3N3GA

4-(3-trifluoromethylphenyl)-pyrimidine-2-carbonitrile as cathepsin s inhibitors: n3, not n1 is critically important
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
217
structure length
217
Chain Sequence
b'LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin S
publication title 4-(3-Trifluoromethylphenyl)-pyrimidine-2-carbonitrile as cathepsin S inhibitors: N3, not N1 is critically important.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 70
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2010-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3n3gA00
1GLOA 4BS5A 3USVA 4YYSA 4I07A 2YJ9A 3F5VA 3LXSA 1ZIVA 1JQPA 4QRXA 2OZ2A 1O0EA 1CS8A 3CH2X 5A24A 1AECA 1PPOA 2HXZA 3V6CA 3PW3A 2XU4A 1DF0A 8PCHA 2XU1A 3ERVA 1MEGA 2FUDA 4YYWA 3TNXA 2B1MA 5CVOB 4DMXA 1AYVA 4I05A 2DC8A 1X9YA 4CDEB 1FH0A 2VHFA 1ITOA 2IPPB 3IEJA 1TU6A 4KLBA 1AU4A 1S4VA 2ATOA 3WXEA 3PDFA 2Y6EA 3RVWA 1EWPA 1PE6A 2AUZA 1KFUL 2P86A 3RVVA 3M99A 3NHEA 2DCBA 3MORA 4YYRA 2ACTA 4I04A 3N4CA 3P5WA 1MIRA 4G54A 4PI3A 3HHIA 4XUIA 2DCDA 1EWOA 2H7JA 4HWYA 4PADA 1NLJA 3WXFA 1NPZA 2P0RA 3QT4A 1YALA 2F1GA 3P5XA 1AIMA 3CBJA 1CB5A 1KXRA 4BS6A 1ME3A 2AYOA 2AUXA 3B79A 1U9VA 4CDDB 2YJ2A 1U5IA 2YJCA 1F29A 2DJGB 4N8WA 4W5BA 2VHSA 3OF9A 1F2CA 2AS8A 1BY8A 1KHPA 3QJ3A 3KW9A 1PIPA 5PADA 2FQ9A 4YV8A 1MS6A 1PXVA 3MHHA 1CVZA 3PNRA 4W4UA 1SNKA 3GCBA 2PNSA 1Y08A 1BGOA 1PPNA 2AIMA 4CDCB 2HHNA 2E02A 3IMAA 1ZCMA 1VJVA 4X6IA 3OVZA 3S3RA 4BPVA 3I06A 2E03A 3IOQA 2YJBA 4QRVA 1QXPA 2B1NA 1EF7A 2C0YA 1YVBA 2NQIA 3KKUA 1SP4B 3O1GA 3WXGA 1PCIA 1AYWA 3QSDA 1NQCA 3OVXA 3KX1A 2FRQA 3BPFA 1PPDA 1PBHA 1CTEA 3H6SA 3KSEA 3BPMA 3V6EA 1AU0A 5J94A 3OF8A 2E01A 1EWLA 1Y4HA 3IV2A 4X6JA 1MEMA 4FIPA 3K24A 3MTNA 3N3GA 1NB3A 2FT2A 3IUTA 1CSBB 3E1ZB 1HUCB 1NL6A 3CH3X 1MDWA 1QMYA 1Q6KA 1QOLA 3BWKA 4WA6A 4YYUA 3F75A 3N3KA 2FO5A 2FRAA 5CVMA 2IBIA 4X6HA 2XU5A 3LFYA 1M6DA 2HH5A 4PP1A 4AXMA 4OEMA 5FPWA 4OELA 4PP2E 3HD3A 1AU2A 2XU3A 1A6RA 1NB5A 1GMYA 3KWZA 4YVAA 3H7DA 4QRGA 1K3BB 1ICFA 2E00A 3C9EA 4CZWA 3ZUAA 2GHUA 2OP3A 5K16A 2GFOA 1XKGA 3BCNA 1THEA 2CIOA 5JA7A 4BQVA 1MHWA 2AYNA 2YJ8A 3P5VA 1KHQA 3MHSA 4P6GA 2FYEA 5EGWA 1AYUA 1CJLA 2DZZA 1GECE 2AVWA 4FK5A 4ZUXU 1YK7A 1DEUA 2DC9A 4MZOA 2R9FA 1BQIA 4MZSA 2ARYA 1GCBA 2JQFR 4XR7A 1ME4A 2PADA 4N4ZA 3CBKA 3I3TA 1CV8A 5CHVA 1PADA 4RY2A 2DZYA 4QBBA 2PBHA 1TL9A 2WBFX 3AI8A 3D6SA 2R9OA 3BOWA 5EF4A 4YYVA 1KFXL 1YT7A 2R6NA 3OISA 4AXLA 4YYQA 5CHTA 1VSNA 2BDLA 2FTDA 2G6DA 3KWBX 1BP4A 1U9WA 2DJFB 3DF0A 