3HD3A

High resolution crystal structure of cruzain bound to the vinyl sulfone inhibitor smdc-256047
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
215
structure length
215
Chain Sequence
APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLAEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQLDHGVLLVGYNDGAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cruzipain
publication title Novel non-peptidic vinylsulfones targeting the S2 and S3 subsites of parasite cysteine proteases.
pubmed doi rcsb
source organism Trypanosoma cruzi
total genus 65
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature ec 3.4.22.51: Cruzipain.
pdb deposition date 2009-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3hd3A00
1SNKA 2CIOA 2E01A 2CB5A 4FIPA 1VSNA 2GHUA 2H7JA 5K16A 1U5IA 3PNRA 3NHEA 3MORA 1AYVA 3OF9A 2DC7A 3BOWA 5J94A 2Y5BA 2HD5A 1MS6A 4AXLA 1BQIA 1F2BA 4YV8A 2DCAA 4AXMA 3O1GA 1HUCB 1M6DA 3I3TA 2PREA 1ME3A 1CV8A 4Q8GA 1VJVA 1AU2A 1SP4B 4I04A 1BGOA 2C0YA 3CH3X 2JQGR 3CBKA 4X6IA 2XU3A 1ME4A 1U9WA 2R9NA 3B79A 3BPMA 1F2AA 3IEJA 1YVBA 1CS8A 1QOLA 3C9EA 3U8EA 4PI3A 1QMYA 2YJ8A 1MEGA 4G54A 2AS8A 1AYUA 1GCBA 3N4CA 2P0RA 1CVZA 2OULA 3QSDA 1ATKA 7PCKA 4ZUXU 4P6GA 4YVAA 2YJCA 1ICFA 1PPDA 3AI8A 3E1ZB 2R9CA 3WXFA 1NPZA 2R9MA 3PDFA 1TL9A 4K7CA 4FK5A 4MZOA 1KFXL 1IWDA 4HWYA 3IOQA 1CTEA 3TNXA 2AYOA 1CSBB 3H8BA 2FUDA 2DCCA 3KWBX 4BQVA 2R6NA 1KFUL 5CHTA 4I05A 1YT7A 1QXPA 5CVNB 1PBHA 2G7YA 3V6EA 2FT2A 2OZ2A 1PCIA 1FH0A 2E03A 1K3BB 2AUXA 3V6CA 4W4UA 4YYSA 4W5CA 2FO5A 5EF4A 4MZSA 3RVWA 1THEA 2AYNA 4QRGA 1MIRA 3S3QA 2ARYA 3BWKA 2DC6A 1STFE 2PNSA 1ITOA 2YJ9A 4KLBA 2BDZA 1KHQA 1AECA 2AVWA 4YYVA 4BSQA 2IBIA 4W5BA 4CDDB 3N3GA 3KSEA 3I06A 4CDEB 3K9MA 2R9OA 3PBHA 1PADA 3ERVA 2G8JA 8PCHA 1KXRA 1YK7A 1AIMA 2F7DA 4FJCA 2YJ2A 1A6RA 1MDWA 4X6JA 2DC8A 2VHFA 2IPPB 3KX1A 1POPA 1PE6A 4BS6A 3H89A 2G6DA 3H8CA 4N8WA 2PBHA 2Y6EA 2DCBA 3H6SA 3IHPA 1Y08A 3QJ3A 1PPPA 2FYEA 9PAPA 2R9FA 1QDQA 2NQDB 4OELA 3P5WA 4OEMA 5JH3A 3HHIA 2BDLA 3KKUA 4QRVA 1NB3A 1PXVA 4QBBA 1CQDA 1CPJA 1NL6A 3M99A 4YYRA 1MHWA 2AUZA 2P7UA 