3N3GA

4-(3-trifluoromethylphenyl)-pyrimidine-2-carbonitrile as cathepsin s inhibitors: n3, not n1 is critically important
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
217
structure length
217
Chain Sequence
LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cathepsin S
publication title 4-(3-Trifluoromethylphenyl)-pyrimidine-2-carbonitrile as cathepsin S inhibitors: N3, not N1 is critically important.
pubmed doi rcsb
source organism Homo sapiens
total genus 70
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2010-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3n3gA00
1STFE 5PADA 4FJCA 3N4CA 3E1ZB 2AIMA 3PNRA 2FYEA 4QH6A 3H7DA 3H6SA 2AS8A 2E03A 2DZZA 5F02A 1KFXL 1X9YA 2DCBA 3LFYA 2HH5A 3O1GA 2XU4A 1BY8A 1PCIA 3I06A 2DC7A 1NPZA 3C9EA 1PBHA 1K3BB 3IHPA 3BCNA 4I04A 1EWPA 5CHVA 3IV2A 4X6JA 1GCBA 1AIMA 3RVVA 1O0EA 2YJ2A 3QT4A 2O6XA 3LXSA 2NQGA 3N3GA 1XKGA 1S4VA 4X6IA 2FQ9A 4RY2A 3H8CA 4I07A 1MDWA 3F75A 3WXFA 4OELA 2DJGB 2AUZA 4HWYA 1YVBA 4QBBA 4YYQA 1U9WA 4BS6A 3CH2X 2VHSA 3IEJA 2YJ9A 2DCDA 3OF9A 2XU3A 4CDDB 4CDFB 1DF0A 1NQCA 2HXZA 1TL9A 3M99A 4MZSA 3KSEA 2OZ2A 1AU0A 1EWMA 1BP4A 1YK7A 5CVMA 4PP2E 1PADA 4W5BA 4P6GA 3D6SA 3USVA 1AYWA 1NB3A 3K9MA 1BQIA 1KHPA 4XR7A 2ATOA 4K7CA 3N3KA 1NLJA 3KW9A 1QDQA 2FRAA 3IUTA 5J94A 3OISA 5K16A 3P5WA 2NQDB 4FK5A 3V6CA 4AXMA 2F1GA 3QJ3A 2P86A 2OP3A 2NQIA 2R9FA 3CH3X 4YV8A 2IPPB 1EWLA 4BSQA 2PBHA 1QOLA 2ACTA 2XU5A 4YYRA 2E00A 2DC6A 1PPPA 2BDZA 1CQDA 3MTNA 3I3TA 1F2CA 4PP1A 2R9CA 1VSNA 3MHSA 4G54A 2Y5BA 4Q8HA 2GHUA 2R9MA 2R6NA 2XU1A 1PPOA 4WA6A 3HHAA 4BPVA 2AVWA 4QRXA 5EGWA 1AYUA 3HD3A 3WXEA 4N8WA 3ERVA 2C0YA 1MHWA 1TLOA 2P7UA 3KFQA 3P5UA 4W5CA 3H8BA 2DC9A 1F2BA 1MEMA 1PPDA 2R9OA 5CVOB 1FH0A 3TNXA 1DEUA 3O0UA 4XUIA 1U9XA 3OVXA 2R9NA 1AU3A 4BQVA 1Q6KA 3NHEA 1A6RA 2YJ8A 3P5XA 4BS5A 3K8UA 1ME4A 2CIOA 1CSBB 1ITOA 2AYOA 1Y08A 3AI8A 3IOQA 1PIPA 1CVZA 2HHNA 1F29A 3S3QA 4OEMA 3PW3A 1GLOA 3RVWA 4CDCB 2PREA 3GCBA 5FPWA 4YVAA 3U8EA 2P0RA 1AU2A 1SP4B 4QRVA 4N4ZA 2FUDA 2FT2A 2BDLA 1M6DA 5EF4A 1HUCB 2YJBA 1CB5A 4X6HA 1KFUL 1BGOA 3BWKA 1GECE 1NB5A 3BPMA 3KWBX 1U5IA 5A24A 3PDFA 1IWDA 3HHIA 3KWZA 1AECA 3H89A 1CV8A 1CTEA 1YT7A 4PADA 2AU1A 4FIPA 4PI3A 3K24A 2G8JA 1QXPA 2AYNA 1CS8A 4YYUA 2AUXA 1F2AA 2PADA 1SNKA 2E01A 2FTDA 1PXVA 1EF7A 1ICFA 3HWNA 2FO5A 4CZWA 1TU6A 2B1NA 1Y4HA 2DCCA 4QRGA 1U9VA 2YJCA 5JA7A 4MSXA 4KLBA 2PNSA 2G7YA 4MZOA 1CPJA 3ZUAA 2B1MA 4AXLA 3BPFA 1ZIVA 3DF0A 6PADA 1JQPA 1QMYA 1YALA 2JQGR 2JQFR 1POPA 2FRQA 8PCHA 4YYVA 