1QDQA 2PREA 4N79A 6PADA 2F7DA 2G8EA 1PPPA 1YK8A 3HHAA 1IWDA 3RVXA 2AU1A 3H89A 4DMYA 5CVNB 2DCAA 4P6EA 2DC6A 1TLOA 3H8BA 4K7CA 2R9MA 4FJCA 3IHPA 2G7YA 1F2AA 3HWNA 3P5UA 2O6XA 2NQDB 2Y5BA 4CDFB 5JH3A 1CQDA 7PCKA 3K8UA 2CB5A 2DC7A 4Q8GA 3O0UA 2G8JA 4BSQA 1ATKA 2NQAA 9PAPA 3BC3A 3H8CA 4Q8HA 4W5CA 1U9QX 2BDZA 4MSXA 3U8EA 5F02A 4QH6A 1AU3A 2R9CA 2NQGA 1POPA 2JQGR 1CPJA 3S3QA 1F2BA 2P7UA 2R9NA 1EWMA 2HD5A 1STFE 3KFQA 1U9XA 2OULA 3K9MA 2DCCA 3PBHA
chains in the Genus database with same CATH superfamily
1GLOA 3MJ5A 4M0WA 4BOUA 4BS5A 4RNAA 3USVA 4YYSA 4I07A 3PHWA 2YJ9A 3F5VA 3LXSA 1ZIVA 1JQPA 4QRXA 2OZ2A 1O0EA 1CS8A 3CH2X 5A24A 1AECA 1PPOA 2HXZA 3V6CA 3PW3A 2XU4A 4D8IA 1DF0A 8PCHA 2XU1A 3ERVA 1MEGA 2FUDA 2AGAA 4YYWA 1PVJA 3TNXA 2B1MA 5CVOB 4DMXA 4MM3B 1AYVA 4I05A 2DC8A 1X9YA 4GUAA 4CDEB 4P16A 1FH0A 2VHFA 1ITOA 4PT5A 2IPPB 4HXDB 3IEJA 1TU6A 4KLBA 4OVZB 1AU4A 1S4VA 2ATOA 2JTCA 3B21A 3WXEA 3PDFA 2Y6EA 3RVWA 1EWPA 1PE6A 2AUZA 1KFUL 5E6JA 2P86A 3RVVA 3M99A 3NHEA 2DCBA 4R3DA 3MORA 4YYRA 2ACTA 4I04A 3PT2A 3N4CA 3P5WA 1MIRA 4G54A 4PI3A 3HHIA 4XUIA 2DCDA 1EWOA 2H7JA 4HWYA 4PADA 2Z84A 1NLJA 3WXFA 1NPZA 2P0RA 3QT4A 1YALA 2F1GA 3P5XA 3CBJA 1AIMA 1CB5A 1KXRA 4BS6A 4MI7A 1ME3A 2AYOA 4D8BA 2DOSA 2AUXA 3IFUA 3B79A 1U9VA 4CDDB 2YJ2A 1U5IA 2YJCA 1F29A 2DJGB 4N8WA 4W5BA 2VHSA 3OF9A 2JRIA 3OQCA 1F2CA 2AS8A 1BY8A 1KHPA 3QJ3A 3KW9A 3RNVA 1PIPA 5PADA 2FQ9A 2UZJA 1MS6A 4YV8A 1PXVA 3PHUA 3MHHA 1CVZA 3PNRA 4W4UA 1SNKA 3GCBA 2PNSA 1Y08A 1BGOA 1PPNA 2AIMA 4CDCB 2HHNA 4RF0A 2HWKA 2E02A 3IMAA 1ZCMA 5JZEA 3BY4A 1VJVA 3TMPA 4X6IA 3OVZA 3C0RA 3S3RA 4BPVA 3I06A 2E03A 3IOQA 2YJBA 4QRVA 1QXPA 2B1NA 4ZTBA 1EF7A 2C0YA 4BOPA 1YVBA 4OW0A 2NQIA 3KKUA 1SP4B 3O1GA 3WXGA 1PCIA 1AYWA 3QSDA 1NQCA 3OVXA 4XZXA 3KX1A 2FRQA 3W31A 3BPFA 1PPDA 1PBHA 1CTEA 3H6SA 3KSEA 3BPMA 3V6EA 1AU0A 5J94A 3OF8A 2E01A 1EWLA 1Y4HA 3IV2A 4X6JA 4IP3A 1MEMA 4FIPA 3K24A 3MTNA 3N3GA 1NB3A 2FT2A 3IUTA 1CSBB 2J7QA 2BTWB 3E1ZB 1HUCB 1NL6A 1YZBA 3O65A 3CH3X 1MDWA 1QMYA 1Q6KA 5EZQA 1QOLA 3BWKA 4WA6A 4YYUA 3F75A 4RKXA 3N3KA 2FO5A 2FRAA 5CVMA 2IBIA 4X6HA 3ZNHA 2XU5A 3BB7A 3LFYA 1M6DA 2HH5A 3BBAA 4PP1A 4AXMA 4OEMA 5FPWA 2J7QC 4OELA 4PP2E 3HD3A 1UKFA 1AU2A 2XU3A 1A6RA 1NB5A 1GMYA 3KWZA 4YVAA 3H7DA 4QRGA 1K3BB 1ICFA 4BOSA 2E00A 3C9EA 4CZWA 3ZUAA 2GHUA 2OP3A 5K16A 2GFOA 1XKGA 3BCNA 1THEA 2CIOA 5JA7A 4BQVA 3E9SA 1MHWA 2AYNA 2YJ8A 3P5VA 1KHQA 3MTVA 3TRKA 3MHSA 4P6GA 2FYEA 5EGWA 1AYUA 4OVZA 1CJLA 2DZZA 1GECE 2AVWA 4FK5A 4ZUXU 1YK7A 1DEUA 3W30A 2DC9A 2BU3A 2R9FA 