4CDEB

Human dpp1 in complex with 4-amino-n-((1s)-1-cyano-2-(4-(4- cyanophenyl)phenyl)ethyl)tetrahydropyran-4-carboxamide
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
161
structure length
161
Chain Sequence
HLPTSWDWRNVHGINFVSPVRNQASCGSCYSFASMGMLEARIRILTNNSQTPILSPQEVVSCSQYAQGCEGGFPYLIAGKYAQDFGLVEEACFPYTGTDSPCKMKEDCFRYYSSEYHYVGGFYGGCNEALMKLELVHHGPMAVAFEVYDDFLHYKKGIYHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords DIPEPTIDYL PEPTIDASE 1 EXCLUSION DOMAIN CHAIN
publication title Cathepsin C Inhibitors: Property Optimization and Identification of a Clinical Candidate.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 161
sequence length 161
chains with identical sequence E
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2013-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4cdeB01
1ME3A 2B1NA 2G6DA 1YT7A 4QRVA 4N8WA 3CH3X 4W5BA 1ZCMA 3F75A 1AU2A 2PNSA 4P6GA 3HD3A 2YJ9A 3DF0A 3WXFA 3MORA 2OULA 3BWKA 1AYVA 1AECA 3BOWA 3RVVA 2XU1A 2FUDA 4OELA 3AI8A 4W5CA 6PADA 5FPWA 2E02A 4BQVA 4QRGA 4PI3A 4RY2A 2AUXA 2HH5A 5K16A 1MIRA 3KW9A 1KFXL 3H8CA 1U5IA 2E00A 1GECE 1PCIA 1PPOA 2GFOA 3V6CA 2G8EA 4MSXA 3HHAA 1BP4A 2PADA 3P5WA 1FH0A 3KWZA 1AU3A 1TLOA 2OZ2A 1ICFA 2DCCA 2CIOA 1BY8A 4HWYA 4I05A 3BCNA 1ZIVA 5CVMA 4CDDB 1AIMA 3PDFA 1NL6A 5CHTA 3ERVA 3F5VA 1X9YA 3IOQA 4W4UA 3NHEA 4FIPA 2FTDA 1CQDA 3OVZA 3USVA 1PPPA 4QBBA 5JA7A 3KSEA 1F29A 2PREA 3P5VA 3S3RA 2IPPB 2E03A 2ARYA 2BDLA 1Y4HA 2R9FA 3IUTA 2VHSA 2DZZA 2BDZA 3HHIA 1SNKA 3IMAA 1U9XA 1PADA 4YYWA 1GCBA 3GCBA 4CDFB 5CVNB 2E01A 2F7DA 4P6EA 2F1GA 1POPA 3HWNA 4DMYA 1U9QX 2FRAA 2XU5A 2AS8A 1CV8A 3QSDA 1QDQA 1YK7A 1KFUL 1MS6A 2YJBA 4X6JA 2H7JA 1GMYA 3I3TA 2G8JA 5JH3A 2FT2A 5J94A 1Y08A 1CJLA 1DF0A 4FJCA 2FRQA 3S3QA 3K24A 3OF9A 2CB5A 3P5XA 1EWOA 1PPNA 3OISA 3MHSA 1NPZA 4X6IA 4YYRA 2B1MA 1NLJA 1NB5A 2YJCA 4AXMA 1AYWA 2OP3A 1YK8A 1AYUA 3LFYA 3E1ZB 1VJVA 3N4CA 5EGWA 3H7DA 2JQGR 1A6RA 4K7CA 5PADA 3K9MA 4Q8GA 3KWBX 4YYUA 1K3BB 4BS6A 1KHPA 1TU6A 4CDCB 3CBJA 3P5UA 1M6DA 4MZSA 1ME4A 1EWMA 2Y5BA 4PP1A 3CBKA 3RVWA 1STFE 1TL9A 3I06A 2R9NA 2NQAA 4AXLA 2HHNA 3TNXA 1QOLA 1QMYA 2Y6EA 4QRXA 1BQIA 2AYOA 1MHWA 5CHVA 4N4ZA 1EF7A 2G7YA 3IV2A 4FK5A 2P86A 3D6SA 2WBFX 1XKGA 2DJFB 1CTEA 3BPFA 2PBHA 3U8EA 2DJGB 1KHQA 3OVXA 1NQCA 2P7UA 2AIMA 3IEJA 3MHHA 1CVZA 1AU0A 4PP2E 1AU4A 1F2CA 5F02A 3B79A 2DC8A 5CVOB 4KLBA 2R6NA 8PCHA 1S4VA 7PCKA 4PADA 2GHUA 4ZUXU 2R9CA 4YV8A 3KX1A 2YJ8A 3LXSA 2AVWA 1QXPA 3OF8A 1GLOA 4XUIA 2C0YA 4N79A 1KXRA 3KFQA 2NQGA 4CDEB 3RVXA 3BPMA 3WXGA 