1MEGA 3KX1A 2E02A 1ME3A 2DCAA 5JH3A 1PE6A 3MORA 3S3RA 2GFOA 1CJLA 4P6EA 1THEA 4DMYA 2DC8A 2H7JA 5CVNB 4YYWA 2ARYA 2G6DA 4YYSA 4W4UA 3B79A 4Q8GA 1U9QX 1MIRA 3PBHA 4I05A 3BC3A 4ZUXU 2DZYA 3WXGA 2G8EA 3MHHA 1AU4A 3KKUA 2IBIA 3P5VA 4CDEB 1YK8A 1KXRA 3OVZA 4DMXA 2CB5A 1VJVA 5CHTA 2F7DA 1NL6A 3OF8A 1EWOA 1PPNA 1KHQA 2Y6EA 1MS6A 2DJFB 3V6EA 1AYVA 2OULA 3F5VA 3CBJA 1GMYA 2WBFX 1ATKA 2NQAA 3QSDA 3RVXA 3BOWA 1ZCMA 2VHFA 7PCKA 4N79A 3IMAA 2HD5A 3CBKA 9PAPA
chains in the Genus database with same CATH superfamily
1STFE 5PADA 4FJCA 4D8EA 3N4CA 3E1ZB 2AIMA 5EZSA 3PNRA 2FYEA 4QH6A 3H7DA 3H6SA 2AS8A 2E03A 3C0RA 2DZZA 5F02A 1KFXL 1X9YA 2DCBA 3LFYA 2HH5A 3O1GA 2XU4A 1BY8A 4RNAA 1PCIA 3I06A 3TRKA 4WURA 2DC7A 1NPZA 3C9EA 1PBHA 1K3BB 3IHPA 3BCNA 4I04A 1EWPA 5CHVA 3IV2A 4X6JA 4RKXA 1GCBA 5EZQA 1AIMA 3RVVA 1O0EA 2YJ2A 3QT4A 2O6XA 3IFUA 3LXSA 2NQGA 4BOPA 3N3GA 1XKGA 1S4VA 4X6IA 2FQ9A 3ZNHA 4RY2A 3H8CA 4I07A 1MDWA 3W30A 3F75A 3WXFA 4OELA 2DJGB 2AUZA 4HWYA 1YVBA 4QBBA 4YYQA 1U9WA 4BS6A 3CH2X 2VHSA 3IEJA 2YJ9A 2DCDA 3OF9A 5JZEA 2XU3A 4M0WA 4CDDB 3TMPA 4CDFB 2BU3A 1DF0A 1NQCA 2HXZA 1TL9A 3M99A 4MZSA 3KSEA 2OZ2A 1AU0A 1EWMA 1BP4A 1PVJA 1YK7A 5CVMA 4PP2E 1PADA 4W5BA 4P6GA 3D6SA 4R3DA 2UZJA 3USVA 1AYWA 1NB3A 3K9MA 4D8IA 1BQIA 1KHPA 4OVZB 4XR7A 2ATOA 4K7CA 3N3KA 1NLJA 1DKIA 3KW9A 1QDQA 2FRAA 2J7QA 3IUTA 5J94A 3OISA 4RF0A 3P5WA 5K16A 2NQDB 4FK5A 4MM3B 3V6CA 4AXMA 2F1GA 3QJ3A 2P86A 2OP3A 2J7QC 2NQIA 2R9FA 3CH3X 4YV8A 2IPPB 1EWLA 4BSQA 2PBHA 1QOLA 2ACTA 2XU5A 4YYRA 2E00A 3PT2A 2DC6A 1PPPA 2BDZA 1CQDA 3MTNA 3MP2A 3I3TA 1F2CA 4PP1A 2R9CA 1VSNA 3MHSA 4G54A 4BOQA 2Y5BA 3W31A 4Q8HA 2GHUA 2R9MA 2R6NA 2XU1A 1PPOA 4WA6A 2BTWA 3HHAA 4BPVA 2AVWA 4QRXA 5EGWA 1AYUA 3HD3A 3WXEA 4N8WA 3ERVA 2JRIA 2C0YA 3BB7A 1MHWA 3O65A 1TLOA 2P7UA 3KFQA 3P5UA 4W5CA 3H8BA 2DC9A 1F2BA 1MEMA 1PPDA 2R9OA 5CVOB 3PRPA 1FH0A 3TNXA 1DEUA 3O0UA 4XUIA 1U9XA 3OVXA 2R9NA 1AU3A 4BQVA 1Q6KA 3NHEA 1A6RA 3RNVA 4RF1A 2YJ8A 3P5XA 4BS5A 3K8UA 1ME4A 2CIOA 4IUMA 1CSBB 1ITOA 2AYOA 1Y08A 3AI8A 3IOQA 1PIPA 1CVZA 2HHNA 1F29A 1UKFA 3S3QA 4OEMA 3PW3A 1GLOA 3RVWA 4CDCB 2PREA 3GCBA 5FPWA 4YVAA 3U8EA 3BY4A 2P0RA 1AU2A 1SP4B 4QRVA 4N4ZA 2FUDA 2FT2A 3PSEA 2BDLA 1M6DA 5EF4A 1HUCB 2YJBA 4PT5A 1CB5A 4X6HA 4BOSA 1KFUL 1BGOA 3BWKA 1GECE 1NB5A 3BPMA 4IP3A 3KWBX 3BBAA 1U5IA 5A24A 3PDFA 2JTCA 1IWDA 3HHIA 3KWZA 1AECA 3H89A 1CV8A 1CTEA 1YT7A 4PADA 3OQCA 2AU1A 4FIPA 4PI3A 3B21A 3K24A 2G8JA 1QXPA 2AYNA 1CS8A 4YYUA 4GUAA 2AUXA 4MI7A 1F2AA 2PADA 1SNKA 2E01A 2FTDA 1PXVA 