4MZOA 1BQIA 4MZSA 2ARYA 1GCBA 2JQFR 4XR7A 4D8EA 1ME4A 2PADA 4N4ZA 3CBKA 3I3TA 1CV8A 5CHVA 1PADA 4RY2A 2DZYA 4QBBA 2PBHA 1TL9A 2WBFX 3AI8A 2FE8A 4WURA 3D6SA 2R9OA 3BOWA 5EF4A 4YYVA 1KFXL 1YT7A 2R6NA 3PHXA 3OISA 4AXLA 4YYQA 5CHTA 1VSNA 2BDLA 2FTDA 2G6DA 5KO3A 3KWBX 1BP4A 1U9WA 2DJFB 3PSEA 3DF0A 4REZA 4BOZA 1QDQA 2PREA 4N79A 6PADA 2F7DA 2G8EA 1PPPA 1YK8A 5EZSA 3HHAA 1IWDA 3RVXA 2AU1A 3H89A 4DMYA 5CVNB 2DCAA 4P6EA 2DC6A 1TLOA 3H8BA 4K7CA 2R9MA 3PRPA 4FJCA 4A5UA 3IHPA 2G7YA 1F2AA 3HWNA 3P5UA 2O6XA 2NQDB 2Y5BA 4CDFB 5JH3A 1CQDA 7PCKA 3K8UA 2CB5A 2DC7A 4Q8GA 3O0UA 2G8JA 4BSQA 1ATKA 2NQAA 9PAPA 3BC3A 3PRMA 3H8CA 4Q8HA 4W5CA 4RF1A 1U9QX 2BDZA 4MSXA 3U8EA 5F02A 4QH6A 1AU3A 4IUMA 2R9CA 2NQGA 1POPA 2JQGR 1CPJA 3S3QA 1F2BA 2P7UA 2R9NA 4BOQA 3MP2A 1EWMA 2HD5A 1STFE 3KFQA 2BTWA 1DKIA 1U9XA 2OULA 3K9MA 2DCCA 3PBHA
chains in the Genus database with same CATH topology
1GLOA 4BS5A 3USVA 4YYSA 4I07A 2YJ9A 3F5VA 3LXSA 1ZIVA 1JQPA 4QRXA 2OZ2A 1O0EA 1CS8A 3CH2X 5A24A 1AECA 1PPOA 2HXZA 3V6CA 3PW3A 2XU4A 1DF0A 8PCHA 2BSZA 2XU1A 3ERVA 1MEGA 2FUDA 4YYWA 3TNXA 2B1MA 5CVOB 4DMXA 1AYVA 1W6FA 4I05A 2DC8A 1X9YA 4CDEB 1FH0A 2VHFA 1ITOA 2IPPB 3IEJA 1TU6A 4KLBA 1AU4A 1S4VA 2ATOA 3WXEA 3PDFA 2Y6EA 3RVWA 1EWPA 1PE6A 4B55A 2AUZA 1KFUL 2P86A 4NV7A 3RVVA 3M99A 3NHEA 2DCBA 3MORA 4YYRA 2ACTA 4I04A 3N4CA 3P5WA 1MIRA 4G54A 4PI3A 3HHIA 4XUIA 2DCDA 1EWOA 2H7JA 4HWYA 4PADA 1NLJA 3WXFA 1NPZA 4BGFA 2P0RA 3QT4A 1YALA 2F1GA 3P5XA 1AIMA 3CBJA 1CB5A 1KXRA 4BS6A 1ME3A 2AYOA 2AUXA 3B79A 1U9VA 4CDDB 2YJ2A 1U5IA 2YJCA 1F29A 2DJGB 4N8WA 4W5BA 2VHSA 3OF9A 1F2CA 2AS8A 1BY8A 1KHPA 3QJ3A 3KW9A 1PIPA 5PADA 2FQ9A 4YV8A 1MS6A 1PXVA 3MHHA 1CVZA 3PNRA 4W4UA 1SNKA 3GCBA 2PNSA 1Y08A 1BGOA 1PPNA 2AIMA 4CDCB 2HHNA 2E02A 3IMAA 1ZCMA 1VJVA 4X6IA 3OVZA 1W4TA 3S3RA 4BPVA 3I06A 2E03A 3IOQA 2YJBA 4QRVA 1QXPA 2B1NA 1EF7A 2C0YA 1YVBA 3D9WA 2NQIA 3KKUA 1SP4B 3O1GA 3WXGA 1PCIA 1AYWA 3QSDA 1NQCA 3OVXA 3KX1A 2FRQA 3BPFA 1PPDA 1PBHA 1CTEA 3H6SA 3KSEA 3BPMA 3V6EA 1AU0A 5J94A 3OF8A 2E01A 1EWLA 1Y4HA 3IV2A 4X6JA 1MEMA 4FIPA 3K24A 4NV8A 3MTNA 3N3GA 1NB3A 2FT2A 3IUTA 1CSBB 3E1ZB 1HUCB 1NL6A 3CH3X 1MDWA 1QMYA 1Q6KA 1QOLA 3BWKA 4WA6A 4YYUA 3F75A 2VFBA 3N3KA 2FO5A 2FRAA 5CVMA 2IBIA 4X6HA 2XU5A 3LFYA 1M6DA 2HH5A 4PP1A 4AXMA 4OEMA 5FPWA 4OELA 4PP2E 3HD3A 1AU2A 2XU3A 1A6RA 1NB5A 1GMYA 3KWZA 4YVAA 3H7DA 4QRGA 1K3BB 1ICFA 4C5PA 3LTWA 2E00A 3C9EA 4CZWA 3ZUAA 2GHUA 2OP3A 5K16A 2GFOA 1XKGA 3BCNA 1THEA 2CIOA 5JA7A 4BQVA 1MHWA 2AYNA 2YJ8A 3P5VA 1KHQA 2VFCA 