2DC6A 3QJ3A 3O0UA 2DZYA 2FYEA 1PIPA 1EWLA 3H8BA 3KKUA 4X6HA 2DCAA 1CPJA 1O0EA 1U9VA 4YYSA 4DMXA 1IWDA 4BPVA 3CH2X 2R9MA 4CZWA 2ACTA 1PXVA 4BS5A 1CS8A 1PBHA 1Q6KA 3V6EA 2XU4A 1NB3A 1PE6A 2DCBA 3C9EA 3PBHA 5EF4A 4XR7A 1ATKA 2R9OA 1ITOA 2HXZA 2AU1A 2JQFR 4WA6A 1MDWA 3H89A 1VSNA 1SP4B 2O6XA 2DCDA 4BSQA 3PNRA 1HUCB 2ATOA 3H6SA 3BC3A 3K8UA 3MTNA 1F2AA 3N3KA 4OEMA 2YJ2A 2FO5A 4I07A 2VHFA 4YYVA 1MEMA 2P0RA 3M99A 1JQPA 1CSBB 1MEGA 4YVAA 2XU3A 1YVBA 9PAPA 2IBIA 2NQIA 4I04A 1CB5A 2NQDB 4MZOA 1PPDA 1U9WA 3ZUAA 1F2BA 4G54A 1YALA 3O1GA 3WXEA 1EWPA 3PW3A 1DEUA 2DC9A 2AYNA 3N3GA 3QT4A 2DC7A 2AUZA 1BGOA 4Q8HA 4YYQA 2HD5A 1THEA 5A24A 3IHPA 2FQ9A 4QH6A
chains in the Genus database with same CATH superfamily
1ME3A 2B1NA 2G6DA 1YT7A 4QRVA 4N8WA 4R3DA 3CH3X 4W5BA 1ZCMA 3F75A 4PT5A 1AU2A 2PNSA 4P6GA 3HD3A 4MI7A 2JTCA 2YJ9A 4BOQA 3DF0A 3WXFA 3MORA 2OULA 3BWKA 2BTWA 1AYVA 3W31A 1AECA 3BOWA 3RVVA 2XU1A 2FUDA 4OELA 3AI8A 4W5CA 6PADA 5FPWA 2E02A 4BQVA 4REZA 4QRGA 4PI3A 3TRKA 4RY2A 2AUXA 2HH5A 4MM3B 1MIRA 5K16A 4BOSA 3KW9A 1KFXL 3H8CA 1U5IA 2E00A 1GECE 1PCIA 1PPOA 2GFOA 2BU3A 3V6CA 2G8EA 4MSXA 3HHAA 1BP4A 2PADA 3P5WA 1FH0A 3KWZA 1AU3A 1TLOA 2OZ2A 1ICFA 2DCCA 2CIOA 1BY8A 4HWYA 4I05A 3BCNA 1ZIVA 3OQCA 5CVMA 4CDDB 1AIMA 3PDFA 4RF1A 1NL6A 5CHTA 3ERVA 3F5VA 1X9YA 3IOQA 4W4UA 4WURA 3NHEA 4FIPA 2FTDA 1CQDA 3OVZA 3USVA 1PPPA 4QBBA 5JA7A 2BTWB 3KSEA 1F29A 2PREA 3P5VA 3S3RA 2IPPB 2E03A 2ARYA 2BDLA 3PHXA 1Y4HA 3B21A 2R9FA 3IUTA 2VHSA 4M0WA 2DZZA 2BDZA 3HHIA 1SNKA 3IMAA 1U9XA 1PADA 4YYWA 1GCBA 3GCBA 4CDFB 5CVNB 2E01A 2F7DA 4P6EA 2F1GA 1POPA 2J7QC 3HWNA 4DMYA 1U9QX 2FRAA 2XU5A 1DKIA 2AS8A 1CV8A 3QSDA 1QDQA 1YK7A 1KFUL 1MS6A 2J7QA 2YJBA 4X6JA 3ZNHA 2H7JA 1GMYA 4P16A 3I3TA 2G8JA 4D8BA 5JH3A 2FT2A 5J94A 1Y08A 1CJLA 1DF0A 3BBAA 4FJCA 2FRQA 4IP3A 3S3QA 3K24A 3OF9A 2CB5A 3MJ5A 3P5XA 1EWOA 1PPNA 3OISA 3MHSA 1NPZA 4X6IA 4YYRA 2B1MA 4BOUA 1NLJA 1NB5A 2YJCA 4AXMA 1AYWA 3PSEA 2OP3A 3BY4A 1YK8A 1AYUA 3PHUA 3LFYA 3E1ZB 1VJVA 3N4CA 5EGWA 3H7DA 2JQGR 1A6RA 4OW0A 4K7CA 5PADA 3K9MA 4Q8GA 3W30A 3KWBX 5KO3A 3MP2A 4BOPA 4YYUA 4XZXA 1K3BB 4BS6A 1KHPA 1TU6A 4CDCB 3CBJA 4A5UA 3P5UA 1M6DA 2HWKA 4MZSA 1UKFA 1ME4A 1EWMA 2Y5BA 4PP1A 3CBKA 3RVWA 1STFE 1TL9A 3I06A 2R9NA 2NQAA 4AXLA 2HHNA 3TNXA 1QOLA 1QMYA 3MTVA 2Y6EA 4QRXA 1BQIA 2AYOA 1MHWA 5CHVA 4N4ZA 1EF7A 2G7YA 3IV2A 4FK5A 4RNAA 3C0RA 2P86A 3D6SA 3O65A 4IUMA 2WBFX 1XKGA 2DJFB 1CTEA 3BPFA 2PBHA 3U8EA 2AGAA 2DJGB 1KHQA 3IFUA 4GUAA 3OVXA 1NQCA 2P7UA 2AIMA 3PRMA 3IEJA 3MHHA 4BOZA 1CVZA 1AU0A 4PP2E 1AU4A 1F2CA 