3HD3A

High resolution crystal structure of cruzain bound to the vinyl sulfone inhibitor smdc-256047
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
215
structure length
215
Chain Sequence
APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLAEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQLDHGVLLVGYNDGAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel non-peptidic vinylsulfones targeting the S2 and S3 subsites of parasite cysteine proteases.
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Hydrolase
molecule keywords Cruzipain
total genus 65
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature ec 3.4.22.51: Cruzipain.
pdb deposition date 2009-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3hd3A00
3BPMA 3KFQA 1NL6A 3I3TA 3N4CA 3KW9A 3OISA 1IWDA 2G7YA 5CVNB 2AS8A 3U8EA 1POPA 2E03A 3LFYA 5J94A 1KHPA 2G8JA 3BCNA 3IUTA 3WXFA 1U9QX 1AU4A 2GFOA 1PE6A 1CB5A 2PREA 5JA7A 4YYUA 5F02A 2YJBA 2NQAA 3IHPA 4PP1A 3CH3X 2ARYA 2R9FA 1ME4A 3IV2A 3P5VA 5JH3A 4Q8GA 4X6JA 1F2AA 1K3BB 1VSNA 1F29A 1NPZA 3KWZA 1NLJA 1GMYA 1O0EA 1AYVA 3S3QA 5A24A 1PPOA 4WA6A 3AI8A 4YYWA 2C0YA 1PPPA 2HD5A 4N8WA 1MDWA 3DF0A 1VJVA 3KSEA 1CVZA 2YJ2A 4BS5A 4RY2A 1PPDA 1AIMA 2Y6EA 1GLOA 2AYNA 3BOWA 3HHIA 4BS6A 1KHQA 3OF9A 4CDEB 6PADA 3PNRA 1U5IA 3P5XA 1TL9A 1F2BA 3OVXA 2HHNA 2R9OA 1CV8A 1MHWA 4K7CA 2AYOA 3QSDA 1CQDA 5EGWA 3H89A 1JQPA 2FO5A 5CHTA 1PIPA 2DJFB 1AU0A 3KWBX 4HWYA 3S3RA 3LXSA 4I05A 1QOLA 2R6NA 2YJ8A 1EWPA 2XU5A 1HUCB 2DCBA 1MS6A 2P86A 2FQ9A 3PDFA 4MZOA 2FUDA 3I06A 3BC3A 1DF0A 1GECE 2H7JA 3B79A 1AU3A 1BY8A 4BSQA 1YK7A 2FYEA 1U9VA 2IBIA 4X6IA 5FPWA 1CPJA 4QRXA 1FH0A 3NHEA 3KKUA 3IEJA 1ITOA 3WXGA 1CS8A 2G6DA 3QJ3A 1NB5A 7PCKA 2B1MA 4QH6A 1CJLA 4OEMA 4CDCB 1CTEA 4QRGA 1QXPA 1PCIA 4PI3A 3TNXA 3CBKA 1CSBB 1M6DA 3K8UA 1MEMA 3H8BA 4P6GA 1SP4B 1YALA 2Y5BA 4XR7A 1PADA 4BPVA 3CH2X 4AXMA 2P0RA 3HD3A 4W5BA 3BWKA 3MHSA 2JQGR 1U9WA 2R9CA 3HHAA 3KX1A 1TLOA 1Y4HA 3H8CA 4N4ZA 4ZUXU 1TU6A 3H6SA 2FT2A 2DCCA 1AU2A 4FK5A 4N79A 1KFXL 3WXEA 4YYRA 3MTNA 2OP3A 2WBFX 4YV8A 2AUXA 1S4VA 2G8EA 5CVMA 5CHVA 2DC6A 2DC9A 2HH5A 2YJ9A 1PXVA 1Y08A 2DC8A 1KFUL 2IPPB 4QRVA 2DZZA 2YJCA 3N3GA 2FTDA 2ACTA 2DZYA 3O0UA 1AYUA 9PAPA 1ATKA 3QT4A 2XU4A 1YK8A 1QMYA 3OF8A 2BDZA 2P7UA 4I04A 3K9MA 2AVWA 3BPFA 4OELA 3HWNA 2FRAA 2AUZA 3IOQA 2R9NA 4MZSA 3K24A 8PCHA 3RVVA 2NQDB 2O6XA 1MIRA 3P5UA 2NQGA 4G54A 3O1GA 3V6CA 1U9XA 3PBHA 2VHSA 3RVXA 1NQCA 2ATOA 3ZUAA 3M99A 4CDDB 1YT7A 5K16A 2HXZA 2PADA 4BQVA 4CZWA 4YYSA 4AXLA 4FJCA 4CDFB 4I07A 