3N3GA

4-(3-trifluoromethylphenyl)-pyrimidine-2-carbonitrile as cathepsin s inhibitors: n3, not n1 is critically important
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
217
structure length
217
Chain Sequence
LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 4-(3-Trifluoromethylphenyl)-pyrimidine-2-carbonitrile as cathepsin S inhibitors: N3, not N1 is critically important.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Cathepsin S
total genus 70
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2010-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3n3gA00
3MTNA 1PCIA 3H8BA 1THEA 1AIMA 2DCAA 2IBIA 4QRGA 2E00A 1GMYA 5K16A 2OZ2A 1TL9A 4N4ZA 1CPJA 3S3QA 4ZUXU 3O0UA 4CDDB 1U9WA 1ATKA 4I07A 2R9OA 1MIRA 3LXSA 2H7JA 1O0EA 5F02A 1NQCA 3PBHA 5CVOB 4YVAA 4MZOA 2BDLA 3KWBX 1NB3A 1EF7A 5J94A 3PW3A 3F75A 1POPA 1YALA 2BDZA 1PBHA 1BGOA 2G6DA 2Y5BA 3K24A 3BWKA 1CB5A 2G8JA 2DZYA 3KWZA 1F2AA 3U8EA 2F7DA 4XUIA 2AYOA 3K9MA 1XKGA 1PPOA 1VJVA 1QXPA 1PE6A 2R9FA 2PNSA 3D6SA 1CS8A 2AVWA 3BCNA 2AS8A 4CDFB 1QOLA 3QSDA 2JQGR 1A6RA 4K7CA 2FTDA 4AXMA 3WXEA 2DC9A 1YK8A 1GECE 1PXVA 2AUXA 3BOWA 4FJCA 3USVA 1NLJA 2CB5A 3KFQA 1EWOA 2AYNA 5CHVA 1KXRA 2FQ9A 1CV8A 3OF8A 2HXZA 3HD3A 3OVXA 4PI3A 4P6GA 5CVMA 1HUCB 4QBBA 3V6CA 1CTEA 2CIOA 3ERVA 3HHAA 4W5BA 1Y4HA 3I3TA 4BS5A 4YYUA 5FPWA 3TNXA 2DZZA 1NB5A 1QDQA 2DCDA 3KKUA 2YJ9A 2IPPB 4MZSA 9PAPA 1TU6A 1GCBA 1NL6A 1AECA 1CVZA 4N8WA 3NHEA 2B1MA 2PREA 3CH2X 2ATOA 1Y08A 1EWMA 1AU3A 3P5XA 4X6HA 5A24A 3H8CA 3MHHA 4YYRA 2ACTA 1ITOA 2YJ2A 3HHIA 2HHNA 3CBKA 1PPDA 2R9NA 3C9EA 4FIPA 1KFUL 2FO5A 2NQGA 2AIMA 1KHQA 1AU2A 1AU0A 4YYSA 3OVZA 1ME3A 4X6JA 4CDEB 4G54A 3M99A 2FRAA 2YJ8A 4W5CA 4OEMA 1BQIA 3F5VA 3P5VA 4YYVA 1AU4A 1YK7A 3RVXA 1S4VA 2FT2A 1NPZA 1VSNA 2HH5A 2E01A 3OF9A 2HD5A 3IUTA 1BP4A 1U5IA 2PBHA 1EWLA 2NQAA 4I05A 3RVWA 4CDCB 1PPNA 1K3BB 7PCKA 1M6DA 3BPMA 4Q8GA 4PADA 2DCCA 2P0RA 2OULA 2P7UA 2NQIA 4RY2A 3KSEA 4OELA 4QRVA 1YT7A 3KW9A 2XU5A 4PP1A 3N3KA 3AI8A 1F29A 1STFE 1PADA 6PADA 4DMXA 1EWPA 2FYEA 3S3RA 4W4UA 3QJ3A 1BY8A 2VHFA 4KLBA 2WBFX 1ICFA 5EGWA 2XU3A 5JA7A 5CVNB 2R6NA 2O6XA 1MHWA 2DJFB 3CH3X 2E02A 4YV8A 5CHTA 1MS6A 4QH6A 3B79A 4YYQA 1TLOA 1SP4B 4MSXA 3CBJA 1GLOA 3N4CA 3GCBA 2YJBA 2FRQA 3P5WA 1MEGA 1YVBA 2XU1A 1IWDA 4BQVA 3MORA 3HWNA 3E1ZB 1X9YA 3IHPA 3IMAA 3BC3A 1PPPA 4FK5A 3LFYA 1QMYA 2Y6EA 3K8UA 1FH0A 1ZCMA 3H89A 4BSQA 4WA6A 4BS6A 3PDFA 1AYVA 1CSBB 1CQDA 1F2CA 1Q6KA 2C0YA 2FUDA 3O1GA 4QRXA 1DF0A 2R9CA 2YJCA 2PADA 1MEMA 1PIPA 2ARYA 