2JRIA 5F02A 3B79A 2DC8A 5CVOB 4KLBA 2R6NA 8PCHA 1S4VA 7PCKA 4PADA 2GHUA 4ZUXU 3PRPA 2R9CA 4YV8A 3TMPA 3KX1A 2YJ8A 4OVZA 3RNVA 3LXSA 2AVWA 2FE8A 3PT2A 1QXPA 3OF8A 1GLOA 4XUIA 2C0YA 4N79A 1KXRA 3KFQA 2NQGA 4CDEB 3RVXA 4HXDB 3BPMA 3WXGA 2DC6A 3QJ3A 3O0UA 2DZYA 2FYEA 1PIPA 1EWLA 3H8BA 3KKUA 4X6HA 2DCAA 1CPJA 1O0EA 1U9VA 4ZTBA 4YYSA 4DMXA 1IWDA 4BPVA 3CH2X 2R9MA 4CZWA 2ACTA 1PXVA 4BS5A 1CS8A 1PBHA 1Q6KA 3V6EA 2XU4A 1NB3A 1PE6A 5JZEA 2DCBA 3C9EA 3PBHA 5EF4A 4XR7A 1ATKA 2R9OA 1ITOA 3E9SA 2HXZA 2AU1A 5E6JA 2JQFR 4WA6A 1MDWA 3H89A 1VSNA 1SP4B 2O6XA 2DCDA 4BSQA 3PNRA 4D8EA 1HUCB 2ATOA 1PVJA 3H6SA 3BC3A 3K8UA 3PHWA 3MTNA 1F2AA 3N3KA 2UZJA 5EZSA 4OEMA 2YJ2A 2FO5A 3BB7A 4I07A 2VHFA 4YYVA 1MEMA 2P0RA 5EZQA 3M99A 1JQPA 1CSBB 4D8IA 1MEGA 4YVAA 4RKXA 2XU3A 1YVBA 9PAPA 2DOSA 2IBIA 2NQIA 4I04A 1CB5A 2NQDB 4MZOA 1PPDA 2Z84A 1U9WA 3ZUAA 1F2BA 4G54A 4OVZB 1YALA 3O1GA 3WXEA 1EWPA 3PW3A 1DEUA 2DC9A 2AYNA 3N3GA 3QT4A 2DC7A 2AUZA 1BGOA 4Q8HA 4YYQA 2HD5A 1THEA 5A24A 3IHPA 4RF0A 2FQ9A 4QH6A 1YZBA
chains in the Genus database with same CATH topology
1ME3A 2B1NA 2G6DA 1YT7A 4QRVA 4N8WA 3CH3X 4W5BA 1ZCMA 3F75A 1AU2A 2PNSA 4P6GA 3HD3A 2YJ9A 3DF0A 3WXFA 3MORA 2OULA 3BWKA 1AYVA 1AECA 3BOWA 3RVVA 3D9WA 2XU1A 2FUDA 4OELA 3AI8A 4W5CA 6PADA 5FPWA 2E02A 4BQVA 4QRGA 4PI3A 4RY2A 2AUXA 2HH5A 5K16A 1MIRA 3KW9A 1KFXL 3H8CA 1U5IA 2E00A 1GECE 1PCIA 1PPOA 2GFOA 3V6CA 2G8EA 4MSXA 3HHAA 1BP4A 2PADA 3P5WA 1FH0A 3KWZA 1AU3A 1TLOA 2OZ2A 1ICFA 2DCCA 2CIOA 1BY8A 4HWYA 4I05A 3BCNA 1ZIVA 5CVMA 4CDDB 1AIMA 3PDFA 1NL6A 5CHTA 3ERVA 3F5VA 1X9YA 3IOQA 4W4UA 3NHEA 4FIPA 2FTDA 1CQDA 3OVZA 3USVA 1PPPA 4QBBA 5JA7A 3KSEA 1F29A 2PREA 3P5VA 3S3RA 2IPPB 2E03A 2ARYA 2BDLA 1Y4HA 2R9FA 3IUTA 2VHSA 2DZZA 2BDZA 3HHIA 1SNKA 3IMAA 1U9XA 1PADA 4YYWA 1GCBA 3GCBA 4CDFB 5CVNB 2E01A 2VFCA 2F7DA 4P6EA 2F1GA 1POPA 3HWNA 4DMYA 1U9QX 2FRAA 2XU5A 2AS8A 1CV8A 1W6FA 3QSDA 1QDQA 1YK7A 1KFUL 1MS6A 2YJBA 4X6JA 2H7JA 1GMYA 3I3TA 2G8JA 2BSZA 5JH3A 2FT2A 5J94A 1Y08A 1CJLA 1DF0A 4FJCA 2FRQA 3S3QA 3K24A 3OF9A 2CB5A 3P5XA 1EWOA 1PPNA 3OISA 3MHSA 1NPZA 4X6IA 4YYRA 2B1MA 1NLJA 1NB5A 2YJCA 4AXMA 1AYWA 2OP3A 1YK8A 1AYUA 1GX3A 3LFYA 3E1ZB 1VJVA 3N4CA 5EGWA 3H7DA 2JQGR 1A6RA 4K7CA 5PADA 3K9MA 4Q8GA 3KWBX 4GUZA 4YYUA 1W4TA 1K3BB 4BS6A 1KHPA 1TU6A 4CDCB 3CBJA 4NV7A 3P5UA 1M6DA 4MZSA 1ME4A 1EWMA 2Y5BA 4PP1A 3CBKA 3RVWA 1STFE 1TL9A 3I06A 2R9NA 2NQAA 4AXLA 2HHNA 3TNXA 1QOLA 1QMYA 4BGFA 2Y6EA 4QRXA 1BQIA 2AYOA 1MHWA 5CHVA 4N4ZA 1EF7A 2G7YA 3IV2A 4FK5A 2P86A 3D6SA 2WBFX 1XKGA 2DJFB 1CTEA 3BPFA 