4PADA 2E02A 4MSXA 4DMYA 1AYWA 1F2CA 4YYVA 1SNKA 1MEGA 2NQIA 2DJGB 3IMAA 2VHFA 2CIOA 4YVAA 1ZCMA 1PPNA 1GCBA 3USVA 1AECA 2XU3A 3GCBA 1BGOA 3H7DA 1EWLA 1Q6KA 3V6EA 3CBJA 3OVZA 2PNSA 2AU1A 1EWOA 4KLBA 3D6SA 2OULA 1KXRA 4X6HA 1ME3A 2DCAA 3E1ZB 5PADA 5CVOB 2B1NA 4QBBA 2OZ2A 4XUIA 2JQFR 5EF4A 2F7DA 1YVBA 1DEUA 4P6EA 2XU1A 1ICFA 3N3KA 4YYQA 3C9EA 2CB5A 3P5WA 2DC7A 3MORA 3RVWA 2BDLA 1A6RA 1BP4A 1EF7A 4DMXA 3PW3A 1XKGA 2F1GA 2R9MA 4PP2E 4FIPA 2FRQA 1EWMA 3F5VA 1NB3A 3MHHA 2DCDA 2E01A 1STFE 3ERVA 1ZIVA 2PBHA 3F75A 2GHUA 2E00A 4W5CA 1PBHA 1THEA 4Q8HA 1BQIA 1X9YA 4W4UA 1QDQA 2AIMA
chains in the Genus database with same CATH superfamily
3BPMA 3KFQA 1NL6A 3I3TA 3N4CA 3KW9A 3OISA 1IWDA 2G7YA 5CVNB 2AS8A 3U8EA 1POPA 2E03A 3LFYA 5J94A 1KHPA 2G8JA 5EZQA 3BCNA 3IUTA 3WXFA 2BTWA 1U9QX 4PT5A 1AU4A 2Z84A 4OVZA 2DOSA 4D8IA 2GFOA 1PE6A 1CB5A 2PREA 5JA7A 4YYUA 5F02A 2YJBA 2NQAA 3IHPA 4PP1A 3PHUA 3CH3X 2ARYA 2R9FA 1ME4A 3IV2A 3P5VA 5JH3A 4Q8GA 4X6JA 1F2AA 1K3BB 1VSNA 1F29A 1NPZA 3KWZA 1NLJA 1GMYA 1O0EA 1AYVA 3S3QA 5A24A 1PPOA 4OW0A 4WA6A 3AI8A 4YYWA 2C0YA 3IFUA 4D8EA 1PPPA 4MM3B 2HD5A 4N8WA 1MDWA 3DF0A 1VJVA 3KSEA 1CVZA 3W30A 2YJ2A 4BS5A 4RY2A 1PPDA 1AIMA 2Y6EA 1GLOA 2AYNA 3BOWA 3HHIA 4BS6A 1KHQA 3OF9A 4CDEB 4OVZB 6PADA 3TRKA 3PNRA 1U5IA 3P5XA 2J7QA 1TL9A 1F2BA 3OVXA 2HHNA 2R9OA 2J7QC 1CV8A 1MHWA 4K7CA 3E9SA 2AYOA 3QSDA 1CQDA 5EGWA 4WURA 3H89A 1JQPA 2FO5A 5CHTA 4BOPA 1PIPA 4HXDB 2DJFB 4IP3A 1AU0A 3KWBX 4HWYA 3S3RA 4BOSA 4P16A 3LXSA 4I05A 2UZJA 1QOLA 2R6NA 2YJ8A 1EWPA 4M0WA 2XU5A 1HUCB 2DCBA 3MTVA 1MS6A 2P86A 2FQ9A 3PDFA 4MZOA 2FUDA 3I06A 1DKIA 1DF0A 1GECE 3BC3A 2H7JA 3B79A 1AU3A 1BY8A 4BSQA 1YK7A 2FYEA 1U9VA 2IBIA 3BB7A 4X6IA 5FPWA 1CPJA 4QRXA 1FH0A 3NHEA 3KKUA 3IEJA 1ITOA 3WXGA 1CS8A 2G6DA 4BOUA 3QJ3A 1NB5A 7PCKA 2B1MA 3PT2A 4QH6A 3PSEA 1CJLA 4OEMA 1CTEA 4QRGA 4CDCB 1QXPA 1PCIA 4PI3A 3TNXA 3CBKA 4A5UA 1CSBB 1M6DA 3K8UA 3OQCA 1MEMA 4D8BA 3H8BA 4P6GA 1SP4B 1YALA 2Y5BA 4XZXA 4XR7A 1PADA 4BPVA 3CH2X 4AXMA 2P0RA 3HD3A 4W5BA 3BWKA 5JZEA 3MHSA 2JQGR 1U9WA 2R9CA 3HHAA 3KX1A 1TLOA 4RF0A 1Y4HA 3H8CA 4N4ZA 4ZUXU 1TU6A 3H6SA 2FT2A 2DCCA 1PVJA 1AU2A 4FK5A 4N79A 1KFXL 3WXEA 4YYRA 3MTNA 2OP3A 2WBFX 4YV8A 2AUXA 1S4VA 5KO3A 2G8EA 5CVMA 5CHVA 2DC6A 2DC9A 2HH5A 2YJ9A 1PXVA 1Y08A 3C0RA 2DC8A 1KFUL 2IPPB 4REZA 4QRVA 2DZZA 2YJCA 3N3GA 2FTDA 2ACTA 4BOZA 2DZYA 3O0UA 1AYUA 9PAPA 1ATKA 3QT4A 2XU4A 1YK8A 3ZNHA 1QMYA 3OF8A 2BDZA 2P7UA 4I04A 3K9MA 2AVWA 3BPFA 4OELA 3HWNA 4GUAA 2FRAA 2AUZA 3IOQA 2R9NA 4MZSA 3K24A 8PCHA 3RVVA 2BTWB 