3MHSA 4P6GA 2FYEA 5EGWA 1AYUA 1CJLA 2DZZA 1GECE 2AVWA 4FK5A 4ZUXU 1YK7A 1DEUA 2DC9A 4MZOA 2R9FA 1BQIA 4MZSA 2ARYA 1GCBA 2JQFR 4XR7A 1ME4A 2PADA 4N4ZA 3CBKA 3I3TA 1GX3A 1CV8A 5CHVA 1PADA 4RY2A 2DZYA 4QBBA 2PBHA 1TL9A 2WBFX 3AI8A 3D6SA 2R9OA 3BOWA 5EF4A 4YYVA 1KFXL 1YT7A 2R6NA 3OISA 4AXLA 4YYQA 5CHTA 1VSNA 2BDLA 2FTDA 2G6DA 3KWBX 1BP4A 1E2TA 1U9WA 2DJFB 3DF0A 1QDQA 2PREA 4N79A 6PADA 2F7DA 2G8EA 1PPPA 1YK8A 3HHAA 1IWDA 3RVXA 2AU1A 3H89A 4DMYA 5CVNB 4GUZA 2DCAA 4P6EA 2DC6A 1TLOA 3H8BA 4K7CA 2R9MA 4FJCA 3IHPA 2G7YA 1F2AA 3HWNA 3P5UA 2O6XA 2NQDB 2Y5BA 4CDFB 5JH3A 1CQDA 1W5RA 7PCKA 3K8UA 2CB5A 2DC7A 4Q8GA 3O0UA 2G8JA 4BSQA 1ATKA 2NQAA 9PAPA 3BC3A 3H8CA 4Q8HA 4W5CA 1U9QX 2BDZA 4MSXA 3U8EA 5F02A 4QH6A 1AU3A 2R9CA 2NQGA 1POPA 2JQGR 1CPJA 3S3QA 1F2BA 2P7UA 2R9NA 1EWMA 2HD5A 1STFE 3KFQA 1U9XA 2OULA 3K9MA 2DCCA 3PBHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GLO A;  4BS5 A;  3USV A;  4YYS A;  4I07 A;  2YJ9 A;  3F5V A;  3LXS A;  1ZIV A;  1JQP A;  4QRX A;  2OZ2 A;  1O0E A;  1CS8 A;  3CH2 X;  5A24 A;  1AEC A;  1PPO A;  2HXZ A;  3V6C A;  3PW3 A;  2XU4 A;  1DF0 A;  8PCH A;  2XU1 A;  3ERV A;  1MEG A;  2FUD A;  4YYW A;  3TNX A;  2B1M A;  5CVO B;  4DMX A;  1AYV A;  4I05 A;  2DC8 A;  1X9Y A;  4CDE B;  1FH0 A;  2VHF A;  1ITO A;  2IPP B;  3IEJ A;  1TU6 A;  4KLB A;  1AU4 A;  1S4V A;  2ATO A;  3WXE A;  3PDF A;  2Y6E A;  3RVW A;  1EWP A;  1PE6 A;  2AUZ A;  1KFU L;  2P86 A;  3RVV A;  3M99 A;  3NHE A;  2DCB A;  3MOR A;  4YYR A;  2ACT A;  4I04 A;  3N4C A;  3P5W A;  1MIR A;  4G54 A;  4PI3 A;  3HHI A;  4XUI A;  2DCD A;  1EWO A;  2H7J A;  4HWY A;  4PAD A;  1NLJ A;  3WXF A;  1NPZ A;  2P0R A;  3QT4 A;  1YAL A;  2F1G A;  3P5X A;  1AIM A;  3CBJ A;  1CB5 A;  1KXR A;  4BS6 A;  1ME3 A;  2AYO A;  2AUX A;  3B79 A;  1U9V A;  4CDD B;  2YJ2 A;  1U5I A;  2YJC A;  1F29 A;  2DJG B;  4N8W A;  4W5B A;  2VHS A;  3OF9 A;  1F2C A;  2AS8 A;  1BY8 A;  1KHP A;  3QJ3 A;  3KW9 A;  1PIP A;  5PAD A;  2FQ9 A;  4YV8 A;  1MS6 A;  1PXV A;  3MHH A;  1CVZ A;  3PNR A;  4W4U A;  1SNK A;  3GCB A;  2PNS A;  1Y08 A;  1BGO A;  1PPN A;  2AIM A;  4CDC B;  2HHN A;  2E02 A;  3IMA A;  1ZCM A;  1VJV A;  4X6I A;  3OVZ A;  3S3R A;  4BPV A;  3I06 A;  2E03 A;  3IOQ A;  2YJB A;  4QRV A;  1QXP A;  2B1N A;  1EF7 A;  2C0Y A;  1YVB A;  2NQI A;  3KKU A;  1SP4 B;  3O1G A;  3WXG A;  1PCI A;  1AYW A;  3QSD A;  1NQC A;  3OVX A;  3KX1 A;  2FRQ A;  3BPF A;  1PPD A;  1PBH A;  1CTE A;  3H6S A;  3KSE A;  3BPM A;  3V6E A;  1AU0 A;  5J94 A;  3OF8 A;  