1EF7A 1ICFA 3HWNA 2FO5A 4CZWA 1TU6A 4BOZA 2B1NA 1Y4HA 1YZBA 2DCCA 4QRGA 1U9VA 2YJCA 5JA7A 4MSXA 4KLBA 2PNSA 2G7YA 4BOUA 4MZOA 1CPJA 4OVZA 2B1MA 3ZUAA 4AXLA 3BPFA 1ZIVA 3DF0A 6PADA 1JQPA 3MTVA 1QMYA 1YALA 2JQGR 2JQFR 1POPA 4A5UA 2FRQA 8PCHA 4OW0A 4YYVA 1MEGA 5KO3A 3KX1A 2E02A 1ME3A 3PHWA 2DCAA 5JH3A 1PE6A 3E9SA 3PHXA 3PRMA 3MORA 3S3RA 2GFOA 1CJLA 4P6EA 1THEA 4DMYA 2DC8A 2H7JA 5CVNB 2FE8A 3PHUA 4YYWA 2ARYA 2G6DA 4YYSA 4D8BA 4W4UA 3B79A 4Q8GA 1U9QX 1MIRA 3PBHA 4I05A 2Z84A 3BC3A 4ZUXU 2DZYA 3WXGA 2G8EA 3MHHA 2AGAA 1AU4A 3KKUA 2IBIA 3P5VA 4CDEB 1YK8A 1KXRA 3MJ5A 4ZTBA 4HXDB 3OVZA 4DMXA 2CB5A 1VJVA 5CHTA 2F7DA 1NL6A 3OF8A 1EWOA 2HWKA 1PPNA 1KHQA 2Y6EA 1MS6A 2DJFB 3V6EA 1AYVA 2OULA 3F5VA 3CBJA 2BTWB 4REZA 2DOSA 5E6JA 1GMYA 4XZXA 2WBFX 1ATKA 2NQAA 3QSDA 4P16A 3RVXA 3BOWA 1ZCMA 2VHFA 7PCKA 4N79A 3IMAA 2HD5A 3CBKA 9PAPA
chains in the Genus database with same CATH topology
1STFE 5PADA 4FJCA 3N4CA 3E1ZB 2AIMA 3PNRA 2FYEA 4QH6A 3H7DA 3H6SA 2AS8A 2E03A 2DZZA 5F02A 1KFXL 1X9YA 2DCBA 3LFYA 2HH5A 3O1GA 2XU4A 1BY8A 1PCIA 3I06A 2DC7A 1NPZA 3C9EA 1PBHA 1K3BB 2VFCA 3IHPA 3BCNA 4I04A 1EWPA 5CHVA 3IV2A 4X6JA 1GCBA 1AIMA 3RVVA 1O0EA 2YJ2A 3QT4A 2O6XA 3LXSA 2NQGA 3N3GA 1XKGA 1S4VA 4X6IA 2FQ9A 4RY2A 3H8CA 4I07A 1MDWA 3F75A 3WXFA 4OELA 2DJGB 2AUZA 4HWYA 1YVBA 4QBBA 4YYQA 1U9WA 4BS6A 3CH2X 2VHSA 3IEJA 2YJ9A 2DCDA 3OF9A 2XU3A 4CDDB 4CDFB 1DF0A 1NQCA 2HXZA 1TL9A 3M99A 4MZSA 3KSEA 2OZ2A 1AU0A 1EWMA 1BP4A 1YK7A 5CVMA 4PP2E 1PADA 4W5BA 4P6GA 3D6SA 3USVA 1AYWA 1NB3A 3K9MA 1BQIA 1KHPA 4XR7A 2ATOA 4K7CA 3N3KA 1NLJA 3KW9A 1QDQA 2FRAA 3IUTA 5J94A 3OISA 5K16A 3P5WA 3LTWA 2NQDB 4FK5A 3V6CA 4AXMA 2F1GA 3QJ3A 2P86A 2OP3A 2NQIA 2R9FA 3CH3X 4YV8A 2IPPB 1EWLA 4BSQA 2PBHA 1QOLA 2ACTA 2XU5A 4YYRA 2E00A 2DC6A 1PPPA 2BDZA 1CQDA 3MTNA 3I3TA 1F2CA 4PP1A 2R9CA 1VSNA 3MHSA 4G54A 2Y5BA 4B55A 4Q8HA 4NV7A 2GHUA 2R9MA 2R6NA 2XU1A 1PPOA 4WA6A 3HHAA 4BPVA 2AVWA 4QRXA 5EGWA 1AYUA 3HD3A 4C5PA 3WXEA 4N8WA 3ERVA 2C0YA 1MHWA 1TLOA 2P7UA 3KFQA 3P5UA 4W5CA 3H8BA 2DC9A 1F2BA 1MEMA 1PPDA 2R9OA 5CVOB 1FH0A 3TNXA 1DEUA 3O0UA 4XUIA 1U9XA 3OVXA 2R9NA 1AU3A 4BQVA 1Q6KA 3NHEA 1E2TA 1A6RA 2YJ8A 3P5XA 4BS5A 3K8UA 1ME4A 2CIOA 4NV8A 1CSBB 1ITOA 2AYOA 1Y08A 3AI8A 3IOQA 1PIPA 1CVZA 2HHNA 1F29A 3S3QA 1W6FA 4OEMA 3PW3A 1GLOA 2BSZA 3RVWA 4CDCB 2PREA 3GCBA 3D9WA 5FPWA 4YVAA 3U8EA 2P0RA 1AU2A 1SP4B 4QRVA 4N4ZA 2FUDA 2FT2A 2BDLA 1M6DA 5EF4A 1HUCB 2YJBA 1CB5A 4X6HA 1KFUL 1BGOA 3BWKA 1GECE 1NB5A 3BPMA 3KWBX 1U5IA 5A24A 3PDFA 1IWDA 3HHIA 3KWZA 1AECA 