2NQDB 2O6XA 1MIRA 3BY4A 3P5UA 2JRIA 2NQGA 4G54A 3O1GA 3V6CA 1U9XA 3O65A 3PBHA 2VHSA 2ATOA 1NQCA 3RVXA 4MI7A 3ZUAA 3M99A 4CDDB 1YT7A 2PADA 2FE8A 2HXZA 5K16A 4BQVA 3MP2A 4CZWA 4YYSA 4AXLA 4FJCA 4CDFB 3B21A 4I07A 4PADA 5E6JA 2E02A 4MSXA 4DMYA 1AYWA 1F2CA 4YYVA 1SNKA 1MEGA 2NQIA 2DJGB 3IMAA 2VHFA 2CIOA 4YVAA 1ZCMA 1PPNA 1GCBA 3USVA 1AECA 2XU3A 3GCBA 1BGOA 3H7DA 4BOQA 1EWLA 1Q6KA 3MJ5A 3V6EA 3CBJA 3OVZA 3PRMA 2PNSA 2AU1A 4R3DA 1EWOA 3BBAA 4KLBA 3D6SA 2OULA 1KXRA 4X6HA 1ME3A 2DCAA 3E1ZB 5PADA 5CVOB 2BU3A 2B1NA 4QBBA 2OZ2A 4XUIA 3PHWA 2JQFR 5EF4A 2F7DA 3RNVA 1YVBA 1DEUA 4P6EA 1UKFA 1ICFA 2XU1A 3N3KA 4YYQA 3C9EA 2CB5A 3P5WA 2DC7A 4ZTBA 3MORA 3RVWA 2BDLA 1A6RA 1BP4A 5EZSA 1EF7A 4DMXA 3PW3A 1XKGA 2F1GA 2R9MA 4PP2E 4RKXA 4FIPA 2FRQA 1EWMA 3W31A 3F5VA 1NB3A 3MHHA 2DCDA 2JTCA 2E01A 1YZBA 3PHXA 1STFE 3ERVA 1ZIVA 2HWKA 2PBHA 4IUMA 4RNAA 3TMPA 3PRPA 4RF1A 2AGAA 3F75A 2GHUA 2E00A 4W5CA 1PBHA 1THEA 4Q8HA 1BQIA 1X9YA 4W4UA 1QDQA 2AIMA
chains in the Genus database with same CATH topology
3BPMA 3KFQA 1NL6A 3I3TA 3N4CA 3KW9A 3OISA 1IWDA 2G7YA 5CVNB 2AS8A 3U8EA 1POPA 2E03A 3LFYA 5J94A 1KHPA 2G8JA 3BCNA 3IUTA 3WXFA 2BSZA 1U9QX 1AU4A 4GUZA 2GFOA 1PE6A 1CB5A 2PREA 5JA7A 1E2TA 4YYUA 5F02A 2YJBA 4BGFA 2NQAA 3IHPA 4PP1A 3CH3X 2ARYA 2R9FA 1ME4A 3IV2A 3P5VA 5JH3A 4Q8GA 4X6JA 1F2AA 1K3BB 1VSNA 1F29A 1NPZA 3KWZA 1NLJA 1GMYA 1O0EA 1AYVA 3S3QA 5A24A 1PPOA 4WA6A 3AI8A 4YYWA 2C0YA 1PPPA 2HD5A 4N8WA 1MDWA 3DF0A 1VJVA 3KSEA 1CVZA 2YJ2A 4BS5A 4RY2A 1PPDA 1AIMA 2Y6EA 1GLOA 2AYNA 3BOWA 3HHIA 4NV7A 4BS6A 1KHQA 3OF9A 4CDEB 6PADA 3PNRA 1U5IA 3P5XA 1TL9A 1F2BA 3OVXA 2HHNA 2R9OA 1CV8A 1MHWA 4K7CA 2AYOA 3QSDA 1CQDA 5EGWA 3H89A 1JQPA 2FO5A 5CHTA 1PIPA 2DJFB 1AU0A 3KWBX 4HWYA 3S3RA 3LXSA 4I05A 1QOLA 2R6NA 2YJ8A 1EWPA 2XU5A 1HUCB 2DCBA 1MS6A 2P86A 2FQ9A 3PDFA 4MZOA 2FUDA 3I06A 3BC3A 1DF0A 1GECE 2H7JA 3B79A 1AU3A 1BY8A 4BSQA 1YK7A 2FYEA 1U9VA 2IBIA 4X6IA 5FPWA 1CPJA 4QRXA 1FH0A 3NHEA 3KKUA 3IEJA 1ITOA 3WXGA 1CS8A 2G6DA 3QJ3A 1NB5A 7PCKA 2B1MA 4QH6A 1CJLA 4OEMA 4CDCB 1CTEA 4QRGA 1QXPA 1PCIA 4PI3A 3TNXA 3CBKA 1CSBB 1M6DA 3K8UA 1MEMA 3H8BA 4P6GA 1SP4B 1YALA 2Y5BA 4XR7A 1PADA 4BPVA 3CH2X 4AXMA 2P0RA 3HD3A 4W5BA 3BWKA 3MHSA 2JQGR 1U9WA 2R9CA 4B55A 3HHAA 3KX1A 1TLOA 1Y4HA 3H8CA 4N4ZA 4ZUXU 1TU6A 3H6SA 2VFBA 2FT2A 2DCCA 1AU2A 4FK5A 4N79A 1KFXL 3WXEA 4YYRA 3MTNA 2OP3A 2WBFX 4YV8A 2AUXA 1S4VA 2G8EA 5CVMA 5CHVA 2DC6A 2DC9A 2HH5A 1W5RA 2YJ9A 1PXVA 1Y08A 2DC8A 1KFUL 2IPPB 4QRVA 2DZZA 2YJCA 3N3GA 2FTDA 2ACTA 2DZYA 3O0UA 1AYUA 9PAPA 1ATKA 3QT4A 