2PBHA 3U8EA 2DJGB 2VFBA 1KHQA 4B55A 3OVXA 1NQCA 2P7UA 2AIMA 3IEJA 3MHHA 1CVZA 1AU0A 4PP2E 1AU4A 1E2TA 1F2CA 5F02A 3B79A 2DC8A 5CVOB 3LTWA 4KLBA 2R6NA 8PCHA 1S4VA 7PCKA 4PADA 2GHUA 4ZUXU 2R9CA 4YV8A 3KX1A 2YJ8A 3LXSA 2AVWA 1QXPA 3OF8A 1GLOA 4XUIA 2C0YA 4N79A 1KXRA 3KFQA 2NQGA 4CDEB 3RVXA 3BPMA 3WXGA 2DC6A 3QJ3A 3O0UA 2DZYA 2FYEA 1PIPA 1EWLA 3H8BA 3KKUA 4X6HA 2DCAA 1CPJA 1O0EA 1U9VA 4YYSA 4DMXA 1IWDA 4BPVA 3CH2X 2R9MA 4CZWA 2ACTA 1PXVA 4BS5A 1CS8A 1PBHA 1Q6KA 3V6EA 2XU4A 1NB3A 1PE6A 2DCBA 3C9EA 3PBHA 5EF4A 4XR7A 1ATKA 2R9OA 1ITOA 2HXZA 2AU1A 2JQFR 4WA6A 1MDWA 3H89A 1W5RA 1VSNA 1SP4B 2O6XA 4C5PA 2DCDA 4BSQA 3PNRA 1HUCB 2ATOA 3H6SA 3BC3A 3K8UA 3MTNA 1F2AA 3N3KA 4OEMA 2YJ2A 2FO5A 4I07A 2VHFA 4YYVA 1MEMA 2P0RA 3M99A 1JQPA 1CSBB 1MEGA 4YVAA 2XU3A 1YVBA 9PAPA 2IBIA 2NQIA 4I04A 1CB5A 2NQDB 4MZOA 1PPDA 1U9WA 3ZUAA 1F2BA 4G54A 1YALA 4NV8A 3O1GA 3WXEA 1EWPA 3PW3A 1DEUA 2DC9A 2AYNA 3N3GA 3QT4A 2DC7A 2AUZA 1BGOA 4Q8HA 4YYQA 2HD5A 1THEA 5A24A 3IHPA 2FQ9A 4QH6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ME3 A;  2B1N A;  2G6D A;  1YT7 A;  4QRV A;  4N8W A;  3CH3 X;  4W5B A;  1ZCM A;  3F75 A;  1AU2 A;  2PNS A;  4P6G A;  3HD3 A;  2YJ9 A;  3DF0 A;  3WXF A;  3MOR A;  2OUL A;  3BWK A;  1AYV A;  1AEC A;  3BOW A;  3RVV A;  2XU1 A;  2FUD A;  4OEL A;  3AI8 A;  4W5C A;  6PAD A;  5FPW A;  2E02 A;  4BQV A;  4QRG A;  4PI3 A;  4RY2 A;  2AUX A;  2HH5 A;  5K16 A;  1MIR A;  3KW9 A;  1KFX L;  3H8C A;  1U5I A;  2E00 A;  1GEC E;  1PCI A;  1PPO A;  2GFO A;  3V6C A;  2G8E A;  4MSX A;  3HHA A;  1BP4 A;  2PAD A;  3P5W A;  1FH0 A;  3KWZ A;  1AU3 A;  1TLO A;  2OZ2 A;  1ICF A;  2DCC A;  2CIO A;  1BY8 A;  4HWY A;  4I05 A;  3BCN A;  1ZIV A;  5CVM A;  4CDD B;  1AIM A;  3PDF A;  1NL6 A;  5CHT A;  3ERV A;  3F5V A;  1X9Y A;  3IOQ A;  4W4U A;  3NHE A;  4FIP A;  2FTD A;  1CQD A;  3OVZ A;  3USV A;  1PPP A;  4QBB A;  5JA7 A;  3KSE A;  1F29 A;  2PRE A;  3P5V A;  3S3R A;  2IPP B;  2E03 A;  2ARY A;  2BDL A;  1Y4H A;  2R9F A;  3IUT A;  2VHS A;  2DZZ A;  2BDZ A;  3HHI A;  1SNK A;  3IMA A;  1U9X A;  1PAD A;  4YYW A;  1GCB A;  3GCB A;  4CDF B;  5CVN B;  2E01 A;  2F7D A;  4P6E A;  2F1G A;  1POP A;  3HWN A;  4DMY A;  1U9Q X;  2FRA A;  2XU5 A;  2AS8 A;  1CV8 A;  3QSD A;  1QDQ A;  1YK7 A;  1KFU L;  1MS6 A;  2YJB A;  4X6J A;  2H7J A;  1GMY A;  3I3T A;  2G8J A;  5JH3 A;  2FT2 A;  5J94 A;  1Y08 A;  1CJL A;  1DF0 A;  4FJC A;  2FRQ A;  3S3Q A;  3K24 A;  3OF9 A;  2CB5 A;  3P5X A;  1EWO A;  1PPN A;  3OIS A;  3MHS A;  1NPZ A;  4X6I A;  4YYR A;  2B1M A;  