3S3RA 3USVA 3LFYA 2XU4A 1YALA 3HWNA 2HXZA 2HH5A 2B1MA 1BP4A 1AU4A 1Y4HA 2DJGB 3IMAA 1F29A 2DZYA 3RVXA 4CDCB 3CBJA 3MHSA 3GCBA 3HHAA 1GLOA 3RVVA 5JA7A 3IV2A 1EWMA 1CJLA 2ATOA 3MHHA 3O0UA 5EGWA 3HD3A 3KWZA 2NQGA 2E00A 1AU3A 4DMYA 5CVOB 2OP3A 4BS5A 3QT4A 1ZCMA 3P5UA 3F75A 1PPNA 2P86A 3N3KA 2O6XA 2DZZA 4BPVA 5FPWA 3K24A 2DCDA 3PW3A 1KHPA 1XKGA 2FRAA 4CZWA 2FTDA 2E02A 3BCNA 1BY8A 1S4VA 2AIMA 1U9QX 3KFQA 1PIPA 1NQCA 2XU5A 2NQAA 3OF8A 4WA6A 2XU1A 4MSXA 3IUTA 2WBFX 1EWPA 4CDFB 1DF0A 3MTNA 3K8UA 1PPOA 3OVZA 2FQ9A 5CHVA 3P5XA 1AYWA 1TLOA 4PP2E 4YYUA 2HHNA 5A24A 1GECE 1JQPA 1ZIVA 4XUIA 3LXSA 1AU0A 3BPFA 4I07A 6PADA 5PADA 4N4ZA 1CB5A 1U9XA 3H7DA 2PADA 3ZUAA 1X9YA 2AU1A 1MEMA 4N79A 4P6EA 5CVMA 1EWLA 2NQIA 3WXEA 2B1NA 2YJBA 2F1GA 3D6SA 4PADA 3F5VA 1U9VA 3CH2X 4QH6A 2GFOA 1EF7A 1EWOA 1O0EA 2G8EA 3P5VA 2FRQA 1F2CA 4RY2A 2ACTA 4PP1A 3BC3A 4YYWA 1Q6KA 4XR7A 5F02A 4DMXA 3KW9A 1NLJA 2DC9A 4QRXA 1GMYA 1NB5A 2VHSA 3OISA 1DEUA 3WXGA 2DJFB 1TU6A 3DF0A 3OVXA 2JQFR 4X6HA 1YK8A 4YYQA 4Q8HA
chains in the Genus database with same CATH superfamily
1SNKA 2CIOA 2E01A 2CB5A 4FIPA 1VSNA 2GHUA 2H7JA 5K16A 1U5IA 3PNRA 3NHEA 3MORA 1AYVA 4BOPA 3OF9A 2DC7A 3BOWA 5J94A 2Y5BA 3TRKA 2HD5A 1MS6A 4AXLA 1BQIA 1F2BA 4YV8A 2DCAA 4AXMA 3O1GA 1HUCB 1M6DA 3I3TA 3PRMA 2PREA 1ME3A 3MP2A 1CV8A 4Q8GA 1VJVA 1AU2A 1SP4B 4I04A 1BGOA 2C0YA 3BY4A 3CH3X 2JQGR 3CBKA 4X6IA 2XU3A 2DOSA 1ME4A 1U9WA 2R9NA 3B79A 3BPMA 4HXDB 1F2AA 3IEJA 1YVBA 1CS8A 1QOLA 3C9EA 3U8EA 4PI3A 3PRPA 1QMYA 2YJ8A 1UKFA 1MEGA 4G54A 2AS8A 1AYUA 1GCBA 3N4CA 2P0RA 1CVZA 2OULA 3QSDA 1ATKA 4RNAA 7PCKA 4ZUXU 4P6GA 4YVAA 2YJCA 1ICFA 1PPDA 1YZBA 3AI8A 3E1ZB 3PSEA 2R9CA 3WXFA 1NPZA 2R9MA 4XZXA 3PDFA 1TL9A 4K7CA 4BOZA 4FK5A 4MZOA 1KFXL 1IWDA 4HWYA 3IOQA 1CTEA 3TNXA 2AYOA 1CSBB 3H8BA 2FUDA 2DCCA 3KWBX 4BQVA 2R6NA 1KFUL 5CHTA 4I05A 3PHWA 1YT7A 1QXPA 3E9SA 3O65A 5CVNB 1PBHA 2G7YA 5EZQA 3V6EA 2FT2A 2OZ2A 1PCIA 1FH0A 2E03A 1K3BB 2AUXA 3V6CA 4W4UA 4YYSA 4W5CA 2FO5A 4RF1A 5EF4A 4MZSA 4BOUA 3RVWA 1THEA 2AYNA 3OQCA 2JTCA 4QRGA 1MIRA 3S3QA 2ARYA 3BWKA 2DC6A 1STFE 2PNSA 1ITOA 2UZJA 2YJ9A 