2E01 A;  1EWL A;  1Y4H A;  3IV2 A;  4X6J A;  1MEM A;  4FIP A;  3K24 A;  3MTN A;  3N3G A;  1NB3 A;  2FT2 A;  3IUT A;  1CSB B;  3E1Z B;  1HUC B;  1NL6 A;  3CH3 X;  1MDW A;  1QMY A;  1Q6K A;  1QOL A;  3BWK A;  4WA6 A;  4YYU A;  3F75 A;  3N3K A;  2FO5 A;  2FRA A;  5CVM A;  2IBI A;  4X6H A;  2XU5 A;  3LFY A;  1M6D A;  2HH5 A;  4PP1 A;  4AXM A;  4OEM A;  5FPW A;  4OEL A;  4PP2 E;  3HD3 A;  1AU2 A;  2XU3 A;  1A6R A;  1NB5 A;  1GMY A;  3KWZ A;  4YVA A;  3H7D A;  4QRG A;  1K3B B;  1ICF A;  2E00 A;  3C9E A;  4CZW A;  3ZUA A;  2GHU A;  2OP3 A;  5K16 A;  2GFO A;  1XKG A;  3BCN A;  1THE A;  2CIO A;  5JA7 A;  4BQV A;  1MHW A;  2AYN A;  2YJ8 A;  3P5V A;  1KHQ A;  3MHS A;  4P6G A;  2FYE A;  5EGW A;  1AYU A;  1CJL A;  2DZZ A;  1GEC E;  2AVW A;  4FK5 A;  4ZUX U;  1YK7 A;  1DEU A;  2DC9 A;  4MZO A;  2R9F A;  1BQI A;  4MZS A;  2ARY A;  1GCB A;  2JQF R;  4XR7 A;  1ME4 A;  2PAD A;  4N4Z A;  3CBK A;  3I3T A;  1CV8 A;  5CHV A;  1PAD A;  4RY2 A;  2DZY A;  4QBB A;  2PBH A;  1TL9 A;  2WBF X;  3AI8 A;  3D6S A;  2R9O A;  3BOW A;  5EF4 A;  4YYV A;  1KFX L;  1YT7 A;  2R6N A;  3OIS A;  4AXL A;  4YYQ A;  5CHT A;  1VSN A;  2BDL A;  2FTD A;  2G6D A;  3KWB X;  1BP4 A;  1U9W A;  2DJF B;  3DF0 A;  1QDQ A;  2PRE A;  4N79 A;  6PAD A;  2F7D A;  2G8E A;  1PPP A;  1YK8 A;  3HHA A;  1IWD A;  3RVX A;  2AU1 A;  3H89 A;  4DMY A;  5CVN B;  2DCA A;  4P6E A;  2DC6 A;  1TLO A;  3H8B A;  4K7C A;  2R9M A;  4FJC A;  3IHP A;  2G7Y A;  1F2A A;  3HWN A;  3P5U A;  2O6X A;  2NQD B;  2Y5B A;  4CDF B;  5JH3 A;  1CQD A;  7PCK A;  3K8U A;  2CB5 A;  2DC7 A;  4Q8G A;  3O0U A;  2G8J A;  4BSQ A;  1ATK A;  2NQA A;  9PAP A;  3BC3 A;  3H8C A;  4Q8H A;  4W5C A;  1U9Q X;  2BDZ A;  4MSX A;  3U8E A;  5F02 A;  4QH6 A;  1AU3 A;  2R9C A;  2NQG A;  1POP A;  2JQG R;  1CPJ A;  3S3Q A;  1F2B A;  2P7U A;  2R9N A;  1EWM A;  2HD5 A;  1STF E;  3KFQ A;  1U9X A;  2OUL A;  3K9M A;  2DCC A;  3PBH A; 
#chains in the Genus database with same CATH topology
 1GLO A;  3MJ5 A;  4M0W A;  4BOU A;  4BS5 A;  4RNA A;  3USV A;  4YYS A;  4I07 A;  3PHW A;  2YJ9 A;  3F5V A;  3LXS A;  1ZIV A;  1JQP A;  4QRX A;  2OZ2 A;  1O0E A;  1CS8 A;  3CH2 X;  5A24 A;  1AEC A;  1PPO A;  2HXZ A;  3V6C A;  3PW3 A;  2XU4 A;  4D8I A;  1DF0 A;  8PCH A;  2XU1 A;  3ERV A;  1MEG A;  2FUD A;  2AGA A;  4YYW A;  1PVJ A;  3TNX A;  2B1M A;  5CVO B;  4DMX A;  4MM3 B;  1AYV A;  4I05 A;  2DC8 A;  1X9Y A;  4GUA A;  4CDE B;  4P16 A;  1FH0 A;  2VHF A;  1ITO A;  4PT5 A;  2IPP B;  4HXD B;  3IEJ A;  