2DC8A 1U9XA 2AUZA 3I06A 1U9VA 1ZIVA 3N3GA 1F2BA 2E03A 4HWYA 1KHPA 3PNRA 1U9QX 2G7YA 2DJGB 2NQDB 2F1GA 4YYWA 3DF0A 3P5UA 2GFOA 1JQPA 2DC6A 2G8EA 2GHUA 4DMYA 3IOQA 3WXFA 1KFXL 2DCBA 3IV2A 4X6IA 5JH3A 1DEUA 3OISA 5PADA 3WXGA 3RVVA 3IEJA 3ZUAA 2P86A 1AYUA 4AXLA 5EF4A 1AYWA 4BPVA 4Q8HA 3BPFA 1CJLA 1ME4A 1MDWA 4PP2E 4CZWA 3H6SA 4XR7A 2XU4A 3V6EA 4P6EA 2R9MA 3MHSA 2AU1A 1SNKA 2JQFR 3KX1A 4N79A 8PCHA 3QT4A 4I04A 2OP3A 3H7DA 2DC7A 2B1NA 2VHSA
chains in the Genus database with same CATH superfamily
5JZEA 3MTNA 1PCIA 3H8BA 1THEA 1AIMA 2DCAA 2IBIA 4QRGA 2E00A 1GMYA 3B21A 5K16A 2OZ2A 1TL9A 4D8IA 4N4ZA 1CPJA 3S3QA 1YZBA 4ZUXU 3O0UA 4CDDB 1U9WA 4D8BA 1ATKA 4R3DA 4I07A 2R9OA 3IFUA 1MIRA 3LXSA 2H7JA 1O0EA 5F02A 1NQCA 3PBHA 5CVOB 4RKXA 2BTWA 4YVAA 4MZOA 4RF0A 2BDLA 3KWBX 1NB3A 3RNVA 3E9SA 1EF7A 5J94A 3PW3A 3F75A 1POPA 1YALA 2BDZA 1PBHA 1BGOA 4PT5A 2G6DA 2Y5BA 3K24A 3BWKA 1CB5A 2G8JA 2DZYA 3KWZA 1F2AA 3U8EA 2F7DA 4XUIA 2AYOA 3K9MA 2DOSA 2UZJA 1XKGA 1PPOA 1VJVA 1QXPA 1PE6A 2R9FA 1UKFA 2PNSA 3D6SA 3PHXA 1CS8A 3ZNHA 2AVWA 3BCNA 2AS8A 4BOSA 4CDFB 1QOLA 3QSDA 2JQGR 1A6RA 4K7CA 2FTDA 4AXMA 3WXEA 2DC9A 3PHWA 1YK8A 4HXDB 1GECE 1PXVA 2AUXA 3BOWA 4FJCA 3USVA 1NLJA 2CB5A 3KFQA 1EWOA 4MI7A 2AYNA 4RF1A 5CHVA 1KXRA 2FQ9A 1CV8A 3OF8A 2HXZA 3HD3A 3OVXA 4OW0A 4PI3A 4P6GA 5CVMA 1HUCB 4QBBA 3O65A 3V6CA 1CTEA 2CIOA 3ERVA 3HHAA 4W5BA 1Y4HA 3I3TA 4BS5A 4YYUA 5FPWA 3TNXA 2DZZA 1NB5A 2JTCA 1QDQA 2DCDA 3KKUA 2YJ9A 2IPPB 4MZSA 9PAPA 1TU6A 1GCBA 1NL6A 1AECA 1CVZA 4N8WA 3NHEA 2B1MA 2PREA 3CH2X 2ATOA 1Y08A 1EWMA 1AU3A 3P5XA 4X6HA 4RNAA 5A24A 3H8CA 3MHHA 4YYRA 2ACTA 1ITOA 2YJ2A 3HHIA 2HHNA 3CBKA 1PPDA 2R9NA 3C9EA 4FIPA 2FE8A 1KFUL 2FO5A 2NQGA 2AIMA 1KHQA 1AU2A 1AU0A 4YYSA 3OVZA 1ME3A 4X6JA 4CDEB 4G54A 3M99A 2FRAA 2YJ8A 4W5CA 4OEMA 1BQIA 3F5VA 3P5VA 4YYVA 1AU4A 3MP2A 1YK7A 3RVXA 1S4VA 2FT2A 3BB7A 1NPZA 1VSNA 2HH5A 2E01A 3OF9A 2HD5A 3IUTA 4BOZA 1BP4A 1U5IA 2PBHA 1EWLA 2NQAA 4I05A 3RVWA 4CDCB 1PPNA 1K3BB 7PCKA 4BOUA 1M6DA 3BPMA 4Q8GA 4PADA 2DCCA 2P0RA 2OULA 2P7UA 3W30A 2NQIA 4RY2A 3KSEA 4IUMA 4OELA 4QRVA 1YT7A 3KW9A 2XU5A 4PP1A 3N3KA 3AI8A 3PRPA 1F29A 1DKIA 1STFE 1PADA 2HWKA 6PADA 4DMXA 1EWPA 2FYEA 3S3RA 4M0WA 3TMPA 4W4UA 3QJ3A 2J7QC 1BY8A 2VHFA 4KLBA 2WBFX 5EZQA 1ICFA 2BTWB 5EGWA 2XU3A 5JA7A 5CVNB 2R6NA 2O6XA 3BY4A 1MHWA 2DJFB 3CH3X 2E02A 3MJ5A 4YV8A 5CHTA 4A5UA 1MS6A 4QH6A 3B79A 4YYQA 1TLOA 1SP4B 4MSXA 4P16A 1PVJA 3CBJA 1GLOA 4XZXA 3N4CA 3GCBA 2YJBA 2FRQA 4MM3B 3P5WA 1MEGA 1YVBA 2XU1A 1IWDA 4BQVA 3PT2A 3MORA 