4KLBA 2BDZA 1KHQA 1AECA 2AVWA 4YYVA 3PHUA 4BSQA 2IBIA 4W5BA 4CDDB 3N3GA 3KSEA 3I06A 4CDEB 3K9MA 4PT5A 2R9OA 3PBHA 1PADA 1PVJA 3ERVA 2G8JA 8PCHA 1KXRA 1YK7A 1AIMA 4D8BA 2F7DA 4M0WA 4FJCA 2YJ2A 3ZNHA 1A6RA 1MDWA 4X6JA 2DC8A 3BB7A 4OVZA 2VHFA 3W30A 2IPPB 3KX1A 1POPA 1PE6A 4BS6A 3H89A 2G6DA 3H8CA 4N8WA 2PBHA 4IUMA 2Y6EA 3TMPA 2DCBA 2Z84A 3H6SA 3C0RA 3MTVA 3IHPA 1Y08A 3QJ3A 1PPPA 2FYEA 9PAPA 2J7QA 2R9FA 1QDQA 2NQDB 4OELA 2BTWB 3P5WA 4OEMA 5JH3A 3HHIA 2BDLA 2BTWA 4R3DA 4BOQA 3KKUA 4QRVA 1NB3A 1PXVA 4QBBA 1CQDA 1CPJA 1NL6A 3M99A 4YYRA 1MHWA 2AUZA 2P7UA 3S3RA 3USVA 3LFYA 2XU4A 1YALA 3HWNA 2HXZA 2HH5A 2B1MA 4RF0A 1BP4A 1AU4A 1Y4HA 2DJGB 4REZA 3IMAA 1F29A 2DZYA 3RVXA 4CDCB 3CBJA 3W31A 3MHSA 3GCBA 3HHAA 1GLOA 3RVVA 3PHXA 5JA7A 3IV2A 1EWMA 1CJLA 2ATOA 3MHHA 3O0UA 5EGWA 3BBAA 3HD3A 3IFUA 3KWZA 1DKIA 2NQGA 2E00A 1AU3A 4DMYA 2AGAA 5CVOB 2OP3A 2FE8A 4BS5A 5KO3A 3QT4A 1ZCMA 4WURA 3P5UA 3F75A 1PPNA 2P86A 4D8EA 3PT2A 3N3KA 2O6XA 2DZZA 4BPVA 5FPWA 3K24A 2DCDA 3PW3A 1KHPA 1XKGA 4RKXA 2FRAA 4CZWA 2FTDA 2E02A 3BCNA 1BY8A 1S4VA 2AIMA 4OVZB 1U9QX 2BU3A 2HWKA 3KFQA 1PIPA 1NQCA 2XU5A 2NQAA 3OF8A 4WA6A 2XU1A 4MSXA 3IUTA 2WBFX 1EWPA 2J7QC 4CDFB 1DF0A 3MTNA 3K8UA 1PPOA 3OVZA 2FQ9A 5CHVA 3P5XA 1AYWA 4MM3B 1TLOA 4PP2E 4YYUA 4P16A 2HHNA 5A24A 1GECE 1JQPA 1ZIVA 4XUIA 3LXSA 1AU0A 3BPFA 4I07A 6PADA 3RNVA 5PADA 4N4ZA 1CB5A 1U9XA 3H7DA 2PADA 3ZUAA 1X9YA 2AU1A 1MEMA 4N79A 4P6EA 5CVMA 4OW0A 1EWLA 2NQIA 3WXEA 2B1NA 2YJBA 2F1GA 3D6SA 4PADA 3F5VA 4ZTBA 1U9VA 4GUAA 3CH2X 4QH6A 2GFOA 1EF7A 4A5UA 1EWOA 4D8IA 1O0EA 3MJ5A 5JZEA 2G8EA 3P5VA 2FRQA 1F2CA 4RY2A 2ACTA 4PP1A 3BC3A 4YYWA 1Q6KA 2JRIA 3B21A 4XR7A 5F02A 4BOSA 4IP3A 4DMXA 3KW9A 5EZSA 1NLJA 2DC9A 4QRXA 1GMYA 1NB5A 2VHSA 3OISA 1DEUA 3WXGA 2DJFB 1TU6A 3DF0A 5E6JA 3OVXA 4MI7A 2JQFR 4X6HA 1YK8A 4YYQA 4Q8HA
chains in the Genus database with same CATH topology