3H89A 1CV8A 1CTEA 1YT7A 4PADA 2AU1A 4FIPA 4PI3A 3K24A 2G8JA 1QXPA 2AYNA 1CS8A 4YYUA 2AUXA 1F2AA 2PADA 1SNKA 2E01A 2FTDA 1PXVA 1EF7A 1ICFA 3HWNA 2FO5A 4CZWA 1TU6A 2B1NA 1Y4HA 2DCCA 4QRGA 1U9VA 2YJCA 5JA7A 4MSXA 2VFBA 4KLBA 2PNSA 2G7YA 4MZOA 1CPJA 3ZUAA 2B1MA 4AXLA 4GUZA 3BPFA 1ZIVA 3DF0A 6PADA 1JQPA 1QMYA 1YALA 2JQGR 2JQFR 1POPA 2FRQA 8PCHA 4YYVA 1MEGA 3KX1A 2E02A 1ME3A 2DCAA 5JH3A 1W4TA 1PE6A 3MORA 3S3RA 2GFOA 1CJLA 4P6EA 1THEA 4DMYA 2DC8A 2H7JA 5CVNB 4YYWA 2ARYA 2G6DA 4YYSA 4W4UA 3B79A 4Q8GA 1U9QX 1MIRA 3PBHA 4I05A 3BC3A 4ZUXU 2DZYA 3WXGA 2G8EA 3MHHA 1W5RA 1GX3A 1AU4A 3KKUA 2IBIA 3P5VA 4CDEB 1YK8A 1KXRA 3OVZA 4DMXA 2CB5A 1VJVA 5CHTA 2F7DA 1NL6A 3OF8A 1EWOA 4BGFA 1PPNA 1KHQA 2Y6EA 1MS6A 2DJFB 3V6EA 1AYVA 2OULA 3F5VA 3CBJA 1GMYA 2WBFX 1ATKA 2NQAA 3QSDA 3RVXA 3BOWA 1ZCMA 2VHFA 7PCKA 4N79A 3IMAA 2HD5A 3CBKA 9PAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1STF E;  5PAD A;  4FJC A;  3N4C A;  3E1Z B;  2AIM A;  3PNR A;  2FYE A;  4QH6 A;  3H7D A;  3H6S A;  2AS8 A;  2E03 A;  2DZZ A;  5F02 A;  1KFX L;  1X9Y A;  2DCB A;  3LFY A;  2HH5 A;  3O1G A;  2XU4 A;  1BY8 A;  1PCI A;  3I06 A;  2DC7 A;  1NPZ A;  3C9E A;  1PBH A;  1K3B B;  3IHP A;  3BCN A;  4I04 A;  1EWP A;  5CHV A;  3IV2 A;  4X6J A;  1GCB A;  1AIM A;  3RVV A;  1O0E A;  2YJ2 A;  3QT4 A;  2O6X A;  3LXS A;  2NQG A;  3N3G A;  1XKG A;  1S4V A;  4X6I A;  2FQ9 A;  4RY2 A;  3H8C A;  4I07 A;  1MDW A;  3F75 A;  3WXF A;  4OEL A;  2DJG B;  2AUZ A;  4HWY A;  1YVB A;  4QBB A;  4YYQ A;  1U9W A;  4BS6 A;  3CH2 X;  2VHS A;  3IEJ A;  2YJ9 A;  2DCD A;  3OF9 A;  2XU3 A;  4CDD B;  4CDF B;  1DF0 A;  1NQC A;  2HXZ A;  1TL9 A;  3M99 A;  4MZS A;  3KSE A;  2OZ2 A;  1AU0 A;  1EWM A;  1BP4 A;  1YK7 A;  5CVM A;  4PP2 E;  1PAD A;  4W5B A;  4P6G A;  3D6S A;  3USV A;  1AYW A;  1NB3 A;  3K9M A;  1BQI A;  1KHP A;  4XR7 A;  2ATO A;  4K7C A;  3N3K A;  1NLJ A;  3KW9 A;  1QDQ A;  2FRA A;  3IUT A;  5J94 A;  3OIS A;  5K16 A;  3P5W A;  2NQD B;  4FK5 A;  3V6C A;  4AXM A;  2F1G A;  3QJ3 A;  2P86 A;  2OP3 A;  2NQI A;  2R9F A;  3CH3 X;  4YV8 A;  2IPP B;  1EWL A;  4BSQ A;  2PBH A;  1QOL A;  2ACT A;  2XU5 A;  4YYR A;  2E00 A;  2DC6 A;  1PPP A;  2BDZ A;  1CQD A;  3MTN A;  3I3T A;  1F2C A;  4PP1 A;  2R9C A;  1VSN A;  3MHS A;  4G54 A;  2Y5B A;  4Q8H A;  2GHU A;  2R9M A;  2R6N A;  2XU1 A;  1PPO A;  4WA6 A;  3HHA A;  4BPV A;  2AVW A;  4QRX A;  5EGW A;  1AYU A;  3HD3 A;  3WXE A;  4N8W A;  3ERV A;  2C0Y A;  1MHW A;  1TLO A;  2P7U A;  3KFQ A;  3P5U A;  4W5C A;  3H8B