1TU6 A;  4KLB A;  4OVZ B;  1AU4 A;  1S4V A;  2ATO A;  2JTC A;  3B21 A;  3WXE A;  3PDF A;  2Y6E A;  3RVW A;  1EWP A;  1PE6 A;  2AUZ A;  1KFU L;  5E6J A;  2P86 A;  3RVV A;  3M99 A;  3NHE A;  2DCB A;  4R3D A;  3MOR A;  4YYR A;  2ACT A;  4I04 A;  3PT2 A;  3N4C A;  3P5W A;  1MIR A;  4G54 A;  4PI3 A;  3HHI A;  4XUI A;  2DCD A;  1EWO A;  2H7J A;  4HWY A;  4PAD A;  2Z84 A;  1NLJ A;  3WXF A;  1NPZ A;  2P0R A;  3QT4 A;  1YAL A;  2F1G A;  3P5X A;  3CBJ A;  1AIM A;  1CB5 A;  1KXR A;  4BS6 A;  4MI7 A;  1ME3 A;  2AYO A;  4D8B A;  2DOS A;  2AUX A;  3IFU A;  3B79 A;  1U9V A;  4CDD B;  2YJ2 A;  1U5I A;  2YJC A;  1F29 A;  2DJG B;  4N8W A;  4W5B A;  2VHS A;  3OF9 A;  2JRI A;  3OQC A;  1F2C A;  2AS8 A;  1BY8 A;  1KHP A;  3QJ3 A;  3KW9 A;  3RNV A;  1PIP A;  5PAD A;  2FQ9 A;  2UZJ A;  1MS6 A;  4YV8 A;  1PXV A;  3PHU A;  3MHH A;  1CVZ A;  3PNR A;  4W4U A;  1SNK A;  3GCB A;  2PNS A;  1Y08 A;  1BGO A;  1PPN A;  2AIM A;  4CDC B;  2HHN A;  4RF0 A;  2HWK A;  2E02 A;  3IMA A;  1ZCM A;  5JZE A;  3BY4 A;  1VJV A;  3TMP A;  4X6I A;  3OVZ A;  3C0R A;  3S3R A;  4BPV A;  3I06 A;  2E03 A;  3IOQ A;  2YJB A;  4QRV A;  1QXP A;  2B1N A;  4ZTB A;  1EF7 A;  2C0Y A;  4BOP A;  1YVB A;  4OW0 A;  2NQI A;  3KKU A;  1SP4 B;  3O1G A;  3WXG A;  1PCI A;  1AYW A;  3QSD A;  1NQC A;  3OVX A;  4XZX A;  3KX1 A;  2FRQ A;  3W31 A;  3BPF A;  1PPD A;  1PBH A;  1CTE A;  3H6S A;  3KSE A;  3BPM A;  3V6E A;  1AU0 A;  5J94 A;  3OF8 A;  2E01 A;  1EWL A;  1Y4H A;  3IV2 A;  4X6J A;  4IP3 A;  1MEM A;  4FIP A;  3K24 A;  3MTN A;  3N3G A;  1NB3 A;  2FT2 A;  3IUT A;  1CSB B;  2J7Q A;  2BTW B;  3E1Z B;  1HUC B;  1NL6 A;  1YZB A;  3O65 A;  3CH3 X;  1MDW A;  1QMY A;  1Q6K A;  5EZQ A;  1QOL A;  3BWK A;  4WA6 A;  4YYU A;  3F75 A;  4RKX A;  3N3K A;  2FO5 A;  2FRA A;  5CVM A;  2IBI A;  4X6H A;  3ZNH A;  2XU5 A;  3BB7 A;  3LFY A;  1M6D A;  2HH5 A;  3BBA A;  4PP1 A;  4AXM A;  4OEM A;  5FPW A;  2J7Q C;  4OEL A;  4PP2 E;  3HD3 A;  1UKF A;  1AU2 A;  2XU3 A;  1A6R A;  1NB5 A;  1GMY A;  3KWZ A;  4YVA A;  3H7D A;  4QRG A;  1K3B B;  1ICF A;  4BOS A;  2E00 A;  3C9E A;  4CZW A;  3ZUA A;  2GHU A;  2OP3 A;  5K16 A;  2GFO A;  1XKG A;  3BCN A;  1THE A;  2CIO A;  5JA7 A;  4BQV A;  3E9S A;  1MHW A;  2AYN A;  2YJ8 A;  3P5V A;  1KHQ A;  3MTV A;  3TRK A;  3MHS A;  4P6G A;  2FYE A;  5EGW A;  1AYU A;  4OVZ A;  1CJL A;  2DZZ A;  1GEC E;  2AVW A;  4FK5 A;  4ZUX U;  1YK7 A;  1DEU A;  3W30 A;  2DC9 A;  2BU3 A;  2R9F A;  4MZO A;  1BQI A;  4MZS A;  2ARY A;  1GCB A;  