1SNKA 2CIOA 2E01A 2CB5A 4FIPA 1VSNA 2GHUA 2H7JA 3D9WA 5K16A 1U5IA 3PNRA 3NHEA 3MORA 1AYVA 3OF9A 2DC7A 3BOWA 5J94A 2Y5BA 2HD5A 1MS6A 4AXLA 4NV8A 1BQIA 1F2BA 4YV8A 2DCAA 4AXMA 3O1GA 1HUCB 1M6DA 3I3TA 2PREA 1ME3A 1CV8A 4Q8GA 1VJVA 1AU2A 1SP4B 4I04A 1BGOA 2C0YA 3CH3X 2JQGR 3CBKA 4X6IA 2XU3A 1ME4A 1U9WA 2R9NA 3B79A 3BPMA 1F2AA 3IEJA 1YVBA 1CS8A 1QOLA 3C9EA 3U8EA 4PI3A 1QMYA 2YJ8A 1MEGA 4G54A 2AS8A 1AYUA 1GCBA 3N4CA 2P0RA 1CVZA 2OULA 3QSDA 1ATKA 7PCKA 4ZUXU 4P6GA 4YVAA 2YJCA 4Q8HA 1ICFA 1PPDA 3AI8A 3E1ZB 2R9CA 3WXFA 1NPZA 2R9MA 3PDFA 1TL9A 4K7CA 1W4TA 4FK5A 4MZOA 1KFXL 1IWDA 4HWYA 3IOQA 1CTEA 3TNXA 2AYOA 1CSBB 3H8BA 2FUDA 2DCCA 3KWBX 4BQVA 2R6NA 1KFUL 5CHTA 4I05A 1YT7A 1QXPA 5CVNB 1PBHA 2G7YA 3V6EA 2FT2A 2OZ2A 1PCIA 1FH0A 2E03A 1K3BB 2AUXA 2VFBA 3V6CA 4W4UA 4YYSA 4W5CA 2FO5A 5EF4A 4MZSA 3RVWA 1THEA 2AYNA 4QRGA 1MIRA 3S3QA 2ARYA 3BWKA 2DC6A 1STFE 2PNSA 1ITOA 2YJ9A 4KLBA 2BDZA 1KHQA 1AECA 2AVWA 4YYVA 4BSQA 2IBIA 4W5BA 4CDDB 3N3GA 3KSEA 2BSZA 3I06A 4CDEB 3K9MA 2R9OA 4B55A 3PBHA 1PADA 3ERVA 2G8JA 8PCHA 1KXRA 1YK7A 1AIMA 4BGFA 2F7DA 4FJCA 4GUZA 2YJ2A 1A6RA 1MDWA 4X6JA 2DC8A 2VHFA 2IPPB 3KX1A 1POPA 1PE6A 4BS6A 3H89A 2G6DA 3H8CA 4N8WA 2PBHA 2Y6EA 2DCBA 3LTWA 3H6SA 3IHPA 1Y08A 3QJ3A 1PPPA 2FYEA 9PAPA 4NV7A 2R9FA 1QDQA 2NQDB 4OELA 3P5WA 4OEMA 5JH3A 3HHIA 2BDLA 3KKUA 4QRVA 1NB3A 1PXVA 4QBBA 1CQDA 1CPJA 1NL6A 3M99A 4YYRA 1MHWA 2AUZA 2P7UA 3S3RA 3USVA 3LFYA 2XU4A 1YALA 3HWNA 2HXZA 2HH5A 2B1MA 1BP4A 1AU4A 1Y4HA 2DJGB 3IMAA 1F29A 2DZYA 3RVXA 4CDCB 3CBJA 3MHSA 3GCBA 3HHAA 1GLOA 3RVVA 5JA7A 3IV2A 1EWMA 1CJLA 2ATOA 3MHHA 3O0UA 5EGWA 3HD3A 3KWZA 2NQGA 2E00A 1AU3A 4DMYA 5CVOB 2OP3A 4BS5A 3QT4A 1ZCMA 3P5UA 3F75A 1PPNA 2P86A 3N3KA 2O6XA 2DZZA 4BPVA 5FPWA 1GX3A 3K24A 2DCDA 3PW3A 1KHPA 1XKGA 2FRAA 4CZWA 2FTDA 2E02A 3BCNA 1BY8A 1S4VA 2AIMA 2VFCA 1U9QX 3KFQA 1PIPA 1NQCA 2XU5A 2NQAA 3OF8A 4WA6A 2XU1A 4MSXA 3IUTA 2WBFX 1EWPA 4CDFB 1DF0A 3MTNA 3K8UA 1PPOA 3OVZA 2FQ9A 5CHVA 3P5XA 1AYWA 1TLOA 4PP2E 4YYUA 1W6FA 2HHNA 5A24A 1GECE 1W5RA 1JQPA 1ZIVA 4XUIA 3LXSA 1AU0A 3BPFA 4I07A 6PADA 5PADA 4N4ZA 1CB5A 1U9XA 3H7DA 2PADA 3ZUAA 1X9YA 2AU1A 1MEMA 4N79A 4P6EA 5CVMA 1EWLA 2NQIA 3WXEA 2B1NA 2YJBA 2F1GA 3D6SA 4PADA 3F5VA 1U9VA 3CH2X 4QH6A 2GFOA 1EF7A 1EWOA 1E2TA 1O0EA 2G8EA 3P5VA 2FRQA 1F2CA 4RY2A 2ACTA 4PP1A 3BC3A 4YYWA 1Q6KA 4XR7A 