2XU4A 1YK8A 1QMYA 3OF8A 2BDZA 2P7UA 3D9WA 4I04A 3K9MA 2AVWA 3BPFA 4OELA 3HWNA 2FRAA 2AUZA 3IOQA 2R9NA 4MZSA 3K24A 8PCHA 3RVVA 2NQDB 2O6XA 1MIRA 3P5UA 2NQGA 4G54A 3O1GA 3V6CA 1U9XA 3PBHA 2VHSA 2ATOA 1NQCA 3RVXA 3ZUAA 3M99A 4CDDB 1YT7A 2PADA 2HXZA 5K16A 4BQVA 4CZWA 4YYSA 4AXLA 4FJCA 4CDFB 4I07A 4PADA 2E02A 4MSXA 4C5PA 1GX3A 4DMYA 1AYWA 1F2CA 4YYVA 1SNKA 1W6FA 1MEGA 2NQIA 2DJGB 3IMAA 2VHFA 2CIOA 4YVAA 1ZCMA 1PPNA 1GCBA 3USVA 1AECA 2XU3A 3GCBA 1BGOA 3H7DA 1EWLA 1Q6KA 3V6EA 3CBJA 3OVZA 2PNSA 1W4TA 2AU1A 1EWOA 4KLBA 3D6SA 2OULA 1KXRA 4X6HA 1ME3A 2DCAA 3E1ZB 5PADA 5CVOB 2B1NA 4QBBA 2OZ2A 4XUIA 2JQFR 5EF4A 2F7DA 1YVBA 1DEUA 4P6EA 2XU1A 1ICFA 3N3KA 4YYQA 3C9EA 2CB5A 3P5WA 2DC7A 3MORA 3RVWA 2BDLA 1A6RA 1BP4A 1EF7A 4DMXA 4NV8A 3PW3A 1XKGA 2F1GA 2R9MA 4PP2E 4FIPA 2FRQA 1EWMA 3F5VA 1NB3A 3MHHA 2DCDA 2E01A 1STFE 3ERVA 1ZIVA 2PBHA 3F75A 2VFCA 2GHUA 2E00A 4W5CA 1PBHA 1THEA 4Q8HA 1BQIA 1X9YA 4W4UA 3LTWA 1QDQA 2AIMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BPM A;  3KFQ A;  1NL6 A;  3I3T A;  3N4C A;  3KW9 A;  3OIS A;  1IWD A;  2G7Y A;  5CVN B;  2AS8 A;  3U8E A;  1POP A;  2E03 A;  3LFY A;  5J94 A;  1KHP A;  2G8J A;  3BCN A;  3IUT A;  3WXF A;  1U9Q X;  1AU4 A;  2GFO A;  1PE6 A;  1CB5 A;  2PRE A;  5JA7 A;  4YYU A;  5F02 A;  2YJB A;  2NQA A;  3IHP A;  4PP1 A;  3CH3 X;  2ARY A;  2R9F A;  1ME4 A;  3IV2 A;  3P5V A;  5JH3 A;  4Q8G A;  4X6J A;  1F2A A;  1K3B B;  1VSN A;  1F29 A;  1NPZ A;  3KWZ A;  1NLJ A;  1GMY A;  1O0E A;  1AYV A;  3S3Q A;  5A24 A;  1PPO A;  4WA6 A;  3AI8 A;  4YYW A;  2C0Y A;  1PPP A;  2HD5 A;  4N8W A;  1MDW A;  3DF0 A;  1VJV A;  3KSE A;  1CVZ A;  2YJ2 A;  4BS5 A;  4RY2 A;  1PPD A;  1AIM A;  2Y6E A;  1GLO A;  2AYN A;  3BOW A;  3HHI A;  4BS6 A;  1KHQ A;  3OF9 A;  4CDE B;  6PAD A;  3PNR A;  1U5I A;  3P5X A;  1TL9 A;  1F2B A;  3OVX A;  2HHN A;  2R9O A;  1CV8 A;  1MHW A;  4K7C A;  2AYO A;  3QSD A;  1CQD A;  5EGW A;  3H89 A;  1JQP A;  2FO5 A;  5CHT A;  1PIP A;  2DJF B;  1AU0 A;  3KWB X;  4HWY A;  3S3R A;  3LXS A;  4I05 A;  1QOL A;  2R6N A;  2YJ8 A;  1EWP A;  2XU5 A;  1HUC B;  2DCB A;  1MS6 A;  2P86 A;  2FQ9 A;  3PDF A;  4MZO A;  2FUD A;  3I06 A;  3BC3 A;  1DF0 A;  1GEC E;  2H7J A;  3B79 A;  1AU3 A;  1BY8 A;  4BSQ A;  1YK7 A;  2FYE A;  1U9V A;  2IBI A;  4X6I A;  5FPW A;  1CPJ A;  4QRX A;  1FH0 A;  3NHE A;  3KKU A;  3IEJ A;  1ITO A;  3WXG A;  1CS8 A;  2G6D A;  3QJ3 A;  1NB5 A;  7PCK A;  2B1M A;  4QH6 A;  1CJL A;  4OEM A;  4CDC B;  1CTE A;  4QRG A;  1QXP A;  1PCI A;  4PI3 A;  3TNX A;  