1NLJ A;  1NB5 A;  2YJC A;  4AXM A;  1AYW A;  2OP3 A;  1YK8 A;  1AYU A;  3LFY A;  3E1Z B;  1VJV A;  3N4C A;  5EGW A;  3H7D A;  2JQG R;  1A6R A;  4K7C A;  5PAD A;  3K9M A;  4Q8G A;  3KWB X;  4YYU A;  1K3B B;  4BS6 A;  1KHP A;  1TU6 A;  4CDC B;  3CBJ A;  3P5U A;  1M6D A;  4MZS A;  1ME4 A;  1EWM A;  2Y5B A;  4PP1 A;  3CBK A;  3RVW A;  1STF E;  1TL9 A;  3I06 A;  2R9N A;  2NQA A;  4AXL A;  2HHN A;  3TNX A;  1QOL A;  1QMY A;  2Y6E A;  4QRX A;  1BQI A;  2AYO A;  1MHW A;  5CHV A;  4N4Z A;  1EF7 A;  2G7Y A;  3IV2 A;  4FK5 A;  2P86 A;  3D6S A;  2WBF X;  1XKG A;  2DJF B;  1CTE A;  3BPF A;  2PBH A;  3U8E A;  2DJG B;  1KHQ A;  3OVX A;  1NQC A;  2P7U A;  2AIM A;  3IEJ A;  3MHH A;  1CVZ A;  1AU0 A;  4PP2 E;  1AU4 A;  1F2C A;  5F02 A;  3B79 A;  2DC8 A;  5CVO B;  4KLB A;  2R6N A;  8PCH A;  1S4V A;  7PCK A;  4PAD A;  2GHU A;  4ZUX U;  2R9C A;  4YV8 A;  3KX1 A;  2YJ8 A;  3LXS A;  2AVW A;  1QXP A;  3OF8 A;  1GLO A;  4XUI A;  2C0Y A;  4N79 A;  1KXR A;  3KFQ A;  2NQG A;  4CDE B;  3RVX A;  3BPM A;  3WXG A;  2DC6 A;  3QJ3 A;  3O0U A;  2DZY A;  2FYE A;  1PIP A;  1EWL A;  3H8B A;  3KKU A;  4X6H A;  2DCA A;  1CPJ A;  1O0E A;  1U9V A;  4YYS A;  4DMX A;  1IWD A;  4BPV A;  3CH2 X;  2R9M A;  4CZW A;  2ACT A;  1PXV A;  4BS5 A;  1CS8 A;  1PBH A;  1Q6K A;  3V6E A;  2XU4 A;  1NB3 A;  1PE6 A;  2DCB A;  3C9E A;  3PBH A;  5EF4 A;  4XR7 A;  1ATK A;  2R9O A;  1ITO A;  2HXZ A;  2AU1 A;  2JQF R;  4WA6 A;  1MDW A;  3H89 A;  1VSN A;  1SP4 B;  2O6X A;  2DCD A;  4BSQ A;  3PNR A;  1HUC B;  2ATO A;  3H6S A;  3BC3 A;  3K8U A;  3MTN A;  1F2A A;  3N3K A;  4OEM A;  2YJ2 A;  2FO5 A;  4I07 A;  2VHF A;  4YYV A;  1MEM A;  2P0R A;  3M99 A;  1JQP A;  1CSB B;  1MEG A;  4YVA A;  2XU3 A;  1YVB A;  9PAP A;  2IBI A;  2NQI A;  4I04 A;  1CB5 A;  2NQD B;  4MZO A;  1PPD A;  1U9W A;  3ZUA A;  1F2B A;  4G54 A;  1YAL A;  3O1G A;  3WXE A;  1EWP A;  3PW3 A;  1DEU A;  2DC9 A;  2AYN A;  3N3G A;  3QT4 A;  2DC7 A;  2AUZ A;  1BGO A;  4Q8H A;  4YYQ A;  2HD5 A;  1THE A;  5A24 A;  3IHP A;  2FQ9 A;  4QH6 A; 
#chains in the Genus database with same CATH topology
 1ME3 A;  2B1N A;  2G6D A;  1YT7 A;  4QRV A;  4N8W A;  4R3D A;  3CH3 X;  4W5B A;  1ZCM A;  3F75 A;  4PT5 A;  1AU2 A;  2PNS A;  4P6G A;  3HD3 A;  4MI7 A;  2JTC A;  2YJ9 A;  4BOQ A;  3DF0 A;  3WXF A;  3MOR A;  2OUL A;  3BWK A;  2BTW A;  1AYV A;  3W31 A;  1AEC A;  3BOW A;  3RVV A;  2XU1 A;  2FUD A;  4OEL A;  3AI8 A;  4W5C A;  6PAD A;  5FPW A;  2E02 A;  4BQV A;  4REZ A;  4QRG A;  4PI3 A;  3TRK A;  4RY2 A;  2AUX A;  