5F02A 4DMXA 3KW9A 1NLJA 2DC9A 4QRXA 1GMYA 1NB5A 2VHSA 3OISA 1DEUA 3WXGA 2DJFB 1TU6A 3DF0A 3OVXA 2JQFR 4X6HA 1YK8A 4YYQA 4C5PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SNK A;  2CIO A;  2E01 A;  2CB5 A;  4FIP A;  1VSN A;  2GHU A;  2H7J A;  5K16 A;  1U5I A;  3PNR A;  3NHE A;  3MOR A;  1AYV A;  3OF9 A;  2DC7 A;  3BOW A;  5J94 A;  2Y5B A;  2HD5 A;  1MS6 A;  4AXL A;  1BQI A;  1F2B A;  4YV8 A;  2DCA A;  4AXM A;  3O1G A;  1HUC B;  1M6D A;  3I3T A;  2PRE A;  1ME3 A;  1CV8 A;  4Q8G A;  1VJV A;  1AU2 A;  1SP4 B;  4I04 A;  1BGO A;  2C0Y A;  3CH3 X;  2JQG R;  3CBK A;  4X6I A;  2XU3 A;  1ME4 A;  1U9W A;  2R9N A;  3B79 A;  3BPM A;  1F2A A;  3IEJ A;  1YVB A;  1CS8 A;  1QOL A;  3C9E A;  3U8E A;  4PI3 A;  1QMY A;  2YJ8 A;  1MEG A;  4G54 A;  2AS8 A;  1AYU A;  1GCB A;  3N4C A;  2P0R A;  1CVZ A;  2OUL A;  3QSD A;  1ATK A;  7PCK A;  4ZUX U;  4P6G A;  4YVA A;  2YJC A;  1ICF A;  1PPD A;  3AI8 A;  3E1Z B;  2R9C A;  3WXF A;  1NPZ A;  2R9M A;  3PDF A;  1TL9 A;  4K7C A;  4FK5 A;  4MZO A;  1KFX L;  1IWD A;  4HWY A;  3IOQ A;  1CTE A;  3TNX A;  2AYO A;  1CSB B;  3H8B A;  2FUD A;  2DCC A;  3KWB X;  4BQV A;  2R6N A;  1KFU L;  5CHT A;  4I05 A;  1YT7 A;  1QXP A;  5CVN B;  1PBH A;  2G7Y A;  3V6E A;  2FT2 A;  2OZ2 A;  1PCI A;  1FH0 A;  2E03 A;  1K3B B;  2AUX A;  3V6C A;  4W4U A;  4YYS A;  4W5C A;  2FO5 A;  5EF4 A;  4MZS A;  3RVW A;  1THE A;  2AYN A;  4QRG A;  1MIR A;  3S3Q A;  2ARY A;  3BWK A;  2DC6 A;  1STF E;  2PNS A;  1ITO A;  2YJ9 A;  4KLB A;  2BDZ A;  1KHQ A;  1AEC A;  2AVW A;  4YYV A;  4BSQ A;  2IBI A;  4W5B A;  4CDD B;  3N3G A;  3KSE A;  3I06 A;  4CDE B;  3K9M A;  2R9O A;  3PBH A;  1PAD A;  3ERV A;  2G8J A;  8PCH A;  1KXR A;  1YK7 A;  1AIM A;  2F7D A;  4FJC A;  2YJ2 A;  1A6R A;  1MDW A;  4X6J A;  2DC8 A;  2VHF A;  2IPP B;  3KX1 A;  1POP A;  1PE6 A;  4BS6 A;  3H89 A;  2G6D A;  3H8C A;  4N8W A;  2PBH A;  2Y6E A;  2DCB A;  3H6S A;  3IHP A;  1Y08 A;  3QJ3 A;  1PPP A;  2FYE A;  9PAP A;  2R9F A;  1QDQ A;  2NQD B;  4OEL A;  3P5W A;  4OEM A;  5JH3 A;  3HHI A;  2BDL A;  3KKU A;  4QRV A;  1NB3 A;  1PXV A;  