3CBK A;  1CSB B;  1M6D A;  3K8U A;  1MEM A;  3H8B A;  4P6G A;  1SP4 B;  1YAL A;  2Y5B A;  4XR7 A;  1PAD A;  4BPV A;  3CH2 X;  4AXM A;  2P0R A;  3HD3 A;  4W5B A;  3BWK A;  3MHS A;  2JQG R;  1U9W A;  2R9C A;  3HHA A;  3KX1 A;  1TLO A;  1Y4H A;  3H8C A;  4N4Z A;  4ZUX U;  1TU6 A;  3H6S A;  2FT2 A;  2DCC A;  1AU2 A;  4FK5 A;  4N79 A;  1KFX L;  3WXE A;  4YYR A;  3MTN A;  2OP3 A;  2WBF X;  4YV8 A;  2AUX A;  1S4V A;  2G8E A;  5CVM A;  5CHV A;  2DC6 A;  2DC9 A;  2HH5 A;  2YJ9 A;  1PXV A;  1Y08 A;  2DC8 A;  1KFU L;  2IPP B;  4QRV A;  2DZZ A;  2YJC A;  3N3G A;  2FTD A;  2ACT A;  2DZY A;  3O0U A;  1AYU A;  9PAP A;  1ATK A;  3QT4 A;  2XU4 A;  1YK8 A;  1QMY A;  3OF8 A;  2BDZ A;  2P7U A;  4I04 A;  3K9M A;  2AVW A;  3BPF A;  4OEL A;  3HWN A;  2FRA A;  2AUZ A;  3IOQ A;  2R9N A;  4MZS A;  3K24 A;  8PCH A;  3RVV A;  2NQD B;  2O6X A;  1MIR A;  3P5U A;  2NQG A;  4G54 A;  3O1G A;  3V6C A;  1U9X A;  3PBH A;  2VHS A;  3RVX A;  1NQC A;  2ATO A;  3ZUA A;  3M99 A;  4CDD B;  1YT7 A;  5K16 A;  2HXZ A;  2PAD A;  4BQV A;  4CZW A;  4YYS A;  4AXL A;  4FJC A;  4CDF B;  4I07 A;  4PAD A;  2E02 A;  4MSX A;  4DMY A;  1AYW A;  1F2C A;  4YYV A;  1SNK A;  1MEG A;  2NQI A;  2DJG B;  3IMA A;  2VHF A;  2CIO A;  4YVA A;  1ZCM A;  1PPN A;  1GCB A;  3USV A;  1AEC A;  2XU3 A;  3GCB A;  1BGO A;  3H7D A;  1EWL A;  1Q6K A;  3V6E A;  3CBJ A;  3OVZ A;  2PNS A;  2AU1 A;  1EWO A;  4KLB A;  3D6S A;  2OUL A;  1KXR A;  4X6H A;  1ME3 A;  2DCA A;  3E1Z B;  5PAD A;  5CVO B;  2B1N A;  4QBB A;  2OZ2 A;  4XUI A;  2JQF R;  5EF4 A;  2F7D A;  1YVB A;  1DEU A;  4P6E A;  2XU1 A;  1ICF A;  3N3K A;  4YYQ A;  3C9E A;  2CB5 A;  3P5W A;  2DC7 A;  3MOR A;  3RVW A;  2BDL A;  1A6R A;  1BP4 A;  1EF7 A;  4DMX A;  3PW3 A;  1XKG A;  2F1G A;  2R9M A;  4PP2 E;  4FIP A;  2FRQ A;  1EWM A;  3F5V A;  1NB3 A;  3MHH A;  2DCD A;  2E01 A;  1STF E;  3ERV A;  1ZIV A;  2PBH A;  3F75 A;  2GHU A;  2E00 A;  4W5C A;  1PBH A;  1THE A;  4Q8H A;  1BQI A;  1X9Y A;  4W4U A;  1QDQ A;  2AIM A; 
#chains in the Genus database with same CATH topology
 3BPM A;  3KFQ A;  1NL6 A;  3I3T A;  3N4C A;  3KW9 A;  3OIS A;  1IWD A;  2G7Y A;  5CVN B;  2AS8 A;  3U8E A;  1POP A;  2E03 A;  3LFY A;  5J94 A;  1KHP A;  2G8J A;  5EZQ A;  3BCN A;  3IUT A;  3WXF A;  2BTW A;  1U9Q X;  4PT5 A;  1AU4 A;  2Z84 A;  4OVZ A;  2DOS A;  4D8I A;  2GFO A;  1PE6 A;  1CB5 A;  2PRE A;  5JA7 A;  4YYU A;  5F02 A;  2YJB A;  2NQA A;  3IHP A;  4PP1 A;  3PHU A;  3CH3 X;  2ARY A;  2R9F A;  1ME4 A;  3IV2 A;  3P5V A;  5JH3 A;  