A;  2DC9 A;  1F2B A;  1MEM A;  1PPD A;  2R9O A;  5CVO B;  1FH0 A;  3TNX A;  1DEU A;  3O0U A;  4XUI A;  1U9X A;  3OVX A;  2R9N A;  1AU3 A;  4BQV A;  1Q6K A;  3NHE A;  1A6R A;  2YJ8 A;  3P5X A;  4BS5 A;  3K8U A;  1ME4 A;  2CIO A;  1CSB B;  1ITO A;  2AYO A;  1Y08 A;  3AI8 A;  3IOQ A;  1PIP A;  1CVZ A;  2HHN A;  1F29 A;  3S3Q A;  4OEM A;  3PW3 A;  1GLO A;  3RVW A;  4CDC B;  2PRE A;  3GCB A;  5FPW A;  4YVA A;  3U8E A;  2P0R A;  1AU2 A;  1SP4 B;  4QRV A;  4N4Z A;  2FUD A;  2FT2 A;  2BDL A;  1M6D A;  5EF4 A;  1HUC B;  2YJB A;  1CB5 A;  4X6H A;  1KFU L;  1BGO A;  3BWK A;  1GEC E;  1NB5 A;  3BPM A;  3KWB X;  1U5I A;  5A24 A;  3PDF A;  1IWD A;  3HHI A;  3KWZ A;  1AEC A;  3H89 A;  1CV8 A;  1CTE A;  1YT7 A;  4PAD A;  2AU1 A;  4FIP A;  4PI3 A;  3K24 A;  2G8J A;  1QXP A;  2AYN A;  1CS8 A;  4YYU A;  2AUX A;  1F2A A;  2PAD A;  1SNK A;  2E01 A;  2FTD A;  1PXV A;  1EF7 A;  1ICF A;  3HWN A;  2FO5 A;  4CZW A;  1TU6 A;  2B1N A;  1Y4H A;  2DCC A;  4QRG A;  1U9V A;  2YJC A;  5JA7 A;  4MSX A;  4KLB A;  2PNS A;  2G7Y A;  4MZO A;  1CPJ A;  3ZUA A;  2B1M A;  4AXL A;  3BPF A;  1ZIV A;  3DF0 A;  6PAD A;  1JQP A;  1QMY A;  1YAL A;  2JQG R;  2JQF R;  1POP A;  2FRQ A;  8PCH A;  4YYV A;  1MEG A;  3KX1 A;  2E02 A;  1ME3 A;  2DCA A;  5JH3 A;  1PE6 A;  3MOR A;  3S3R A;  2GFO A;  1CJL A;  4P6E A;  1THE A;  4DMY A;  2DC8 A;  2H7J A;  5CVN B;  4YYW A;  2ARY A;  2G6D A;  4YYS A;  4W4U A;  3B79 A;  4Q8G A;  1U9Q X;  1MIR A;  3PBH A;  4I05 A;  3BC3 A;  4ZUX U;  2DZY A;  3WXG A;  2G8E A;  3MHH A;  1AU4 A;  3KKU A;  2IBI A;  3P5V A;  4CDE B;  1YK8 A;  1KXR A;  3OVZ A;  4DMX A;  2CB5 A;  1VJV A;  5CHT A;  2F7D A;  1NL6 A;  3OF8 A;  1EWO A;  1PPN A;  1KHQ A;  2Y6E A;  1MS6 A;  2DJF B;  3V6E A;  1AYV A;  2OUL A;  3F5V A;  3CBJ A;  1GMY A;  2WBF X;  1ATK A;  2NQA A;  3QSD A;  3RVX A;  3BOW A;  1ZCM A;  2VHF A;  7PCK A;  4N79 A;  3IMA A;  2HD5 A;  3CBK A;  9PAP A; 
#chains in the Genus database with same CATH topology
 1STF E;  5PAD A;  4FJC A;  4D8E A;  3N4C A;  3E1Z B;  2AIM A;  5EZS A;  3PNR A;  2FYE A;  4QH6 A;  3H7D A;  3H6S A;  2AS8 A;  2E03 A;  3C0R A;  2DZZ A;  5F02 A;  1KFX L;  1X9Y A;  2DCB A;  3LFY A;  2HH5 A;  3O1G A;  2XU4 A;  1BY8 A;  4RNA A;  1PCI A;  3I06 A;  3TRK A;  4WUR A;  2DC7 A;  1NPZ A;  3C9E A;  1PBH A;  1K3B B;  3IHP A;  3BCN A;  4I04 A;  1EWP A;  5CHV A;  3IV2 A;  4X6J A;  4RKX A;  1GCB A;  5EZQ A;  1AIM A;  3RVV A;  1O0E A;  2YJ2 A;  3QT4 A;  2O6X A;  3IFU A;  3LXS A;  2NQG A;  4BOP