3HWNA 3E1ZB 1X9YA 3IHPA 3IMAA 5KO3A 3BC3A 1PPPA 4FK5A 3LFYA 3BBAA 3PSEA 1QMYA 2Y6EA 3K8UA 1FH0A 1ZCMA 3H89A 4BSQA 4WA6A 4BS6A 3PDFA 1AYVA 1CSBB 1CQDA 4ZTBA 1F2CA 1Q6KA 2C0YA 2FUDA 3O1GA 4QRXA 1DF0A 2R9CA 2YJCA 2PADA 1MEMA 2BU3A 2JRIA 1PIPA 2ARYA 3W31A 2DC8A 3TRKA 1U9XA 2J7QA 2AUZA 4WURA 4IP3A 3I06A 1U9VA 1ZIVA 3N3GA 1F2BA 3MTVA 2E03A 4OVZB 4HWYA 1KHPA 3PNRA 1U9QX 2G7YA 3PHUA 2DJGB 2NQDB 2F1GA 4YYWA 3OQCA 3DF0A 4BOPA 3P5UA 2GFOA 3C0RA 1JQPA 2DC6A 2G8EA 4GUAA 2GHUA 3PRMA 4DMYA 3IOQA 4OVZA 3WXFA 5EZSA 1KFXL 2DCBA 5E6JA 3IV2A 4X6IA 5JH3A 1DEUA 3OISA 5PADA 3WXGA 3RVVA 3IEJA 3ZUAA 2AGAA 2P86A 1AYUA 2Z84A 4AXLA 5EF4A 1AYWA 4REZA 4BPVA 4Q8HA 3BPFA 1CJLA 1ME4A 1MDWA 4PP2E 4CZWA 3H6SA 4XR7A 4BOQA 2XU4A 4D8EA 3V6EA 4P6EA 2R9MA 3MHSA 2AU1A 1SNKA 2JQFR 3KX1A 4N79A 8PCHA 3QT4A 4I04A 2OP3A 3H7DA 2DC7A 2B1NA 2VHSA
chains in the Genus database with same CATH topology
3MTNA 1PCIA 3H8BA 1THEA 1AIMA 2DCAA 2IBIA 4QRGA 2E00A 1GMYA 5K16A 2OZ2A 1TL9A 4N4ZA 1CPJA 3S3QA 4ZUXU 3O0UA 4CDDB 1U9WA 1ATKA 4I07A 2R9OA 1MIRA 3LXSA 2H7JA 1O0EA 5F02A 1NQCA 3PBHA 5CVOB 4YVAA 2VFCA 4MZOA 2BDLA 3KWBX 1NB3A 1EF7A 4NV7A 5J94A 3PW3A 3F75A 2BSZA 1POPA 1YALA 2BDZA 1PBHA 1BGOA 2G6DA 2Y5BA 3K24A 3BWKA 1CB5A 2G8JA 2DZYA 3KWZA 1F2AA 3U8EA 2F7DA 4XUIA 2AYOA 3K9MA 1XKGA 1PPOA 1VJVA 1QXPA 1PE6A 2R9FA 2PNSA 3D6SA 1CS8A 2AVWA 3BCNA 2AS8A 4CDFB 1QOLA 3QSDA 2JQGR 1A6RA 4K7CA 2FTDA 4AXMA 3WXEA 2DC9A 1W5RA 1YK8A 1GECE 1PXVA 2AUXA 3BOWA 4FJCA 3USVA 1NLJA 3D9WA 2CB5A 3KFQA 1EWOA 1W4TA 2AYNA 5CHVA 1KXRA 2FQ9A 1CV8A 3OF8A 2HXZA 3HD3A 3OVXA 4PI3A 4P6GA 5CVMA 1HUCB 4QBBA 3V6CA 1CTEA 2CIOA 3ERVA 3HHAA 4BGFA 4C5PA 4W5BA 1Y4HA 3I3TA 4BS5A 4YYUA 5FPWA 3TNXA 2DZZA 1NB5A 1QDQA 2DCDA 3KKUA 2YJ9A 2IPPB 4MZSA 9PAPA 1TU6A 1GCBA 1NL6A 1AECA 1CVZA 4N8WA 3NHEA 2B1MA 2PREA 3CH2X 2ATOA 1Y08A 1EWMA 1AU3A 3P5XA 4X6HA 5A24A 3H8CA 3MHHA 4YYRA 2ACTA 1ITOA 2YJ2A 3HHIA 2HHNA 3CBKA 1PPDA 2R9NA 3C9EA 4FIPA 1KFUL 2FO5A 2NQGA 2AIMA 1KHQA 1AU2A 1AU0A 4YYSA 3OVZA 1ME3A 4X6JA 4CDEB 4G54A 3M99A 2FRAA 2YJ8A 4W5CA 4OEMA 1BQIA 3F5VA 3P5VA 4YYVA 1AU4A 1YK7A 3RVXA 1S4VA 2FT2A 1NPZA 1VSNA 2HH5A 2VFBA 2E01A 3OF9A 2HD5A 4GUZA 3IUTA 1BP4A 1U5IA 2PBHA 4I05A 1EWLA 2NQAA 3RVWA 4CDCB 1PPNA 1K3BB 7PCKA 1M6DA 3BPMA 4Q8GA 3LTWA 4PADA 1E2TA 2DCCA 2P0RA 2OULA 2P7UA 2NQIA 4RY2A 3KSEA 4OELA 4QRVA 1YT7A 3KW9A 2XU5A 4PP1A 3N3KA 3AI8A 1F29A 1STFE 1PADA 6PADA 4DMXA 1EWPA 2FYEA 3S3RA 4W4UA 3QJ3A 1BY8A 2VHFA 4KLBA 2WBFX 1ICFA 5EGWA 2XU3A 5JA7A 5CVNB 1W6FA 2R6NA 2O6XA 1MHWA 