1ATK A;  4YYQ A;  2JQG R;  1KFX L;  4QRX A;  3O1G A;  3U8E A;  3USV A;  2OP3 A;  4X6H A;  1GMY A;  1QMY A;  2Y6E A;  2DC8 A;  2F1G A;  1U5I A;  3BWK A;  1CPJ A;  1X9Y A;  5PAD A;  2AUX A;  2DCD A;  1PXV A;  2DC9 A;  5JH3 A;  2IPP B;  3K24 A;  2DJF B;  2E02 A;  5F02 A;  2DZY A;  1U9X A;  4PP1 A;  3MHS A;  1NQC A;  4MZS A;  1SNK A;  2CIO A;  4AXL A;  5CVM A;  3P5V A;  3MOR A;  2O6X A;  2IBI A;  3I06 A;  3OVZ A;  1CB5 A;  3PBH A;  2GFO A;  3KSE A;  1EWO A;  1KHQ A;  1AU0 A;  2FRQ A;  2PNS A;  4YV8 A;  3AI8 A;  1MIR A;  4YVA A;  3BC3 A;  2Y5B A;  4PI3 A;  4RY2 A;  4MSX A;  1GCB A;  2G7Y A;  2VHF A;  3S3Q A;  4PAD A;  1ZIV A;  1AYU A;  3KWB X;  5CHV A;  2YJ8 A;  4FK5 A;  3KWZ A;  1PBH A;  1EWM A;  1U9V A;  3RVV A;  5A24 A;  3OF8 A;  4WA6 A;  2NQG A;  1PPD A;  2R6N A;  5K16 A;  3CBK A;  1CV8 A;  5FPW A;  3OVX A;  4W5C A;  2XU1 A;  1F2A A;  2XU3 A;  1CVZ A;  3D6S A;  3IUT A;  1PPN A;  2BDZ A;  4Q8G A;  2FRA A;  4CDC B;  2NQA A;  3H89 A;  4XUI A;  4BQV A;  2HH5 A;  2DCB A;  3IHP A;  4I05 A;  1GLO A;  1XKG A;  2G8E A;  2C0Y A;  4X6I A;  3CH3 X;  5EGW A;  4FJC A;  2FUD A;  3KKU A;  4YYR A;  1POP A;  2AIM A;  2B1M A;  2ARY A;  2FQ9 A;  3WXE A;  3V6E A;  3HWN A;  1KFU L;  2YJC A;  4BPV A;  4QH6 A;  1EF7 A;  1HUC B;  2P7U A;  3K9M A;  3HD3 A;  2F7D A;  4CDF B;  3KX1 A;  2E00 A;  3WXG A;  1YT7 A;  4PP2 E;  1IWD A;  4P6G A;  1VJV A;  2PAD A;  1THE A;  4HWY A;  3BPM A;  3IEJ A;  2FT2 A; 
#chains in the Genus database with same CATH topology
 2XU5 A;  1CTE A;  5EF4 A;  2R9M A;  4YYW A;  2J7Q C;  2PBH A;  4I07 A;  1M6D A;  3QT4 A;  3MHH A;  3CBJ A;  1CSB B;  1TLO A;  3BB7 A;  1VSN A;  1CS8 A;  2DCA A;  7PCK A;  3MTN A;  1ME4 A;  3F75 A;  3HHI A;  3N3K A;  4KLB A;  3K8U A;  1STF E;  1CQD A;  1F29 A;  1NPZ A;  3N3G A;  4BS5 A;  3QJ3 A;  3H8C A;  3IOQ A;  2R9N A;  1EWL A;  4BOS A;  1PCI A;  3PHU A;  2DCC A;  2AU1 A;  2DJG B;  4BOP A;  4OEL A;  2R9O A;  2HWK A;  4R3D A;  3TMP A;  3PNR A;  1PPP A;  4ZUX U;  1PPO A;  2DC6 A;  4YYV A;  1AU2 A;  5CHT A;  3ZUA A;  1BQI A;  2VHS A;  4N79 A;  1DEU A;  2P86 A;  2P0R A;  1YK7 A;  3O65 A;  1JQP A;  3W30 A;  1AU3 A;  1DF0 A;  2FE8 A;  4Q8H A;  3QSD A;  3PT2 A;  3P5U A;  4P6E A;  3BY4 A;  1MS6 A;  3PHW A;  2NQD B;  3S3R A;  1S4V A;  2YJ2 A;  1F2B A;  1NL6 A;  3I3T A;  4M0W A;  2AGA A;  1AYW A;  1PAD A;  2AYO A;  2PRE A;  3H8B A;  4RNA A;  4D8B A;  1U9Q X;  3P5W A;  4P16 A;  2FTD A;  3MJ5 A;  3KFQ A;  4D8I A;  3H6S A;  2ACT A;  4OW0 A;  5JA7 A;  4YYU A;  4W4U A;  3PDF A;  2FO5 A;  2B1N A;  3V6C A;  1MHW A;  4YYS A;  3OF9 A;  2G8J A;  1AU4 A;  3LFY A;  1AEC A;  1QDQ A;  2Z84 A;  2YJ9 A;  4XR7 A;  3MP2 A;  4ZTB A;  1NB3 A;  1KXR A;  3IV2 A;  1PE6 A;  3CH2 X;  1BP4 A;  1AIM A;  1YK8 A;  2BTW B;  2ATO A;  1CJL A;  2DC7 A;  2OUL A;  4QRG A;  2AYN A;  3PW3 A;  1QOL A;  3HHA A;  1MDW A;  3W31 A;  1ME3 A;  2G6D A;  1A6R A;  1NLJ A;  1F2C A;  4X6J A;  4QRV A;  3C0R A;  1Q6K A;  2FYE A;  4DMX A;  3ERV A;  9PAP A;  2R9C A;  4BSQ A;  2WBF X;  3P5X A;  3TNX A;  5CVO B;  2XU4 A;  4OVZ B;  2E01 A;  1ITO A;  2OZ2 A;  4N8W A;  4BOU A;  5KO3 A;  3C9E A;  1YAL A;  1ICF A;  4K7C A;  4CZW A;  1KHP A;  6PAD A;  3BCN A;  4CDD B;  3M99 A;  3N4C A;  1DKI A;  1ZCM A;  3LXS A;  3O0U A;  1MEG A;  3KW9 A;  2R9F A;  4DMY A;  5CVN B;  1AYV A;  1Y08 A;  4CDE B;  2CB5 A;  1O0E A;  1Y4H A;  4I04 A;  1YZB A;  3IMA A;  4HXD B;  3OIS A;  2JQF R;  2HD5 A;  3TRK A;  1BY8 A;  2DZZ A;  1U9W A;  2E03 A;  3GCB A;  3F5V A;  8PCH A;  4MI7 A;  3B21 A;  2H7J A;  3BPF A;  4G54 A;  3B79 A;  2HHN A;  4OEM A;  4AXM A;  3BOW A;  2AS8 A;  3RVW A;  1EWP A;  1YVB A;  3E1Z B;  2AVW A;  1BGO A;  4FIP A;  4REZ A;  4N4Z A;  1TL9 A;  2GHU A;  1FH0 A;  1SP4 B;  1PIP A;  4QBB A;  5EZS A;  4MZO A;  3RVX A;  3H7D A;  4BS6 A;  3WXF A;  1MEM A;  3NHE A;  2NQI A;  5J94 A;  3MTV A;  1TU6 A;  2AUZ A;  1K3B B;  2YJB A;  1GEC E;  1QXP A;  2BDL A;  4RF1 A;  1NB5 A;  4W5B A;  3DF0 A;  2HXZ A;  1ATK A;  4YYQ A;  2JQG R;  1KFX L;  4QRX A;  3O1G A;  3U8E A;  2BTW A;  3USV A;  2OP3 A;  4X6H A;  1GMY A;  1QMY A;  2Y6E A;  2DC8 A;  2F1G A;  1U5I A;  3BWK A;  1CPJ A;  1X9Y A;  5PAD A;  2AUX A;  2DCD A;  1PXV A;  2DC9 A;  2J7Q A;  5JH3 A;  2IPP B;  3K24 A;  2DJF B;  2E02 A;  5F02 A;  3PSE A;  3PRP A;  2DZY A;  1U9X A;  4PP1 A;  3MHS A;  3ZNH A;  1NQC A;  4MZS A;  1SNK A;  2CIO A;  4OVZ A;  4AXL A;  5CVM A;  3P5V A;  3MOR A;  2O6X A;  4A5U A;  2IBI A;  3I06 A;  3OVZ A;  1CB5 A;  3PBH A;  2GFO A;  5JZE A;  3KSE A;  1EWO A;  3IFU A;  3PRM A;  1KHQ A;  1AU0 A;  2FRQ A;  2PNS A;  4YV8 A;  3AI8 A;  1MIR A;  4YVA A;  1PVJ A;  3BC3 A;  2JTC A;  2UZJ A;  2Y5B A;  4PI3 A;  4RY2 A;  4MSX A;  1GCB A;  3OQC A;  2G7Y A;  2VHF A;  4IUM A;  3S3Q A;  4PAD A;  1ZIV A;  4RF0 A;  