2HH5 A;  4MM3 B;  1MIR A;  5K16 A;  4BOS A;  3KW9 A;  1KFX L;  3H8C A;  1U5I A;  2E00 A;  1GEC E;  1PCI A;  1PPO A;  2GFO A;  2BU3 A;  3V6C A;  2G8E A;  4MSX A;  3HHA A;  1BP4 A;  2PAD A;  3P5W A;  1FH0 A;  3KWZ A;  1AU3 A;  1TLO A;  2OZ2 A;  1ICF A;  2DCC A;  2CIO A;  1BY8 A;  4HWY A;  4I05 A;  3BCN A;  1ZIV A;  3OQC A;  5CVM A;  4CDD B;  1AIM A;  3PDF A;  4RF1 A;  1NL6 A;  5CHT A;  3ERV A;  3F5V A;  1X9Y A;  3IOQ A;  4W4U A;  4WUR A;  3NHE A;  4FIP A;  2FTD A;  1CQD A;  3OVZ A;  3USV A;  1PPP A;  4QBB A;  5JA7 A;  2BTW B;  3KSE A;  1F29 A;  2PRE A;  3P5V A;  3S3R A;  2IPP B;  2E03 A;  2ARY A;  2BDL A;  3PHX A;  1Y4H A;  3B21 A;  2R9F A;  3IUT A;  2VHS A;  4M0W A;  2DZZ A;  2BDZ A;  3HHI A;  1SNK A;  3IMA A;  1U9X A;  1PAD A;  4YYW A;  1GCB A;  3GCB A;  4CDF B;  5CVN B;  2E01 A;  2F7D A;  4P6E A;  2F1G A;  1POP A;  2J7Q C;  3HWN A;  4DMY A;  1U9Q X;  2FRA A;  2XU5 A;  1DKI A;  2AS8 A;  1CV8 A;  3QSD A;  1QDQ A;  1YK7 A;  1KFU L;  1MS6 A;  2J7Q A;  2YJB A;  4X6J A;  3ZNH A;  2H7J A;  1GMY A;  4P16 A;  3I3T A;  2G8J A;  4D8B A;  5JH3 A;  2FT2 A;  5J94 A;  1Y08 A;  1CJL A;  1DF0 A;  3BBA A;  4FJC A;  2FRQ A;  4IP3 A;  3S3Q A;  3K24 A;  3OF9 A;  2CB5 A;  3MJ5 A;  3P5X A;  1EWO A;  1PPN A;  3OIS A;  3MHS A;  1NPZ A;  4X6I A;  4YYR A;  2B1M A;  4BOU A;  1NLJ A;  1NB5 A;  2YJC A;  4AXM A;  1AYW A;  3PSE A;  2OP3 A;  3BY4 A;  1YK8 A;  1AYU A;  3PHU A;  3LFY A;  3E1Z B;  1VJV A;  3N4C A;  5EGW A;  3H7D A;  2JQG R;  1A6R A;  4OW0 A;  4K7C A;  5PAD A;  3K9M A;  4Q8G A;  3W30 A;  3KWB X;  5KO3 A;  3MP2 A;  4BOP A;  4YYU A;  4XZX A;  1K3B B;  4BS6 A;  1KHP A;  1TU6 A;  4CDC B;  3CBJ A;  4A5U A;  3P5U A;  1M6D A;  2HWK A;  4MZS A;  1UKF A;  1ME4 A;  1EWM A;  2Y5B A;  4PP1 A;  3CBK A;  3RVW A;  1STF E;  1TL9 A;  3I06 A;  2R9N A;  2NQA A;  4AXL A;  2HHN A;  3TNX A;  1QOL A;  1QMY A;  3MTV A;  2Y6E A;  4QRX A;  1BQI A;  2AYO A;  1MHW A;  5CHV A;  4N4Z A;  1EF7 A;  2G7Y A;  3IV2 A;  4FK5 A;  4RNA A;  3C0R A;  2P86 A;  3D6S A;  3O65 A;  4IUM A;  2WBF X;  1XKG A;  2DJF B;  1CTE A;  3BPF A;  2PBH A;  3U8E A;  2AGA A;  2DJG B;  1KHQ A;  3IFU A;  4GUA A;  3OVX A;  1NQC A;  2P7U A;  2AIM A;  3PRM A;  3IEJ A;  3MHH A;  4BOZ A;  1CVZ A;  1AU0 A;  4PP2 E;  1AU4 A;  1F2C A;  2JRI A;  5F02 A;  3B79 A;  2DC8 A;  5CVO B;  4KLB A;  2R6N A;  8PCH A;  1S4V A;  7PCK A;  4PAD A;  2GHU A;  4ZUX U;  3PRP A;  2R9C A;  4YV8 A;  3TMP A;  3KX1 A;  2YJ8 A;  4OVZ A;  3RNV A;  3LXS A;  2AVW A;  2FE8 A;  3PT2 A;  1QXP A;  3OF8 A;  1GLO