2DJFB 3CH3X 2E02A 4YV8A 5CHTA 1MS6A 4QH6A 3B79A 4YYQA 1TLOA 1SP4B 4MSXA 3CBJA 1GLOA 3N4CA 3GCBA 2YJBA 2FRQA 3P5WA 1MEGA 1YVBA 2XU1A 1IWDA 4BQVA 3MORA 3HWNA 3E1ZB 1X9YA 3IHPA 3IMAA 3BC3A 1PPPA 4FK5A 3LFYA 1QMYA 2Y6EA 3K8UA 1FH0A 1ZCMA 3H89A 4BSQA 4WA6A 4BS6A 3PDFA 1AYVA 1CSBB 1CQDA 1F2CA 1Q6KA 2C0YA 2FUDA 3O1GA 4QRXA 1DF0A 2R9CA 2YJCA 2PADA 1MEMA 1PIPA 2ARYA 2DC8A 1U9XA 4B55A 2AUZA 3I06A 1U9VA 1ZIVA 3N3GA 1F2BA 2E03A 4NV8A 4HWYA 1KHPA 3PNRA 1U9QX 2G7YA 2DJGB 2NQDB 2F1GA 4YYWA 3DF0A 3P5UA 2GFOA 1JQPA 2DC6A 2G8EA 2GHUA 4DMYA 3IOQA 3WXFA 1KFXL 2DCBA 3IV2A 4X6IA 5JH3A 1DEUA 3OISA 5PADA 3WXGA 3RVVA 3IEJA 3ZUAA 2P86A 1AYUA 4AXLA 5EF4A 1AYWA 4BPVA 4Q8HA 3BPFA 1CJLA 1ME4A 1MDWA 4PP2E 4CZWA 3H6SA 4XR7A 2XU4A 3V6EA 4P6EA 2R9MA 3MHSA 2AU1A 1SNKA 2JQFR 3KX1A 4N79A 8PCHA 3QT4A 4I04A 2OP3A 3H7DA 2DC7A 2B1NA 1GX3A 2VHSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MTN A;  1PCI A;  3H8B A;  1THE A;  1AIM A;  2DCA A;  2IBI A;  4QRG A;  2E00 A;  1GMY A;  5K16 A;  2OZ2 A;  1TL9 A;  4N4Z A;  1CPJ A;  3S3Q A;  4ZUX U;  3O0U A;  4CDD B;  1U9W A;  1ATK A;  4I07 A;  2R9O A;  1MIR A;  3LXS A;  2H7J A;  1O0E A;  5F02 A;  1NQC A;  3PBH A;  5CVO B;  4YVA A;  4MZO A;  2BDL A;  3KWB X;  1NB3 A;  1EF7 A;  5J94 A;  3PW3 A;  3F75 A;  1POP A;  1YAL A;  2BDZ A;  1PBH A;  1BGO A;  2G6D A;  2Y5B A;  3K24 A;  3BWK A;  1CB5 A;  2G8J A;  2DZY A;  3KWZ A;  1F2A A;  3U8E A;  2F7D A;  4XUI A;  2AYO A;  3K9M A;  1XKG A;  1PPO A;  1VJV A;  1QXP A;  1PE6 A;  2R9F A;  2PNS A;  3D6S A;  1CS8 A;  2AVW A;  3BCN A;  2AS8 A;  4CDF B;  1QOL A;  3QSD A;  2JQG R;  1A6R A;  4K7C A;  2FTD A;  4AXM A;  3WXE A;  2DC9 A;  1YK8 A;  1GEC E;  1PXV A;  2AUX A;  3BOW A;  4FJC A;  3USV A;  1NLJ A;  2CB5 A;  3KFQ A;  1EWO A;  2AYN A;  5CHV A;  1KXR A;  2FQ9 A;  1CV8 A;  3OF8 A;  2HXZ A;  3HD3 A;  3OVX A;  4PI3 A;  4P6G A;  5CVM A;  1HUC B;  4QBB A;  3V6C A;  1CTE A;  2CIO A;  3ERV A;  3HHA A;  4W5B A;  1Y4H A;  3I3T A;  4BS5 A;  4YYU A;  5FPW A;  3TNX A;  2DZZ A;  1NB5 A;  1QDQ A;  2DCD A;  3KKU A;  2YJ9 A;  2IPP B;  4MZS A;  9PAP A;  1TU6 A;  1GCB A;  1NL6 A;  1AEC A;  1CVZ A;  4N8W A;  3NHE A;  2B1M A;  2PRE A;  3CH2 X;  2ATO A;  1Y08 A;  1EWM A;  1AU3 A;  3P5X A;  4X6H A;  5A24 A;  3H8C A;  3MHH A;  4YYR A;  2ACT A;  1ITO A;  2YJ2 A;  3HHI A;  2HHN A;  3CBK A;  1PPD A;  2R9N A;  3C9E A;  4FIP A;  1KFU L;  2FO5 A;  2NQG A;  2AIM A;  1KHQ A;  1AU2 A;  1AU0 A;  4YYS A;  3OVZ A;  1ME3 A;  4X6J A;  4CDE B;  4G54 A;  3M99 A;  