1AYU A;  3KWB X;  5CHV A;  4XZX A;  2YJ8 A;  4FK5 A;  3KWZ A;  1PBH A;  1EWM A;  1U9V A;  3RVV A;  5A24 A;  3OF8 A;  4WA6 A;  2NQG A;  1PPD A;  5E6J A;  2R6N A;  5K16 A;  2BU3 A;  3CBK A;  1CV8 A;  5FPW A;  3OVX A;  4W5C A;  2XU1 A;  1F2A A;  2XU3 A;  4BOQ A;  1CVZ A;  3D6S A;  3IUT A;  4MM3 B;  1PPN A;  2BDZ A;  4RKX A;  4Q8G A;  2FRA A;  4CDC B;  4GUA A;  2NQA A;  3H89 A;  4PT5 A;  4XUI A;  4BQV A;  2HH5 A;  2DCB A;  3IHP A;  4I05 A;  1GLO A;  1XKG A;  2G8E A;  2C0Y A;  4X6I A;  3CH3 X;  5EGW A;  3PHX A;  2DOS A;  4FJC A;  2FUD A;  3KKU A;  5EZQ A;  4BOZ A;  4YYR A;  1POP A;  2AIM A;  2B1M A;  2ARY A;  2FQ9 A;  4IP3 A;  3WXE A;  3V6E A;  3HWN A;  1KFU L;  2YJC A;  4BPV A;  4QH6 A;  1UKF A;  3E9S A;  1EF7 A;  1HUC B;  2P7U A;  3BBA A;  3K9M A;  3HD3 A;  4WUR A;  2F7D A;  4CDF B;  3KX1 A;  2E00 A;  2JRI A;  3WXG A;  1YT7 A;  4PP2 E;  1IWD A;  4P6G A;  1VJV A;  2PAD A;  1THE A;  4HWY A;  3BPM A;  3IEJ A;  4D8E A;  3RNV A;  2FT2 A; 
#chains in the Genus database with same CATH homology
 3D9W A;  2XU5 A;  1CTE A;  5EF4 A;  2R9M A;  4YYW A;  4I07 A;  2PBH A;  1M6D A;  3QT4 A;  3MHH A;  1GX3 A;  3CBJ A;  1CSB B;  1TLO A;  1VSN A;  1CS8 A;  2DCA A;  7PCK A;  3MTN A;  1ME4 A;  3F75 A;  3HHI A;  3N3K A;  4KLB A;  3K8U A;  1STF E;  1CQD A;  1F29 A;  1NPZ A;  3N3G A;  4GUZ A;  4BS5 A;  3QJ3 A;  3H8C A;  3IOQ A;  2R9N A;  1EWL A;  1PCI A;  2DCC A;  2AU1 A;  2DJG B;  4OEL A;  2R9O A;  3PNR A;  1PPP A;  4ZUX U;  1PPO A;  2DC6 A;  4YYV A;  1AU2 A;  5CHT A;  3ZUA A;  1BQI A;  2VHS A;  4N79 A;  1DEU A;  2P86 A;  2P0R A;  1YK7 A;  1JQP A;  1AU3 A;  1DF0 A;  4Q8H A;  1W6F A;  3QSD A;  3P5U A;  4P6E A;  1MS6 A;  2NQD B;  3S3R A;  1S4V A;  2YJ2 A;  1F2B A;  1NL6 A;  3I3T A;  1AYW A;  1PAD A;  2AYO A;  2PRE A;  3H8B A;  1U9Q X;  3P5W A;  2FTD A;  3KFQ A;  3H6S A;  2ACT A;  3LTW A;  5JA7 A;  4YYU A;  4W4U A;  3PDF A;  2FO5 A;  2B1N A;  3V6C A;  1MHW A;  4YYS A;  3OF9 A;  2G8J A;  1AU4 A;  3LFY A;  1AEC A;  1QDQ A;  2YJ9 A;  4XR7 A;  1NB3 A;  1KXR A;  3IV2 A;  1PE6 A;  3CH2 X;  1BP4 A;  1AIM A;  1YK8 A;  2ATO A;  1W5R A;  1CJL A;  2VFB A;  1E2T A;  2DC7 A;  2OUL A;  4QRG A;  2AYN A;  3PW3 A;  1QOL A;  3HHA A;  1MDW A;  1ME3 A;  2G6D A;  1A6R A;  1NLJ A;  1F2C A;  4X6J A;  4QRV A;  2BSZ A;  1Q6K A;  2FYE A;  4DMX A;  3ERV A;  9PAP A;  2R9C A;  4BSQ A;  2WBF X;  3P5X A;  