4Q8G A;  4X6J A;  1F2A A;  1K3B B;  1VSN A;  1F29 A;  1NPZ A;  3KWZ A;  1NLJ A;  1GMY A;  1O0E A;  1AYV A;  3S3Q A;  5A24 A;  1PPO A;  4OW0 A;  4WA6 A;  3AI8 A;  4YYW A;  2C0Y A;  3IFU A;  4D8E A;  1PPP A;  4MM3 B;  2HD5 A;  4N8W A;  1MDW A;  3DF0 A;  1VJV A;  3KSE A;  1CVZ A;  3W30 A;  2YJ2 A;  4BS5 A;  4RY2 A;  1PPD A;  1AIM A;  2Y6E A;  1GLO A;  2AYN A;  3BOW A;  3HHI A;  4BS6 A;  1KHQ A;  3OF9 A;  4CDE B;  4OVZ B;  6PAD A;  3TRK A;  3PNR A;  1U5I A;  3P5X A;  2J7Q A;  1TL9 A;  1F2B A;  3OVX A;  2HHN A;  2R9O A;  2J7Q C;  1CV8 A;  1MHW A;  4K7C A;  3E9S A;  2AYO A;  3QSD A;  1CQD A;  5EGW A;  4WUR A;  3H89 A;  1JQP A;  2FO5 A;  5CHT A;  4BOP A;  1PIP A;  4HXD B;  2DJF B;  4IP3 A;  1AU0 A;  3KWB X;  4HWY A;  3S3R A;  4BOS A;  4P16 A;  3LXS A;  4I05 A;  2UZJ A;  1QOL A;  2R6N A;  2YJ8 A;  1EWP A;  4M0W A;  2XU5 A;  1HUC B;  2DCB A;  3MTV A;  1MS6 A;  2P86 A;  2FQ9 A;  3PDF A;  4MZO A;  2FUD A;  3I06 A;  1DKI A;  1DF0 A;  1GEC E;  3BC3 A;  2H7J A;  3B79 A;  1AU3 A;  1BY8 A;  4BSQ A;  1YK7 A;  2FYE A;  1U9V A;  2IBI A;  3BB7 A;  4X6I A;  5FPW A;  1CPJ A;  4QRX A;  1FH0 A;  3NHE A;  3KKU A;  3IEJ A;  1ITO A;  3WXG A;  1CS8 A;  2G6D A;  4BOU A;  3QJ3 A;  1NB5 A;  7PCK A;  2B1M A;  3PT2 A;  4QH6 A;  3PSE A;  1CJL A;  4OEM A;  1CTE A;  4QRG A;  4CDC B;  1QXP A;  1PCI A;  4PI3 A;  3TNX A;  3CBK A;  4A5U A;  1CSB B;  1M6D A;  3K8U A;  3OQC A;  1MEM A;  4D8B A;  3H8B A;  4P6G A;  1SP4 B;  1YAL A;  2Y5B A;  4XZX A;  4XR7 A;  1PAD A;  4BPV A;  3CH2 X;  4AXM A;  2P0R A;  3HD3 A;  4W5B A;  3BWK A;  5JZE A;  3MHS A;  2JQG R;  1U9W A;  2R9C A;  3HHA A;  3KX1 A;  1TLO A;  4RF0 A;  1Y4H A;  3H8C A;  4N4Z A;  4ZUX U;  1TU6 A;  3H6S A;  2FT2 A;  2DCC A;  1PVJ A;  1AU2 A;  4FK5 A;  4N79 A;  1KFX L;  3WXE A;  4YYR A;  3MTN A;  2OP3 A;  2WBF X;  4YV8 A;  2AUX A;  1S4V A;  5KO3 A;  2G8E A;  5CVM A;  5CHV A;  2DC6 A;  2DC9 A;  2HH5 A;  2YJ9 A;  1PXV A;  1Y08 A;  3C0R A;  2DC8 A;  1KFU L;  2IPP B;  4REZ A;  4QRV A;  2DZZ A;  2YJC A;  3N3G A;  2FTD A;  2ACT A;  4BOZ A;  2DZY A;  3O0U A;  1AYU A;  9PAP A;  1ATK A;  3QT4 A;  2XU4 A;  1YK8 A;  3ZNH A;  1QMY A;  3OF8 A;  2BDZ A;  2P7U A;  4I04 A;  3K9M A;  2AVW A;  3BPF A;  4OEL A;  3HWN A;  4GUA A;  2FRA A;  2AUZ A;  3IOQ A;  2R9N A;  4MZS A;  3K24 A;  8PCH A;  3RVV A;  2BTW B;  2NQD B;  2O6X A;  1MIR A;  3BY4 A;  3P5U A;  2JRI A;  2NQG A;  4G54 A;  3O1G A;  3V6C A;  1U9X A;  3O65 A;  3PBH A;  2VHS A;  2ATO A;  1NQC A;  3RVX A;  4MI7 A;  3ZUA A;  3M99 A;  4CDD