A;  3N3G A;  1XKG A;  1S4V A;  4X6I A;  2FQ9 A;  3ZNH A;  4RY2 A;  3H8C A;  4I07 A;  1MDW A;  3W30 A;  3F75 A;  3WXF A;  4OEL A;  2DJG B;  2AUZ A;  4HWY A;  1YVB A;  4QBB A;  4YYQ A;  1U9W A;  4BS6 A;  3CH2 X;  2VHS A;  3IEJ A;  2YJ9 A;  2DCD A;  3OF9 A;  5JZE A;  2XU3 A;  4M0W A;  4CDD B;  3TMP A;  4CDF B;  2BU3 A;  1DF0 A;  1NQC A;  2HXZ A;  1TL9 A;  3M99 A;  4MZS A;  3KSE A;  2OZ2 A;  1AU0 A;  1EWM A;  1BP4 A;  1PVJ A;  1YK7 A;  5CVM A;  4PP2 E;  1PAD A;  4W5B A;  4P6G A;  3D6S A;  4R3D A;  2UZJ A;  3USV A;  1AYW A;  1NB3 A;  3K9M A;  4D8I A;  1BQI A;  1KHP A;  4OVZ B;  4XR7 A;  2ATO A;  4K7C A;  3N3K A;  1NLJ A;  1DKI A;  3KW9 A;  1QDQ A;  2FRA A;  2J7Q A;  3IUT A;  5J94 A;  3OIS A;  4RF0 A;  3P5W A;  5K16 A;  2NQD B;  4FK5 A;  4MM3 B;  3V6C A;  4AXM A;  2F1G A;  3QJ3 A;  2P86 A;  2OP3 A;  2J7Q C;  2NQI A;  2R9F A;  3CH3 X;  4YV8 A;  2IPP B;  1EWL A;  4BSQ A;  2PBH A;  1QOL A;  2ACT A;  2XU5 A;  4YYR A;  2E00 A;  3PT2 A;  2DC6 A;  1PPP A;  2BDZ A;  1CQD A;  3MTN A;  3MP2 A;  3I3T A;  1F2C A;  4PP1 A;  2R9C A;  1VSN A;  3MHS A;  4G54 A;  4BOQ A;  2Y5B A;  3W31 A;  4Q8H A;  2GHU A;  2R9M A;  2R6N A;  2XU1 A;  1PPO A;  4WA6 A;  2BTW A;  3HHA A;  4BPV A;  2AVW A;  4QRX A;  5EGW A;  1AYU A;  3HD3 A;  3WXE A;  4N8W A;  3ERV A;  2JRI A;  2C0Y A;  3BB7 A;  1MHW A;  3O65 A;  1TLO A;  2P7U A;  3KFQ A;  3P5U A;  4W5C A;  3H8B A;  2DC9 A;  1F2B A;  1MEM A;  1PPD A;  2R9O A;  5CVO B;  3PRP A;  1FH0 A;  3TNX A;  1DEU A;  3O0U A;  4XUI A;  1U9X A;  3OVX A;  2R9N A;  1AU3 A;  4BQV A;  1Q6K A;  3NHE A;  1A6R A;  3RNV A;  4RF1 A;  2YJ8 A;  3P5X A;  4BS5 A;  3K8U A;  1ME4 A;  2CIO A;  4IUM A;  1CSB B;  1ITO A;  2AYO A;  1Y08 A;  3AI8 A;  3IOQ A;  1PIP A;  1CVZ A;  2HHN A;  1F29 A;  1UKF A;  3S3Q A;  4OEM A;  3PW3 A;  1GLO A;  3RVW A;  4CDC B;  2PRE A;  3GCB A;  5FPW A;  4YVA A;  3U8E A;  3BY4 A;  2P0R A;  1AU2 A;  1SP4 B;  4QRV A;  4N4Z A;  2FUD A;  2FT2 A;  3PSE A;  2BDL A;  1M6D A;  5EF4 A;  1HUC B;  2YJB A;  4PT5 A;  1CB5 A;  4X6H A;  4BOS A;  1KFU L;  1BGO A;  3BWK A;  1GEC E;  1NB5 A;  3BPM A;  4IP3 A;  3KWB X;  3BBA A;  1U5I A;  5A24 A;  3PDF A;  2JTC A;  1IWD A;  3HHI A;  3KWZ A;  1AEC A;  3H89 A;  1CV8 A;  1CTE A;  1YT7 A;  4PAD A;  3OQC A;  2AU1 A;  4FIP A;  4PI3 A;  3B21 A;  3K24 A;  2G8J A;  1QXP A;  2AYN A;  1CS8 A;  4YYU A;  4GUA A;  2AUX A;  4MI7 A;  1F2A A;  2PAD A;  1SNK A;  2E01 A;  2FTD A;  1PXV A;  1EF7 A;  1ICF A;  3HWN A;  2FO5 A;  4CZW A;  1TU6 A;  4BOZ A;  2B1N A;  1Y4H A;  1YZB A;  2DCC A;  4QRG A;  1U9V A;  2YJC A;  5JA7 A;  4MSX A;  4KLB A;  2PNS A;  2G7Y A;  4BOU A;  4MZO A;  1CPJ A;  4OVZ A;  2B1M A;  3ZUA A;  4AXL A;  3BPF A;  1ZIV A;  3DF0 A;  6PAD A;  1JQP A;  3MTV A;  1QMY A;  1YAL A;  2JQG R;  2JQF R;  1POP A;  4A5U A;  2FRQ A;  8PCH A;  4OW0 A;  4YYV A;  1MEG A;  5KO3 A;  3KX1 A;  2E02 A;  1ME3 A;  3PHW A;  2DCA A;  5JH3 A;  1PE6 A;  3E9S A;  3PHX A;  3PRM A;  3MOR A;  3S3R A;  2GFO A;  1CJL A;  4P6E A;  1THE A;  4DMY A;  2DC8 A;  2H7J A;  5CVN B;  2FE8 A;  3PHU A;  4YYW A;  2ARY A;  2G6D A;  4YYS A;  4D8B A;  4W4U A;  3B79 A;  4Q8G A;  1U9Q X;  1MIR A;  3PBH A;  4I05 A;  2Z84 A;  3BC3 A;  4ZUX U;  2DZY A;  3WXG A;  2G8E A;  3MHH A;  2AGA A;  1AU4 A;  3KKU A;  2IBI A;  3P5V A;  4CDE B;  1YK8 A;  1KXR A;  3MJ5 A;  4ZTB A;  4HXD B;  3OVZ A;  4DMX A;  2CB5 A;  1VJV A;  5CHT A;  2F7D A;  1NL6 A;  3OF8 A;  1EWO A;  2HWK A;  1PPN A;  1KHQ A;  2Y6E A;  1MS6 A;  2DJF B;  3V6E A;  1AYV A;  2OUL A;  3F5V A;  3CBJ A;  2BTW B;  4REZ A;  2DOS A;  5E6J A;  1GMY A;  4XZX A;  2WBF X;  1ATK A;  2NQA A;  3QSD A;  4P16 A;  3RVX A;  3BOW A;  1ZCM A;  2VHF A;  7PCK A;  4N79 A;  3IMA A;  2HD5 A;  3CBK A;  9PAP A; 
#chains in the Genus database with same CATH homology
 1STF E;  5PAD A;  4FJC A;  3N4C A;  3E1Z B;  2AIM A;  3PNR A;  2FYE A;  4QH6 A;  3H7D A;  3H6S A;  2AS8 A;  2E03 A;  2DZZ A;  5F02 A;  1KFX L;  1X9Y A;  2DCB A;  3LFY A;  2HH5 A;  3O1G A;  2XU4 A;  1BY8 A;  1PCI A;  3I06 A;  2DC7 A;  1NPZ A;  3C9E A;  1PBH A;  1K3B B;  2VFC A;  3IHP A;  3BCN A;  4I04 A;  1EWP A;  5CHV A;  3IV2 A;  4X6J A;  1GCB A;  1AIM A;  3RVV A;  1O0E A;  2YJ2 A;  3QT4 A;  2O6X A;  3LXS A;  2NQG A;  3N3G A;  1XKG A;  1S4V A;  4X6I A;  2FQ9 A;  4RY2 A;  3H8C A;  4I07 A;  1MDW A;  3F75 A;  3WXF A;  4OEL A;  2DJG B;  2AUZ A;  4HWY A;  1YVB A;  4QBB A;  4YYQ A;  1U9W A;  4BS6 A;  3CH2 X;  2VHS A;  3IEJ A;  2YJ9 A;  2DCD A;  3OF9 A;  2XU3 A;  4CDD B;  4CDF B;  1DF0 A;  1NQC A;  2HXZ A;  1TL9 A;  3M99 A;  4MZS A;  3KSE A;  2OZ2 A;  1AU0 A;  1EWM A;  1BP4 A;  1YK7 A;  5CVM A;  4PP2 E;  1PAD A;  4W5B A;  4P6G A;  3D6S A;  3USV A;  1AYW A;  1NB3 A;  3K9M A;  1BQI A;  1KHP A;  4XR7 A;  2ATO A;  4K7C A;  3N3K A;  1NLJ A;  3KW9 A;  1QDQ A;  2FRA A;  3IUT A;  5J94 A;  3OIS A;  5K16 A;  3P5W A;  3LTW A;  2NQD B;  4FK5 A;  3V6C A;  4AXM A;  2F1G A;  3QJ3 A;  2P86 A;  2OP3 A;  2NQI A;  2R9F A;  3CH3 X;  4YV8 A;  2IPP B;  1EWL A;  4BSQ A;  2PBH A;  1QOL