2FRA A;  2YJ8 A;  4W5C A;  4OEM A;  1BQI A;  3F5V A;  3P5V A;  4YYV A;  1AU4 A;  1YK7 A;  3RVX A;  1S4V A;  2FT2 A;  1NPZ A;  1VSN A;  2HH5 A;  2E01 A;  3OF9 A;  2HD5 A;  3IUT A;  1BP4 A;  1U5I A;  2PBH A;  1EWL A;  2NQA A;  4I05 A;  3RVW A;  4CDC B;  1PPN A;  1K3B B;  7PCK A;  1M6D A;  3BPM A;  4Q8G A;  4PAD A;  2DCC A;  2P0R A;  2OUL A;  2P7U A;  2NQI A;  4RY2 A;  3KSE A;  4OEL A;  4QRV A;  1YT7 A;  3KW9 A;  2XU5 A;  4PP1 A;  3N3K A;  3AI8 A;  1F29 A;  1STF E;  1PAD A;  6PAD A;  4DMX A;  1EWP A;  2FYE A;  3S3R A;  4W4U A;  3QJ3 A;  1BY8 A;  2VHF A;  4KLB A;  2WBF X;  1ICF A;  5EGW A;  2XU3 A;  5JA7 A;  5CVN B;  2R6N A;  2O6X A;  1MHW A;  2DJF B;  3CH3 X;  2E02 A;  4YV8 A;  5CHT A;  1MS6 A;  4QH6 A;  3B79 A;  4YYQ A;  1TLO A;  1SP4 B;  4MSX A;  3CBJ A;  1GLO A;  3N4C A;  3GCB A;  2YJB A;  2FRQ A;  3P5W A;  1MEG A;  1YVB A;  2XU1 A;  1IWD A;  4BQV A;  3MOR A;  3HWN A;  3E1Z B;  1X9Y A;  3IHP A;  3IMA A;  3BC3 A;  1PPP A;  4FK5 A;  3LFY A;  1QMY A;  2Y6E A;  3K8U A;  1FH0 A;  1ZCM A;  3H89 A;  4BSQ A;  4WA6 A;  4BS6 A;  3PDF A;  1AYV A;  1CSB B;  1CQD A;  1F2C A;  1Q6K A;  2C0Y A;  2FUD A;  3O1G A;  4QRX A;  1DF0 A;  2R9C A;  2YJC A;  2PAD A;  1MEM A;  1PIP A;  2ARY A;  2DC8 A;  1U9X A;  2AUZ A;  3I06 A;  1U9V A;  1ZIV A;  3N3G A;  1F2B A;  2E03 A;  4HWY A;  1KHP A;  3PNR A;  1U9Q X;  2G7Y A;  2DJG B;  2NQD B;  2F1G A;  4YYW A;  3DF0 A;  3P5U A;  2GFO A;  1JQP A;  2DC6 A;  2G8E A;  2GHU A;  4DMY A;  3IOQ A;  3WXF A;  1KFX L;  2DCB A;  3IV2 A;  4X6I A;  5JH3 A;  1DEU A;  3OIS A;  5PAD A;  3WXG A;  3RVV A;  3IEJ A;  3ZUA A;  2P86 A;  1AYU A;  4AXL A;  5EF4 A;  1AYW A;  4BPV A;  4Q8H A;  3BPF A;  1CJL A;  1ME4 A;  1MDW A;  4PP2 E;  4CZW A;  3H6S A;  4XR7 A;  2XU4 A;  3V6E A;  4P6E A;  2R9M A;  3MHS A;  2AU1 A;  1SNK A;  2JQF R;  3KX1 A;  4N79 A;  8PCH A;  3QT4 A;  4I04 A;  2OP3 A;  3H7D A;  2DC7 A;  2B1N A;  2VHS A; 
#chains in the Genus database with same CATH topology
 5JZE A;  3MTN A;  1PCI A;  3H8B A;  1THE A;  1AIM A;  2DCA A;  2IBI A;  4QRG A;  2E00 A;  1GMY A;  3B21 A;  5K16 A;  2OZ2 A;  1TL9 A;  4D8I A;  4N4Z A;  1CPJ A;  3S3Q A;  1YZB A;  4ZUX U;  3O0U A;  4CDD B;  1U9W A;  4D8B A;  1ATK A;  4R3D A;  4I07 A;  2R9O A;  3IFU A;  1MIR A;  3LXS A;  2H7J A;  1O0E A;  5F02 A;  1NQC A;  3PBH A;  5CVO B;  4RKX A;  2BTW A;  4YVA A;  4MZO A;  4RF0 A;  2BDL A;  3KWB X;  1NB3 A;  3RNV A;  3E9S A;  1EF7 A;  5J94 A;  3PW3 A;  3F75 A;  1POP A;  1YAL A;  2BDZ A;  1PBH A;  