A;  4XUI A;  2C0Y A;  4N79 A;  1KXR A;  3KFQ A;  2NQG A;  4CDE B;  3RVX A;  4HXD B;  3BPM A;  3WXG A;  2DC6 A;  3QJ3 A;  3O0U A;  2DZY A;  2FYE A;  1PIP A;  1EWL A;  3H8B A;  3KKU A;  4X6H A;  2DCA A;  1CPJ A;  1O0E A;  1U9V A;  4ZTB A;  4YYS A;  4DMX A;  1IWD A;  4BPV A;  3CH2 X;  2R9M A;  4CZW A;  2ACT A;  1PXV A;  4BS5 A;  1CS8 A;  1PBH A;  1Q6K A;  3V6E A;  2XU4 A;  1NB3 A;  1PE6 A;  5JZE A;  2DCB A;  3C9E A;  3PBH A;  5EF4 A;  4XR7 A;  1ATK A;  2R9O A;  1ITO A;  3E9S A;  2HXZ A;  2AU1 A;  5E6J A;  2JQF R;  4WA6 A;  1MDW A;  3H89 A;  1VSN A;  1SP4 B;  2O6X A;  2DCD A;  4BSQ A;  3PNR A;  4D8E A;  1HUC B;  2ATO A;  1PVJ A;  3H6S A;  3BC3 A;  3K8U A;  3PHW A;  3MTN A;  1F2A A;  3N3K A;  2UZJ A;  5EZS A;  4OEM A;  2YJ2 A;  2FO5 A;  3BB7 A;  4I07 A;  2VHF A;  4YYV A;  1MEM A;  2P0R A;  5EZQ A;  3M99 A;  1JQP A;  1CSB B;  4D8I A;  1MEG A;  4YVA A;  4RKX A;  2XU3 A;  1YVB A;  9PAP A;  2DOS A;  2IBI A;  2NQI A;  4I04 A;  1CB5 A;  2NQD B;  4MZO A;  1PPD A;  2Z84 A;  1U9W A;  3ZUA A;  1F2B A;  4G54 A;  4OVZ B;  1YAL A;  3O1G A;  3WXE A;  1EWP A;  3PW3 A;  1DEU A;  2DC9 A;  2AYN A;  3N3G A;  3QT4 A;  2DC7 A;  2AUZ A;  1BGO A;  4Q8H A;  4YYQ A;  2HD5 A;  1THE A;  5A24 A;  3IHP A;  4RF0 A;  2FQ9 A;  4QH6 A;  1YZB A; 
#chains in the Genus database with same CATH homology
 1ME3 A;  2B1N A;  2G6D A;  1YT7 A;  4QRV A;  4N8W A;  3CH3 X;  4W5B A;  1ZCM A;  3F75 A;  1AU2 A;  2PNS A;  4P6G A;  3HD3 A;  2YJ9 A;  3DF0 A;  3WXF A;  3MOR A;  2OUL A;  3BWK A;  1AYV A;  1AEC A;  3BOW A;  3RVV A;  3D9W A;  2XU1 A;  2FUD A;  4OEL A;  3AI8 A;  4W5C A;  6PAD A;  5FPW A;  2E02 A;  4BQV A;  4QRG A;  4PI3 A;  4RY2 A;  2AUX A;  2HH5 A;  5K16 A;  1MIR A;  3KW9 A;  1KFX L;  3H8C A;  1U5I A;  2E00 A;  1GEC E;  1PCI A;  1PPO A;  2GFO A;  3V6C A;  2G8E A;  4MSX A;  3HHA A;  1BP4 A;  2PAD A;  3P5W A;  1FH0 A;  3KWZ A;  1AU3 A;  1TLO A;  2OZ2 A;  1ICF A;  2DCC A;  2CIO A;  1BY8 A;  4HWY A;  4I05 A;  3BCN A;  1ZIV A;  5CVM A;  4CDD B;  1AIM A;  3PDF A;  1NL6 A;  5CHT A;  3ERV A;  3F5V A;  1X9Y A;  3IOQ A;  4W4U A;  3NHE A;  4FIP A;  2FTD A;  1CQD A;  3OVZ A;  3USV A;  1PPP A;  4QBB A;  5JA7 A;  3KSE A;  1F29 A;  2PRE A;  3P5V A;  3S3R A;  2IPP B;  2E03 A;  2ARY A;  2BDL A;  1Y4H A;  2R9F A;  3IUT A;  2VHS A;  2DZZ A;  2BDZ A;  3HHI A;  1SNK A;  3IMA A;  1U9X A;  1PAD A;  4YYW A;  1GCB A;  3GCB A;  4CDF B;  5CVN B;  2E01 A;  2VFC A;  2F7D A;  4P6E A;  2F1G A;  1POP A;  3HWN A;  4DMY A;  1U9Q X;  2FRA A;  2XU5 A;  2AS8 A;  1CV8 