4QBB A;  1CQD A;  1CPJ A;  1NL6 A;  3M99 A;  4YYR A;  1MHW A;  2AUZ A;  2P7U A;  3S3R A;  3USV A;  3LFY A;  2XU4 A;  1YAL A;  3HWN A;  2HXZ A;  2HH5 A;  2B1M A;  1BP4 A;  1AU4 A;  1Y4H A;  2DJG B;  3IMA A;  1F29 A;  2DZY A;  3RVX A;  4CDC B;  3CBJ A;  3MHS A;  3GCB A;  3HHA A;  1GLO A;  3RVV A;  5JA7 A;  3IV2 A;  1EWM A;  1CJL A;  2ATO A;  3MHH A;  3O0U A;  5EGW A;  3HD3 A;  3KWZ A;  2NQG A;  2E00 A;  1AU3 A;  4DMY A;  5CVO B;  2OP3 A;  4BS5 A;  3QT4 A;  1ZCM A;  3P5U A;  3F75 A;  1PPN A;  2P86 A;  3N3K A;  2O6X A;  2DZZ A;  4BPV A;  5FPW A;  3K24 A;  2DCD A;  3PW3 A;  1KHP A;  1XKG A;  2FRA A;  4CZW A;  2FTD A;  2E02 A;  3BCN A;  1BY8 A;  1S4V A;  2AIM A;  1U9Q X;  3KFQ A;  1PIP A;  1NQC A;  2XU5 A;  2NQA A;  3OF8 A;  4WA6 A;  2XU1 A;  4MSX A;  3IUT A;  2WBF X;  1EWP A;  4CDF B;  1DF0 A;  3MTN A;  3K8U A;  1PPO A;  3OVZ A;  2FQ9 A;  5CHV A;  3P5X A;  1AYW A;  1TLO A;  4PP2 E;  4YYU A;  2HHN A;  5A24 A;  1GEC E;  1JQP A;  1ZIV A;  4XUI A;  3LXS A;  1AU0 A;  3BPF A;  4I07 A;  6PAD A;  5PAD A;  4N4Z A;  1CB5 A;  1U9X A;  3H7D A;  2PAD A;  3ZUA A;  1X9Y A;  2AU1 A;  1MEM A;  4N79 A;  4P6E A;  5CVM A;  1EWL A;  2NQI A;  3WXE A;  2B1N A;  2YJB A;  2F1G A;  3D6S A;  4PAD A;  3F5V A;  1U9V A;  3CH2 X;  4QH6 A;  2GFO A;  1EF7 A;  1EWO A;  1O0E A;  2G8E A;  3P5V A;  2FRQ A;  1F2C A;  4RY2 A;  2ACT A;  4PP1 A;  3BC3 A;  4YYW A;  1Q6K A;  4XR7 A;  5F02 A;  4DMX A;  3KW9 A;  1NLJ A;  2DC9 A;  4QRX A;  1GMY A;  1NB5 A;  2VHS A;  3OIS A;  1DEU A;  3WXG A;  2DJF B;  1TU6 A;  3DF0 A;  3OVX A;  2JQF R;  4X6H A;  1YK8 A;  4YYQ A;  4Q8H A; 
#chains in the Genus database with same CATH topology
 1SNK A;  2CIO A;  2E01 A;  2CB5 A;  4FIP A;  1VSN A;  2GHU A;  2H7J A;  5K16 A;  1U5I A;  3PNR A;  3NHE A;  3MOR A;  1AYV A;  4BOP A;  3OF9 A;  2DC7 A;  3BOW A;  5J94 A;  2Y5B A;  3TRK A;  2HD5 A;  1MS6 A;  4AXL A;  1BQI A;  1F2B A;  4YV8 A;  2DCA A;  4AXM A;  3O1G A;  1HUC B;  1M6D A;  3I3T A;  3PRM A;  2PRE A;  1ME3 A;  3MP2 A;  1CV8 A;  4Q8G A;  1VJV A;  1AU2 A;  1SP4 B;  4I04 A;  1BGO A;  2C0Y A;  3BY4 