A;  2ACT A;  2XU5 A;  4YYR A;  2E00 A;  2DC6 A;  1PPP A;  2BDZ A;  1CQD A;  3MTN A;  3I3T A;  1F2C A;  4PP1 A;  2R9C A;  1VSN A;  3MHS A;  4G54 A;  2Y5B A;  4B55 A;  4Q8H A;  4NV7 A;  2GHU A;  2R9M A;  2R6N A;  2XU1 A;  1PPO A;  4WA6 A;  3HHA A;  4BPV A;  2AVW A;  4QRX A;  5EGW A;  1AYU A;  3HD3 A;  4C5P A;  3WXE A;  4N8W A;  3ERV A;  2C0Y A;  1MHW A;  1TLO A;  2P7U A;  3KFQ A;  3P5U A;  4W5C A;  3H8B A;  2DC9 A;  1F2B A;  1MEM A;  1PPD A;  2R9O A;  5CVO B;  1FH0 A;  3TNX A;  1DEU A;  3O0U A;  4XUI A;  1U9X A;  3OVX A;  2R9N A;  1AU3 A;  4BQV A;  1Q6K A;  3NHE A;  1E2T A;  1A6R A;  2YJ8 A;  3P5X A;  4BS5 A;  3K8U A;  1ME4 A;  2CIO A;  4NV8 A;  1CSB B;  1ITO A;  2AYO A;  1Y08 A;  3AI8 A;  3IOQ A;  1PIP A;  1CVZ A;  2HHN A;  1F29 A;  3S3Q A;  1W6F A;  4OEM A;  3PW3 A;  1GLO A;  2BSZ A;  3RVW A;  4CDC B;  2PRE A;  3GCB A;  3D9W A;  5FPW A;  4YVA A;  3U8E A;  2P0R A;  1AU2 A;  1SP4 B;  4QRV A;  4N4Z A;  2FUD A;  2FT2 A;  2BDL A;  1M6D A;  5EF4 A;  1HUC B;  2YJB A;  1CB5 A;  4X6H A;  1KFU L;  1BGO A;  3BWK A;  1GEC E;  1NB5 A;  3BPM A;  3KWB X;  1U5I A;  5A24 A;  3PDF A;  1IWD A;  3HHI A;  3KWZ A;  1AEC A;  3H89 A;  1CV8 A;  1CTE A;  1YT7 A;  4PAD A;  2AU1 A;  4FIP A;  4PI3 A;  3K24 A;  2G8J A;  1QXP A;  2AYN A;  1CS8 A;  4YYU A;  2AUX A;  1F2A A;  2PAD A;  1SNK A;  2E01 A;  2FTD A;  1PXV A;  1EF7 A;  1ICF A;  3HWN A;  2FO5 A;  4CZW A;  1TU6 A;  2B1N A;  1Y4H A;  2DCC A;  4QRG A;  1U9V A;  2YJC A;  5JA7 A;  4MSX A;  2VFB A;  4KLB A;  2PNS A;  2G7Y A;  4MZO A;  1CPJ A;  3ZUA A;  2B1M A;  4AXL A;  4GUZ A;  3BPF A;  1ZIV A;  3DF0 A;  6PAD A;  1JQP A;  1QMY A;  1YAL A;  2JQG R;  2JQF R;  1POP A;  2FRQ A;  8PCH A;  4YYV A;  1MEG A;  3KX1 A;  2E02 A;  1ME3 A;  2DCA A;  5JH3 A;  1W4T A;  1PE6 A;  3MOR A;  3S3R A;  2GFO A;  1CJL A;  4P6E A;  1THE A;  4DMY A;  2DC8 A;  2H7J A;  5CVN B;  4YYW A;  2ARY A;  2G6D A;  4YYS A;  4W4U A;  3B79 A;  4Q8G A;  1U9Q X;  1MIR A;  3PBH A;  4I05 A;  3BC3 A;  4ZUX U;  2DZY A;  3WXG A;  2G8E A;  3MHH A;  1W5R A;  1GX3 A;  1AU4 A;  3KKU A;  2IBI A;  3P5V A;  4CDE B;  1YK8 A;  1KXR A;  3OVZ A;  4DMX A;  2CB5 A;  1VJV A;  5CHT A;  2F7D A;  1NL6 A;  3OF8 A;  1EWO A;  4BGF A;  1PPN A;  1KHQ A;  2Y6E A;  1MS6 A;  2DJF B;  3V6E A;  1AYV A;  2OUL A;  3F5V A;  3CBJ A;  1GMY A;  2WBF X;  1ATK A;  2NQA A;  3QSD A;  3RVX A;  3BOW A;  1ZCM A;  2VHF A;  7PCK A;  4N79 A;  3IMA A;  2HD5 A;  3CBK A;  9PAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...