B;  1YT7 A;  2PAD A;  2FE8 A;  2HXZ A;  5K16 A;  4BQV A;  3MP2 A;  4CZW A;  4YYS A;  4AXL A;  4FJC A;  4CDF B;  3B21 A;  4I07 A;  4PAD A;  5E6J A;  2E02 A;  4MSX A;  4DMY A;  1AYW A;  1F2C A;  4YYV A;  1SNK A;  1MEG A;  2NQI A;  2DJG B;  3IMA A;  2VHF A;  2CIO A;  4YVA A;  1ZCM A;  1PPN A;  1GCB A;  3USV A;  1AEC A;  2XU3 A;  3GCB A;  1BGO A;  3H7D A;  4BOQ A;  1EWL A;  1Q6K A;  3MJ5 A;  3V6E A;  3CBJ A;  3OVZ A;  3PRM A;  2PNS A;  2AU1 A;  4R3D A;  1EWO A;  3BBA A;  4KLB A;  3D6S A;  2OUL A;  1KXR A;  4X6H A;  1ME3 A;  2DCA A;  3E1Z B;  5PAD A;  5CVO B;  2BU3 A;  2B1N A;  4QBB A;  2OZ2 A;  4XUI A;  3PHW A;  2JQF R;  5EF4 A;  2F7D A;  3RNV A;  1YVB A;  1DEU A;  4P6E A;  1UKF A;  1ICF A;  2XU1 A;  3N3K A;  4YYQ A;  3C9E A;  2CB5 A;  3P5W A;  2DC7 A;  4ZTB A;  3MOR A;  3RVW A;  2BDL A;  1A6R A;  1BP4 A;  5EZS A;  1EF7 A;  4DMX A;  3PW3 A;  1XKG A;  2F1G A;  2R9M A;  4PP2 E;  4RKX A;  4FIP A;  2FRQ A;  1EWM A;  3W31 A;  3F5V A;  1NB3 A;  3MHH A;  2DCD A;  2JTC A;  2E01 A;  1YZB A;  3PHX A;  1STF E;  3ERV A;  1ZIV A;  2HWK A;  2PBH A;  4IUM A;  4RNA A;  3TMP A;  3PRP A;  4RF1 A;  2AGA A;  3F75 A;  2GHU A;  2E00 A;  4W5C A;  1PBH A;  1THE A;  4Q8H A;  1BQI A;  1X9Y A;  4W4U A;  1QDQ A;  2AIM A; 
#chains in the Genus database with same CATH homology
 3BPM A;  3KFQ A;  1NL6 A;  3I3T A;  3N4C A;  3KW9 A;  3OIS A;  1IWD A;  2G7Y A;  5CVN B;  2AS8 A;  3U8E A;  1POP A;  2E03 A;  3LFY A;  5J94 A;  1KHP A;  2G8J A;  3BCN A;  3IUT A;  3WXF A;  2BSZ A;  1U9Q X;  1AU4 A;  4GUZ A;  2GFO A;  1PE6 A;  1CB5 A;  2PRE A;  5JA7 A;  1E2T A;  4YYU A;  5F02 A;  2YJB A;  4BGF A;  2NQA A;  3IHP A;  4PP1 A;  3CH3 X;  2ARY A;  2R9F A;  1ME4 A;  3IV2 A;  3P5V A;  5JH3 A;  4Q8G A;  4X6J A;  1F2A A;  1K3B B;  1VSN A;  1F29 A;  1NPZ A;  3KWZ A;  1NLJ A;  1GMY A;  1O0E A;  1AYV A;  3S3Q A;  5A24 A;  1PPO A;  4WA6 A;  3AI8 A;  4YYW A;  2C0Y A;  1PPP A;  2HD5 A;  4N8W A;  1MDW A;  3DF0 A;  1VJV A;  3KSE A;  1CVZ A;  2YJ2 A;  4BS5 A;  4RY2 A;  1PPD A;  1AIM A;  2Y6E A;  1GLO A;  2AYN A;  3BOW A;  3HHI A;  4NV7 A;  4BS6 A;  1KHQ A;  3OF9 A;  4CDE B;  6PAD A;  3PNR A;  1U5I A;  3P5X A;  1TL9 A;  1F2B A;  3OVX A;  2HHN A;  2R9O A;  1CV8 A;  1MHW A;  4K7C A;  2AYO A;  3QSD A;  1CQD A;  5EGW A;  3H89 A;  1JQP A;  2FO5 A;  5CHT A;  1PIP A;  2DJF B;  1AU0 A;  3KWB X;  4HWY A;  3S3R A;  3LXS A;  4I05 A;  1QOL A;  2R6N A;  2YJ8 A;  1EWP A;  2XU5 A;  1HUC B;  2DCB A;  1MS6 A;  2P86 A;  2FQ9 A;  3PDF A;  4MZO A;  2FUD A;  3I06 