A;  3CH3 X;  2JQG R;  3CBK A;  4X6I A;  2XU3 A;  2DOS A;  1ME4 A;  1U9W A;  2R9N A;  3B79 A;  3BPM A;  4HXD B;  1F2A A;  3IEJ A;  1YVB A;  1CS8 A;  1QOL A;  3C9E A;  3U8E A;  4PI3 A;  3PRP A;  1QMY A;  2YJ8 A;  1UKF A;  1MEG A;  4G54 A;  2AS8 A;  1AYU A;  1GCB A;  3N4C A;  2P0R A;  1CVZ A;  2OUL A;  3QSD A;  1ATK A;  4RNA A;  7PCK A;  4ZUX U;  4P6G A;  4YVA A;  2YJC A;  1ICF A;  1PPD A;  1YZB A;  3AI8 A;  3E1Z B;  3PSE A;  2R9C A;  3WXF A;  1NPZ A;  2R9M A;  4XZX A;  3PDF A;  1TL9 A;  4K7C A;  4BOZ A;  4FK5 A;  4MZO A;  1KFX L;  1IWD A;  4HWY A;  3IOQ A;  1CTE A;  3TNX A;  2AYO A;  1CSB B;  3H8B A;  2FUD A;  2DCC A;  3KWB X;  4BQV A;  2R6N A;  1KFU L;  5CHT A;  4I05 A;  3PHW A;  1YT7 A;  1QXP A;  3E9S A;  3O65 A;  5CVN B;  1PBH A;  2G7Y A;  5EZQ A;  3V6E A;  2FT2 A;  2OZ2 A;  1PCI A;  1FH0 A;  2E03 A;  1K3B B;  2AUX A;  3V6C A;  4W4U A;  4YYS A;  4W5C A;  2FO5 A;  4RF1 A;  5EF4 A;  4MZS A;  4BOU A;  3RVW A;  1THE A;  2AYN A;  3OQC A;  2JTC A;  4QRG A;  1MIR A;  3S3Q A;  2ARY A;  3BWK A;  2DC6 A;  1STF E;  2PNS A;  1ITO A;  2UZJ A;  2YJ9 A;  4KLB A;  2BDZ A;  1KHQ A;  1AEC A;  2AVW A;  4YYV A;  3PHU A;  4BSQ A;  2IBI A;  4W5B A;  4CDD B;  3N3G A;  3KSE A;  3I06 A;  4CDE B;  3K9M A;  4PT5 A;  2R9O A;  3PBH A;  1PAD A;  1PVJ A;  3ERV A;  2G8J A;  8PCH A;  1KXR A;  1YK7 A;  1AIM A;  4D8B A;  2F7D A;  4M0W A;  4FJC A;  2YJ2 A;  3ZNH A;  1A6R A;  1MDW A;  4X6J A;  2DC8 A;  3BB7 A;  4OVZ A;  2VHF A;  3W30 A;  2IPP B;  3KX1 A;  1POP A;  1PE6 A;  4BS6 A;  3H89 A;  2G6D A;  3H8C A;  4N8W A;  2PBH A;  4IUM A;  2Y6E A;  3TMP A;  2DCB A;  2Z84 A;  3H6S A;  3C0R A;  3MTV A;  3IHP A;  1Y08 A;  3QJ3 A;  1PPP A;  2FYE A;  9PAP A;  2J7Q A;  2R9F A;  1QDQ A;  2NQD B;  4OEL A;  2BTW B;  3P5W A;  4OEM A;  5JH3 A;  3HHI A;  2BDL A;  2BTW A;  4R3D A;  4BOQ A;  3KKU A;  4QRV A;  1NB3 A;  1PXV A;  4QBB A;  1CQD A;  1CPJ A;  1NL6 A;  3M99 A;  4YYR A;  1MHW A;  2AUZ A;  2P7U A;  3S3R A;  3USV A;  3LFY A;  2XU4 A;  1YAL A;  3HWN A;  2HXZ A;  2HH5 A;  2B1M A;  4RF0 A;  1BP4 A;  1AU4 A;  1Y4H A;  2DJG B;  