1BGO A;  4PT5 A;  2G6D A;  2Y5B A;  3K24 A;  3BWK A;  1CB5 A;  2G8J A;  2DZY A;  3KWZ A;  1F2A A;  3U8E A;  2F7D A;  4XUI A;  2AYO A;  3K9M A;  2DOS A;  2UZJ A;  1XKG A;  1PPO A;  1VJV A;  1QXP A;  1PE6 A;  2R9F A;  1UKF A;  2PNS A;  3D6S A;  3PHX A;  1CS8 A;  3ZNH A;  2AVW A;  3BCN A;  2AS8 A;  4BOS A;  4CDF B;  1QOL A;  3QSD A;  2JQG R;  1A6R A;  4K7C A;  2FTD A;  4AXM A;  3WXE A;  2DC9 A;  3PHW A;  1YK8 A;  4HXD B;  1GEC E;  1PXV A;  2AUX A;  3BOW A;  4FJC A;  3USV A;  1NLJ A;  2CB5 A;  3KFQ A;  1EWO A;  4MI7 A;  2AYN A;  4RF1 A;  5CHV A;  1KXR A;  2FQ9 A;  1CV8 A;  3OF8 A;  2HXZ A;  3HD3 A;  3OVX A;  4OW0 A;  4PI3 A;  4P6G A;  5CVM A;  1HUC B;  4QBB A;  3O65 A;  3V6C A;  1CTE A;  2CIO A;  3ERV A;  3HHA A;  4W5B A;  1Y4H A;  3I3T A;  4BS5 A;  4YYU A;  5FPW A;  3TNX A;  2DZZ A;  1NB5 A;  2JTC A;  1QDQ A;  2DCD A;  3KKU A;  2YJ9 A;  2IPP B;  4MZS A;  9PAP A;  1TU6 A;  1GCB A;  1NL6 A;  1AEC A;  1CVZ A;  4N8W A;  3NHE A;  2B1M A;  2PRE A;  3CH2 X;  2ATO A;  1Y08 A;  1EWM A;  1AU3 A;  3P5X A;  4X6H A;  4RNA A;  5A24 A;  3H8C A;  3MHH A;  4YYR A;  2ACT A;  1ITO A;  2YJ2 A;  3HHI A;  2HHN A;  3CBK A;  1PPD A;  2R9N A;  3C9E A;  4FIP A;  2FE8 A;  1KFU L;  2FO5 A;  2NQG A;  2AIM A;  1KHQ A;  1AU2 A;  1AU0 A;  4YYS A;  3OVZ A;  1ME3 A;  4X6J A;  4CDE B;  4G54 A;  3M99 A;  2FRA A;  2YJ8 A;  4W5C A;  4OEM A;  1BQI A;  3F5V A;  3P5V A;  4YYV A;  1AU4 A;  3MP2 A;  1YK7 A;  3RVX A;  1S4V A;  2FT2 A;  3BB7 A;  1NPZ A;  1VSN A;  2HH5 A;  2E01 A;  3OF9 A;  2HD5 A;  3IUT A;  4BOZ A;  1BP4 A;  1U5I A;  2PBH A;  1EWL A;  2NQA A;  4I05 A;  3RVW A;  4CDC B;  1PPN A;  1K3B B;  7PCK A;  4BOU A;  1M6D A;  3BPM A;  4Q8G A;  4PAD A;  2DCC A;  2P0R A;  2OUL A;  2P7U A;  3W30 A;  2NQI A;  4RY2 A;  3KSE A;  4IUM A;  4OEL A;  4QRV A;  1YT7 A;  3KW9 A;  2XU5 A;  4PP1 A;  3N3K A;  3AI8 A;  3PRP A;  1F29 A;  1DKI A;  1STF E;  1PAD A;  2HWK A;  6PAD A;  4DMX A;  1EWP A;  2FYE A;  3S3R A;  4M0W A;  3TMP A;  4W4U A;  3QJ3 A;  2J7Q C;  1BY8 A;  2VHF A;  4KLB A;  2WBF X;  5EZQ A;  1ICF A;  2BTW B;  5EGW A;  2XU3 A;  5JA7 A;  5CVN B;  2R6N A;  2O6X A;  3BY4 A;  1MHW A;  2DJF B;  3CH3 X;  2E02 A;  3MJ5 A;  4YV8 A;  5CHT A;  4A5U A;  1MS6 A;  4QH6 A;  3B79 A;  4YYQ A;  1TLO A;  1SP4 B;  4MSX A;  4P16 A;  1PVJ A;  3CBJ A;  1GLO A;  4XZX A;  3N4C A;  3GCB A;  2YJB A;  2FRQ A;  4MM3 B;  3P5W A;  1MEG A;  1YVB A;  2XU1 A;  1IWD A;  4BQV A;  3PT2 A;  3MOR A;  3HWN A;  3E1Z B;  1X9Y A;  3IHP A;  3IMA A;  