A;  3BC3 A;  1DF0 A;  1GEC E;  2H7J A;  3B79 A;  1AU3 A;  1BY8 A;  4BSQ A;  1YK7 A;  2FYE A;  1U9V A;  2IBI A;  4X6I A;  5FPW A;  1CPJ A;  4QRX A;  1FH0 A;  3NHE A;  3KKU A;  3IEJ A;  1ITO A;  3WXG A;  1CS8 A;  2G6D A;  3QJ3 A;  1NB5 A;  7PCK A;  2B1M A;  4QH6 A;  1CJL A;  4OEM A;  4CDC B;  1CTE A;  4QRG A;  1QXP A;  1PCI A;  4PI3 A;  3TNX A;  3CBK A;  1CSB B;  1M6D A;  3K8U A;  1MEM A;  3H8B A;  4P6G A;  1SP4 B;  1YAL A;  2Y5B A;  4XR7 A;  1PAD A;  4BPV A;  3CH2 X;  4AXM A;  2P0R A;  3HD3 A;  4W5B A;  3BWK A;  3MHS A;  2JQG R;  1U9W A;  2R9C A;  4B55 A;  3HHA A;  3KX1 A;  1TLO A;  1Y4H A;  3H8C A;  4N4Z A;  4ZUX U;  1TU6 A;  3H6S A;  2VFB A;  2FT2 A;  2DCC A;  1AU2 A;  4FK5 A;  4N79 A;  1KFX L;  3WXE A;  4YYR A;  3MTN A;  2OP3 A;  2WBF X;  4YV8 A;  2AUX A;  1S4V A;  2G8E A;  5CVM A;  5CHV A;  2DC6 A;  2DC9 A;  2HH5 A;  1W5R A;  2YJ9 A;  1PXV A;  1Y08 A;  2DC8 A;  1KFU L;  2IPP B;  4QRV A;  2DZZ A;  2YJC A;  3N3G A;  2FTD A;  2ACT A;  2DZY A;  3O0U A;  1AYU A;  9PAP A;  1ATK A;  3QT4 A;  2XU4 A;  1YK8 A;  1QMY A;  3OF8 A;  2BDZ A;  2P7U A;  3D9W A;  4I04 A;  3K9M A;  2AVW A;  3BPF A;  4OEL A;  3HWN A;  2FRA A;  2AUZ A;  3IOQ A;  2R9N A;  4MZS A;  3K24 A;  8PCH A;  3RVV A;  2NQD B;  2O6X A;  1MIR A;  3P5U A;  2NQG A;  4G54 A;  3O1G A;  3V6C A;  1U9X A;  3PBH A;  2VHS A;  2ATO A;  1NQC A;  3RVX A;  3ZUA A;  3M99 A;  4CDD B;  1YT7 A;  2PAD A;  2HXZ A;  5K16 A;  4BQV A;  4CZW A;  4YYS A;  4AXL A;  4FJC A;  4CDF B;  4I07 A;  4PAD A;  2E02 A;  4MSX A;  4C5P A;  1GX3 A;  4DMY A;  1AYW A;  1F2C A;  4YYV A;  1SNK A;  1W6F A;  1MEG A;  2NQI A;  2DJG B;  3IMA A;  2VHF A;  2CIO A;  4YVA A;  1ZCM A;  1PPN A;  1GCB A;  3USV A;  1AEC A;  2XU3 A;  3GCB A;  1BGO A;  3H7D A;  1EWL A;  1Q6K A;  3V6E A;  3CBJ A;  3OVZ A;  2PNS A;  1W4T A;  2AU1 A;  1EWO A;  4KLB A;  3D6S A;  2OUL A;  1KXR A;  4X6H A;  1ME3 A;  2DCA A;  3E1Z B;  5PAD A;  5CVO B;  2B1N A;  4QBB A;  2OZ2 A;  4XUI A;  2JQF R;  5EF4 A;  2F7D A;  1YVB A;  1DEU A;  4P6E A;  2XU1 A;  1ICF A;  3N3K A;  4YYQ A;  3C9E A;  2CB5 A;  3P5W A;  2DC7 A;  3MOR A;  3RVW A;  2BDL A;  1A6R A;  1BP4 A;  1EF7 A;  4DMX A;  4NV8 A;  3PW3 A;  1XKG A;  2F1G A;  2R9M A;  4PP2 E;  4FIP A;  2FRQ A;  1EWM A;  3F5V A;  1NB3 A;  3MHH A;  2DCD A;  2E01 A;  1STF E;  3ERV A;  1ZIV A;  2PBH A;  3F75 A;  2VFC A;  2GHU A;  2E00 A;  4W5C A;  1PBH A;  1THE A;  4Q8H A;  1BQI A;  1X9Y A;  4W4U A;  3LTW A;  1QDQ A;  2AIM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...