2JQF R;  4XR7 A;  4D8E A;  1ME4 A;  2PAD A;  4N4Z A;  3CBK A;  3I3T A;  1CV8 A;  5CHV A;  1PAD A;  4RY2 A;  2DZY A;  4QBB A;  2PBH A;  1TL9 A;  2WBF X;  3AI8 A;  2FE8 A;  4WUR A;  3D6S A;  2R9O A;  3BOW A;  5EF4 A;  4YYV A;  1KFX L;  1YT7 A;  2R6N A;  3PHX A;  3OIS A;  4AXL A;  4YYQ A;  5CHT A;  1VSN A;  2BDL A;  2FTD A;  2G6D A;  5KO3 A;  3KWB X;  1BP4 A;  1U9W A;  2DJF B;  3PSE A;  3DF0 A;  4REZ A;  4BOZ A;  1QDQ A;  2PRE A;  4N79 A;  6PAD A;  2F7D A;  2G8E A;  1PPP A;  1YK8 A;  5EZS A;  3HHA A;  1IWD A;  3RVX A;  2AU1 A;  3H89 A;  4DMY A;  5CVN B;  2DCA A;  4P6E A;  2DC6 A;  1TLO A;  3H8B A;  4K7C A;  2R9M A;  3PRP A;  4FJC A;  4A5U A;  3IHP A;  2G7Y A;  1F2A A;  3HWN A;  3P5U A;  2O6X A;  2NQD B;  2Y5B A;  4CDF B;  5JH3 A;  1CQD A;  7PCK A;  3K8U A;  2CB5 A;  2DC7 A;  4Q8G A;  3O0U A;  2G8J A;  4BSQ A;  1ATK A;  2NQA A;  9PAP A;  3BC3 A;  3PRM A;  3H8C A;  4Q8H A;  4W5C A;  4RF1 A;  1U9Q X;  2BDZ A;  4MSX A;  3U8E A;  5F02 A;  4QH6 A;  1AU3 A;  4IUM A;  2R9C A;  2NQG A;  1POP A;  2JQG R;  1CPJ A;  3S3Q A;  1F2B A;  2P7U A;  2R9N A;  4BOQ A;  3MP2 A;  1EWM A;  2HD5 A;  1STF E;  3KFQ A;  2BTW A;  1DKI A;  1U9X A;  2OUL A;  3K9M A;  2DCC A;  3PBH A; 
#chains in the Genus database with same CATH homology
 1GLO A;  4BS5 A;  3USV A;  4YYS A;  4I07 A;  2YJ9 A;  3F5V A;  3LXS A;  1ZIV A;  1JQP A;  4QRX A;  2OZ2 A;  1O0E A;  1CS8 A;  3CH2 X;  5A24 A;  1AEC A;  1PPO A;  2HXZ A;  3V6C A;  3PW3 A;  2XU4 A;  1DF0 A;  8PCH A;  2BSZ A;  2XU1 A;  3ERV A;  1MEG A;  2FUD A;  4YYW A;  3TNX A;  2B1M A;  5CVO B;  4DMX A;  1AYV A;  1W6F A;  4I05 A;  2DC8 A;  1X9Y A;  4CDE B;  1FH0 A;  2VHF A;  1ITO A;  2IPP B;  3IEJ A;  1TU6 A;  4KLB A;  1AU4 A;  1S4V A;  2ATO A;  3WXE A;  3PDF A;  2Y6E A;  3RVW A;  1EWP A;  1PE6 A;  4B55 A;  2AUZ A;  1KFU L;  2P86 A;  4NV7 A;  3RVV A;  3M99 A;  3NHE A;  2DCB A;  3MOR A;  4YYR A;  2ACT A;  4I04 A;  3N4C A;  3P5W A;  1MIR A;  4G54 A;  4PI3 A;  3HHI A;  4XUI A;  2DCD A;  1EWO A;  2H7J A;  4HWY A;  4PAD A;  1NLJ A;  3WXF A;  1NPZ A;  4BGF A;  2P0R A;  3QT4 A;  1YAL A;  2F1G A;  3P5X A;  1AIM A;  3CBJ A;  1CB5 A;  1KXR A;  4BS6 A;  1ME3 A;  2AYO A;  2AUX A;  3B79 A;  1U9V A;  4CDD B;  2YJ2 A;  1U5I A;  2YJC A;  1F29 A;  2DJG B;  4N8W A;  4W5B A;  2VHS A;  3OF9 A;  1F2C A;  2AS8 A;  1BY8 A;  1KHP A;  3QJ3 A;  3KW9 A;  1PIP A;  5PAD A;  2FQ9 A;  4YV8 A;  1MS6 A;  1PXV A;  3MHH A;  1CVZ A;  3PNR A;  4W4U A;  1SNK A;  3GCB A;  2PNS A;  1Y08 A;  1BGO