5KO3 A;  3BC3 A;  1PPP A;  4FK5 A;  3LFY A;  3BBA A;  3PSE A;  1QMY A;  2Y6E A;  3K8U A;  1FH0 A;  1ZCM A;  3H89 A;  4BSQ A;  4WA6 A;  4BS6 A;  3PDF A;  1AYV A;  1CSB B;  1CQD A;  4ZTB A;  1F2C A;  1Q6K A;  2C0Y A;  2FUD A;  3O1G A;  4QRX A;  1DF0 A;  2R9C A;  2YJC A;  2PAD A;  1MEM A;  2BU3 A;  2JRI A;  1PIP A;  2ARY A;  3W31 A;  2DC8 A;  3TRK A;  1U9X A;  2J7Q A;  2AUZ A;  4WUR A;  4IP3 A;  3I06 A;  1U9V A;  1ZIV A;  3N3G A;  1F2B A;  3MTV A;  2E03 A;  4OVZ B;  4HWY A;  1KHP A;  3PNR A;  1U9Q X;  2G7Y A;  3PHU A;  2DJG B;  2NQD B;  2F1G A;  4YYW A;  3OQC A;  3DF0 A;  4BOP A;  3P5U A;  2GFO A;  3C0R A;  1JQP A;  2DC6 A;  2G8E A;  4GUA A;  2GHU A;  3PRM A;  4DMY A;  3IOQ A;  4OVZ A;  3WXF A;  5EZS A;  1KFX L;  2DCB A;  5E6J A;  3IV2 A;  4X6I A;  5JH3 A;  1DEU A;  3OIS A;  5PAD A;  3WXG A;  3RVV A;  3IEJ A;  3ZUA A;  2AGA A;  2P86 A;  1AYU A;  2Z84 A;  4AXL A;  5EF4 A;  1AYW A;  4REZ A;  4BPV A;  4Q8H A;  3BPF A;  1CJL A;  1ME4 A;  1MDW A;  4PP2 E;  4CZW A;  3H6S A;  4XR7 A;  4BOQ A;  2XU4 A;  4D8E A;  3V6E A;  4P6E A;  2R9M A;  3MHS A;  2AU1 A;  1SNK A;  2JQF R;  3KX1 A;  4N79 A;  8PCH A;  3QT4 A;  4I04 A;  2OP3 A;  3H7D A;  2DC7 A;  2B1N A;  2VHS A; 
#chains in the Genus database with same CATH homology
 3MTN A;  1PCI A;  3H8B A;  1THE A;  1AIM A;  2DCA A;  2IBI A;  4QRG A;  2E00 A;  1GMY A;  5K16 A;  2OZ2 A;  1TL9 A;  4N4Z A;  1CPJ A;  3S3Q A;  4ZUX U;  3O0U A;  4CDD B;  1U9W A;  1ATK A;  4I07 A;  2R9O A;  1MIR A;  3LXS A;  2H7J A;  1O0E A;  5F02 A;  1NQC A;  3PBH A;  5CVO B;  4YVA A;  2VFC A;  4MZO A;  2BDL A;  3KWB X;  1NB3 A;  1EF7 A;  4NV7 A;  5J94 A;  3PW3 A;  3F75 A;  2BSZ A;  1POP A;  1YAL A;  2BDZ A;  1PBH A;  1BGO A;  2G6D A;  2Y5B A;  3K24 A;  3BWK A;  1CB5 A;  2G8J A;  2DZY A;  3KWZ A;  1F2A A;  3U8E A;  2F7D A;  4XUI A;  2AYO A;  3K9M A;  1XKG A;  1PPO A;  1VJV A;  1QXP A;  1PE6 A;  2R9F A;  2PNS A;  3D6S A;  1CS8 A;  2AVW A;  3BCN A;  2AS8 A;  4CDF B;  1QOL A;  3QSD A;  2JQG R;  1A6R A;  4K7C A;  2FTD A;  4AXM A;  3WXE A;  2DC9 A;  1W5R A;  1YK8 A;  1GEC E;  1PXV A;  2AUX A;  3BOW A;  4FJC A;  3USV A;  1NLJ A;  3D9W A;  2CB5 A;  3KFQ A;  1EWO A;  1W4T A;  2AYN A;  5CHV A;  1KXR A;  2FQ9 A;  1CV8 A;  3OF8 A;  2HXZ A;  3HD3 A;  3OVX A;  4PI3 A;  4P6G A;  5CVM A;  1HUC B;  4QBB A;  3V6C A;  1CTE A;  2CIO A;  3ERV A;  3HHA A;  4BGF A;  4C5P A;  4W5B A;  1Y4H A;  3I3T A;  4BS5 A;  4YYU A;  5FPW A;  3TNX A;  2DZZ A;  1NB5 A;  1QDQ A;  2DCD A;  3KKU