3TNX A;  5CVO B;  2XU4 A;  2E01 A;  1ITO A;  2OZ2 A;  4N8W A;  3C9E A;  1YAL A;  1ICF A;  4K7C A;  4CZW A;  1KHP A;  6PAD A;  3BCN A;  4CDD B;  3M99 A;  3N4C A;  1ZCM A;  3LXS A;  3O0U A;  1MEG A;  3KW9 A;  2R9F A;  4DMY A;  4NV8 A;  5CVN B;  1AYV A;  1Y08 A;  4CDE B;  2CB5 A;  1O0E A;  1Y4H A;  4I04 A;  3IMA A;  3OIS A;  2JQF R;  2HD5 A;  1BY8 A;  2DZZ A;  4C5P A;  1U9W A;  2E03 A;  3GCB A;  3F5V A;  8PCH A;  2H7J A;  3BPF A;  4G54 A;  3B79 A;  2HHN A;  4OEM A;  4AXM A;  3BOW A;  2AS8 A;  3RVW A;  1EWP A;  1YVB A;  3E1Z B;  1W4T A;  2AVW A;  1BGO A;  4FIP A;  4N4Z A;  1TL9 A;  2GHU A;  4B55 A;  1FH0 A;  1SP4 B;  1PIP A;  4QBB A;  4MZO A;  3RVX A;  3H7D A;  4BS6 A;  3WXF A;  1MEM A;  3NHE A;  2NQI A;  5J94 A;  1TU6 A;  2AUZ A;  1K3B B;  2YJB A;  1GEC E;  1QXP A;  2BDL A;  1NB5 A;  4W5B A;  3DF0 A;  2HXZ A;  1ATK A;  4YYQ A;  2JQG R;  1KFX L;  4QRX A;  3O1G A;  3U8E A;  3USV A;  2OP3 A;  4X6H A;  1GMY A;  1QMY A;  2Y6E A;  2DC8 A;  2F1G A;  1U5I A;  3BWK A;  1CPJ A;  4BGF A;  1X9Y A;  5PAD A;  2AUX A;  2DCD A;  1PXV A;  2DC9 A;  5JH3 A;  2IPP B;  3K24 A;  2DJF B;  2E02 A;  5F02 A;  2DZY A;  1U9X A;  4PP1 A;  3MHS A;  2VFC A;  1NQC A;  4MZS A;  1SNK A;  2CIO A;  4AXL A;  5CVM A;  3P5V A;  3MOR A;  2O6X A;  2IBI A;  3I06 A;  3OVZ A;  1CB5 A;  3PBH A;  2GFO A;  3KSE A;  1EWO A;  1KHQ A;  1AU0 A;  2FRQ A;  2PNS A;  4YV8 A;  3AI8 A;  1MIR A;  4YVA A;  3BC3 A;  2Y5B A;  4PI3 A;  4RY2 A;  4MSX A;  1GCB A;  2G7Y A;  2VHF A;  3S3Q A;  4NV7 A;  4PAD A;  1ZIV A;  1AYU A;  3KWB X;  5CHV A;  2YJ8 A;  4FK5 A;  3KWZ A;  1PBH A;  1EWM A;  1U9V A;  3RVV A;  5A24 A;  3OF8 A;  4WA6 A;  2NQG A;  1PPD A;  2R6N A;  5K16 A;  3CBK A;  1CV8 A;  5FPW A;  3OVX A;  4W5C A;  2XU1 A;  1F2A A;  2XU3 A;  1CVZ A;  3D6S A;  3IUT A;  1PPN A;  2BDZ A;  4Q8G A;  2FRA A;  4CDC B;  2NQA A;  3H89 A;  4XUI A;  4BQV A;  2HH5 A;  2DCB A;  3IHP A;  4I05 A;  1GLO A;  1XKG A;  2G8E A;  2C0Y A;  4X6I A;  3CH3 X;  5EGW A;  4FJC A;  2FUD A;  3KKU A;  4YYR A;  1POP A;  2AIM A;  2B1M A;  2ARY A;  2FQ9 A;  3WXE A;  3V6E A;  3HWN A;  1KFU L;  2YJC A;  4BPV A;  4QH6 A;  1EF7 A;  1HUC B;  2P7U A;  3K9M A;  3HD3 A;  2F7D A;  4CDF B;  3KX1 A;  2E00 A;  3WXG A;  1YT7 A;  4PP2 E;  1IWD A;  4P6G A;  1VJV A;  2PAD A;  1THE A;  4HWY A;  3BPM A;  3IEJ A;  2FT2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...