A;  1PPN A;  2AIM A;  4CDC B;  2HHN A;  2E02 A;  3IMA A;  1ZCM A;  1VJV A;  4X6I A;  3OVZ A;  1W4T A;  3S3R A;  4BPV A;  3I06 A;  2E03 A;  3IOQ A;  2YJB A;  4QRV A;  1QXP A;  2B1N A;  1EF7 A;  2C0Y A;  1YVB A;  3D9W A;  2NQI A;  3KKU A;  1SP4 B;  3O1G A;  3WXG A;  1PCI A;  1AYW A;  3QSD A;  1NQC A;  3OVX A;  3KX1 A;  2FRQ A;  3BPF A;  1PPD A;  1PBH A;  1CTE A;  3H6S A;  3KSE A;  3BPM A;  3V6E A;  1AU0 A;  5J94 A;  3OF8 A;  2E01 A;  1EWL A;  1Y4H A;  3IV2 A;  4X6J A;  1MEM A;  4FIP A;  3K24 A;  4NV8 A;  3MTN A;  3N3G A;  1NB3 A;  2FT2 A;  3IUT A;  1CSB B;  3E1Z B;  1HUC B;  1NL6 A;  3CH3 X;  1MDW A;  1QMY A;  1Q6K A;  1QOL A;  3BWK A;  4WA6 A;  4YYU A;  3F75 A;  2VFB A;  3N3K A;  2FO5 A;  2FRA A;  5CVM A;  2IBI A;  4X6H A;  2XU5 A;  3LFY A;  1M6D A;  2HH5 A;  4PP1 A;  4AXM A;  4OEM A;  5FPW A;  4OEL A;  4PP2 E;  3HD3 A;  1AU2 A;  2XU3 A;  1A6R A;  1NB5 A;  1GMY A;  3KWZ A;  4YVA A;  3H7D A;  4QRG A;  1K3B B;  1ICF A;  4C5P A;  3LTW A;  2E00 A;  3C9E A;  4CZW A;  3ZUA A;  2GHU A;  2OP3 A;  5K16 A;  2GFO A;  1XKG A;  3BCN A;  1THE A;  2CIO A;  5JA7 A;  4BQV A;  1MHW A;  2AYN A;  2YJ8 A;  3P5V A;  1KHQ A;  2VFC A;  3MHS A;  4P6G A;  2FYE A;  5EGW A;  1AYU A;  1CJL A;  2DZZ A;  1GEC E;  2AVW A;  4FK5 A;  4ZUX U;  1YK7 A;  1DEU A;  2DC9 A;  4MZO A;  2R9F A;  1BQI A;  4MZS A;  2ARY A;  1GCB A;  2JQF R;  4XR7 A;  1ME4 A;  2PAD A;  4N4Z A;  3CBK A;  3I3T A;  1GX3 A;  1CV8 A;  5CHV A;  1PAD A;  4RY2 A;  2DZY A;  4QBB A;  2PBH A;  1TL9 A;  2WBF X;  3AI8 A;  3D6S A;  2R9O A;  3BOW A;  5EF4 A;  4YYV A;  1KFX L;  1YT7 A;  2R6N A;  3OIS A;  4AXL A;  4YYQ A;  5CHT A;  1VSN A;  2BDL A;  2FTD A;  2G6D A;  3KWB X;  1BP4 A;  1E2T A;  1U9W A;  2DJF B;  3DF0 A;  1QDQ A;  2PRE A;  4N79 A;  6PAD A;  2F7D A;  2G8E A;  1PPP A;  1YK8 A;  3HHA A;  1IWD A;  3RVX A;  2AU1 A;  3H89 A;  4DMY A;  5CVN B;  4GUZ A;  2DCA A;  4P6E A;  2DC6 A;  1TLO A;  3H8B A;  4K7C A;  2R9M A;  4FJC A;  3IHP A;  2G7Y A;  1F2A A;  3HWN A;  3P5U A;  2O6X A;  2NQD B;  2Y5B A;  4CDF B;  5JH3 A;  1CQD A;  1W5R A;  7PCK A;  3K8U A;  2CB5 A;  2DC7 A;  4Q8G A;  3O0U A;  2G8J A;  4BSQ A;  1ATK A;  2NQA A;  9PAP A;  3BC3 A;  3H8C A;  4Q8H A;  4W5C A;  1U9Q X;  2BDZ A;  4MSX A;  3U8E A;  5F02 A;  4QH6 A;  1AU3 A;  2R9C A;  2NQG A;  1POP A;  2JQG R;  1CPJ A;  3S3Q A;  1F2B A;  2P7U A;  2R9N A;  1EWM A;  2HD5 A;  1STF E;  3KFQ A;  1U9X A;  2OUL A;  3K9M A;  2DCC A;  3PBH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...