A;  2YJ9 A;  2IPP B;  4MZS A;  9PAP A;  1TU6 A;  1GCB A;  1NL6 A;  1AEC A;  1CVZ A;  4N8W A;  3NHE A;  2B1M A;  2PRE A;  3CH2 X;  2ATO A;  1Y08 A;  1EWM A;  1AU3 A;  3P5X A;  4X6H A;  5A24 A;  3H8C A;  3MHH A;  4YYR A;  2ACT A;  1ITO A;  2YJ2 A;  3HHI A;  2HHN A;  3CBK A;  1PPD A;  2R9N A;  3C9E A;  4FIP A;  1KFU L;  2FO5 A;  2NQG A;  2AIM A;  1KHQ A;  1AU2 A;  1AU0 A;  4YYS A;  3OVZ A;  1ME3 A;  4X6J A;  4CDE B;  4G54 A;  3M99 A;  2FRA A;  2YJ8 A;  4W5C A;  4OEM A;  1BQI A;  3F5V A;  3P5V A;  4YYV A;  1AU4 A;  1YK7 A;  3RVX A;  1S4V A;  2FT2 A;  1NPZ A;  1VSN A;  2HH5 A;  2VFB A;  2E01 A;  3OF9 A;  2HD5 A;  4GUZ A;  3IUT A;  1BP4 A;  1U5I A;  2PBH A;  4I05 A;  1EWL A;  2NQA A;  3RVW A;  4CDC B;  1PPN A;  1K3B B;  7PCK A;  1M6D A;  3BPM A;  4Q8G A;  3LTW A;  4PAD A;  1E2T A;  2DCC A;  2P0R A;  2OUL A;  2P7U A;  2NQI A;  4RY2 A;  3KSE A;  4OEL A;  4QRV A;  1YT7 A;  3KW9 A;  2XU5 A;  4PP1 A;  3N3K A;  3AI8 A;  1F29 A;  1STF E;  1PAD A;  6PAD A;  4DMX A;  1EWP A;  2FYE A;  3S3R A;  4W4U A;  3QJ3 A;  1BY8 A;  2VHF A;  4KLB A;  2WBF X;  1ICF A;  5EGW A;  2XU3 A;  5JA7 A;  5CVN B;  1W6F A;  2R6N A;  2O6X A;  1MHW A;  2DJF B;  3CH3 X;  2E02 A;  4YV8 A;  5CHT A;  1MS6 A;  4QH6 A;  3B79 A;  4YYQ A;  1TLO A;  1SP4 B;  4MSX A;  3CBJ A;  1GLO A;  3N4C A;  3GCB A;  2YJB A;  2FRQ A;  3P5W A;  1MEG A;  1YVB A;  2XU1 A;  1IWD A;  4BQV A;  3MOR A;  3HWN A;  3E1Z B;  1X9Y A;  3IHP A;  3IMA A;  3BC3 A;  1PPP A;  4FK5 A;  3LFY A;  1QMY A;  2Y6E A;  3K8U A;  1FH0 A;  1ZCM A;  3H89 A;  4BSQ A;  4WA6 A;  4BS6 A;  3PDF A;  1AYV A;  1CSB B;  1CQD A;  1F2C A;  1Q6K A;  2C0Y A;  2FUD A;  3O1G A;  4QRX A;  1DF0 A;  2R9C A;  2YJC A;  2PAD A;  1MEM A;  1PIP A;  2ARY A;  2DC8 A;  1U9X A;  4B55 A;  2AUZ A;  3I06 A;  1U9V A;  1ZIV A;  3N3G A;  1F2B A;  2E03 A;  4NV8 A;  4HWY A;  1KHP A;  3PNR A;  1U9Q X;  2G7Y A;  2DJG B;  2NQD B;  2F1G A;  4YYW A;  3DF0 A;  3P5U A;  2GFO A;  1JQP A;  2DC6 A;  2G8E A;  2GHU A;  4DMY A;  3IOQ A;  3WXF A;  1KFX L;  2DCB A;  3IV2 A;  4X6I A;  5JH3 A;  1DEU A;  3OIS A;  5PAD A;  3WXG A;  3RVV A;  3IEJ A;  3ZUA A;  2P86 A;  1AYU A;  4AXL A;  5EF4 A;  1AYW A;  4BPV A;  4Q8H A;  3BPF A;  1CJL A;  1ME4 A;  1MDW A;  4PP2 E;  4CZW A;  3H6S A;  4XR7 A;  2XU4 A;  3V6E A;  4P6E A;  2R9M A;  3MHS A;  2AU1 A;  1SNK A;  2JQF R;  3KX1 A;  4N79 A;  8PCH A;  3QT4 A;  4I04 A;  2OP3 A;  3H7D A;  2DC7 A;  2B1N A;  1GX3 A;  2VHS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...