A;  1W6F A;  3QSD A;  1QDQ A;  1YK7 A;  1KFU L;  1MS6 A;  2YJB A;  4X6J A;  2H7J A;  1GMY A;  3I3T A;  2G8J A;  2BSZ A;  5JH3 A;  2FT2 A;  5J94 A;  1Y08 A;  1CJL A;  1DF0 A;  4FJC A;  2FRQ A;  3S3Q A;  3K24 A;  3OF9 A;  2CB5 A;  3P5X A;  1EWO A;  1PPN A;  3OIS A;  3MHS A;  1NPZ A;  4X6I A;  4YYR A;  2B1M A;  1NLJ A;  1NB5 A;  2YJC A;  4AXM A;  1AYW A;  2OP3 A;  1YK8 A;  1AYU A;  1GX3 A;  3LFY A;  3E1Z B;  1VJV A;  3N4C A;  5EGW A;  3H7D A;  2JQG R;  1A6R A;  4K7C A;  5PAD A;  3K9M A;  4Q8G A;  3KWB X;  4GUZ A;  4YYU A;  1W4T A;  1K3B B;  4BS6 A;  1KHP A;  1TU6 A;  4CDC B;  3CBJ A;  4NV7 A;  3P5U A;  1M6D A;  4MZS A;  1ME4 A;  1EWM A;  2Y5B A;  4PP1 A;  3CBK A;  3RVW A;  1STF E;  1TL9 A;  3I06 A;  2R9N A;  2NQA A;  4AXL A;  2HHN A;  3TNX A;  1QOL A;  1QMY A;  4BGF A;  2Y6E A;  4QRX A;  1BQI A;  2AYO A;  1MHW A;  5CHV A;  4N4Z A;  1EF7 A;  2G7Y A;  3IV2 A;  4FK5 A;  2P86 A;  3D6S A;  2WBF X;  1XKG A;  2DJF B;  1CTE A;  3BPF A;  2PBH A;  3U8E A;  2DJG B;  2VFB A;  1KHQ A;  4B55 A;  3OVX A;  1NQC A;  2P7U A;  2AIM A;  3IEJ A;  3MHH A;  1CVZ A;  1AU0 A;  4PP2 E;  1AU4 A;  1E2T A;  1F2C A;  5F02 A;  3B79 A;  2DC8 A;  5CVO B;  3LTW A;  4KLB A;  2R6N A;  8PCH A;  1S4V A;  7PCK A;  4PAD A;  2GHU A;  4ZUX U;  2R9C A;  4YV8 A;  3KX1 A;  2YJ8 A;  3LXS A;  2AVW A;  1QXP A;  3OF8 A;  1GLO A;  4XUI A;  2C0Y A;  4N79 A;  1KXR A;  3KFQ A;  2NQG A;  4CDE B;  3RVX A;  3BPM A;  3WXG A;  2DC6 A;  3QJ3 A;  3O0U A;  2DZY A;  2FYE A;  1PIP A;  1EWL A;  3H8B A;  3KKU A;  4X6H A;  2DCA A;  1CPJ A;  1O0E A;  1U9V A;  4YYS A;  4DMX A;  1IWD A;  4BPV A;  3CH2 X;  2R9M A;  4CZW A;  2ACT A;  1PXV A;  4BS5 A;  1CS8 A;  1PBH A;  1Q6K A;  3V6E A;  2XU4 A;  1NB3 A;  1PE6 A;  2DCB A;  3C9E A;  3PBH A;  5EF4 A;  4XR7 A;  1ATK A;  2R9O A;  1ITO A;  2HXZ A;  2AU1 A;  2JQF R;  4WA6 A;  1MDW A;  3H89 A;  1W5R A;  1VSN A;  1SP4 B;  2O6X A;  4C5P A;  2DCD A;  4BSQ A;  3PNR A;  1HUC B;  2ATO A;  3H6S A;  3BC3 A;  3K8U A;  3MTN A;  1F2A A;  3N3K A;  4OEM A;  2YJ2 A;  2FO5 A;  4I07 A;  2VHF A;  4YYV A;  1MEM A;  2P0R A;  3M99 A;  1JQP A;  1CSB B;  1MEG A;  4YVA A;  2XU3 A;  1YVB A;  9PAP A;  2IBI A;  2NQI A;  4I04 A;  1CB5 A;  2NQD B;  4MZO A;  1PPD A;  1U9W A;  3ZUA A;  1F2B A;  4G54 A;  1YAL A;  4NV8 A;  3O1G A;  3WXE A;  1EWP A;  3PW3 A;  1DEU A;  2DC9 A;  2AYN A;  3N3G A;  3QT4 A;  2DC7 A;  2AUZ A;  1BGO A;  4Q8H A;  4YYQ A;  2HD5 A;  1THE A;  5A24 A;  3IHP A;  2FQ9 A;  4QH6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...