4REZ A;  3IMA A;  1F29 A;  2DZY A;  3RVX A;  4CDC B;  3CBJ A;  3W31 A;  3MHS A;  3GCB A;  3HHA A;  1GLO A;  3RVV A;  3PHX A;  5JA7 A;  3IV2 A;  1EWM A;  1CJL A;  2ATO A;  3MHH A;  3O0U A;  5EGW A;  3BBA A;  3HD3 A;  3IFU A;  3KWZ A;  1DKI A;  2NQG A;  2E00 A;  1AU3 A;  4DMY A;  2AGA A;  5CVO B;  2OP3 A;  2FE8 A;  4BS5 A;  5KO3 A;  3QT4 A;  1ZCM A;  4WUR A;  3P5U A;  3F75 A;  1PPN A;  2P86 A;  4D8E A;  3PT2 A;  3N3K A;  2O6X A;  2DZZ A;  4BPV A;  5FPW A;  3K24 A;  2DCD A;  3PW3 A;  1KHP A;  1XKG A;  4RKX A;  2FRA A;  4CZW A;  2FTD A;  2E02 A;  3BCN A;  1BY8 A;  1S4V A;  2AIM A;  4OVZ B;  1U9Q X;  2BU3 A;  2HWK A;  3KFQ A;  1PIP A;  1NQC A;  2XU5 A;  2NQA A;  3OF8 A;  4WA6 A;  2XU1 A;  4MSX A;  3IUT A;  2WBF X;  1EWP A;  2J7Q C;  4CDF B;  1DF0 A;  3MTN A;  3K8U A;  1PPO A;  3OVZ A;  2FQ9 A;  5CHV A;  3P5X A;  1AYW A;  4MM3 B;  1TLO A;  4PP2 E;  4YYU A;  4P16 A;  2HHN A;  5A24 A;  1GEC E;  1JQP A;  1ZIV A;  4XUI A;  3LXS A;  1AU0 A;  3BPF A;  4I07 A;  6PAD A;  3RNV A;  5PAD A;  4N4Z A;  1CB5 A;  1U9X A;  3H7D A;  2PAD A;  3ZUA A;  1X9Y A;  2AU1 A;  1MEM A;  4N79 A;  4P6E A;  5CVM A;  4OW0 A;  1EWL A;  2NQI A;  3WXE A;  2B1N A;  2YJB A;  2F1G A;  3D6S A;  4PAD A;  3F5V A;  4ZTB A;  1U9V A;  4GUA A;  3CH2 X;  4QH6 A;  2GFO A;  1EF7 A;  4A5U A;  1EWO A;  4D8I A;  1O0E A;  3MJ5 A;  5JZE A;  2G8E A;  3P5V A;  2FRQ A;  1F2C A;  4RY2 A;  2ACT A;  4PP1 A;  3BC3 A;  4YYW A;  1Q6K A;  2JRI A;  3B21 A;  4XR7 A;  5F02 A;  4BOS A;  4IP3 A;  4DMX A;  3KW9 A;  5EZS A;  1NLJ A;  2DC9 A;  4QRX A;  1GMY A;  1NB5 A;  2VHS A;  3OIS A;  1DEU A;  3WXG A;  2DJF B;  1TU6 A;  3DF0 A;  5E6J A;  3OVX A;  4MI7 A;  2JQF R;  4X6H A;  1YK8 A;  4YYQ A;  4Q8H A; 
#chains in the Genus database with same CATH homology
 1SNK A;  2CIO A;  2E01 A;  2CB5 A;  4FIP A;  1VSN A;  2GHU A;  2H7J A;  3D9W A;  5K16 A;  1U5I A;  3PNR A;  3NHE A;  3MOR A;  1AYV A;  3OF9 A;  2DC7 A;  3BOW A;  5J94 A;  2Y5B A;  2HD5 A;  1MS6 A;  4AXL A;  4NV8 A;  1BQI A;  1F2B A;  4YV8 A;  2DCA A;  4AXM A;  3O1G A;  1HUC B;  1M6D A;  3I3T A;  2PRE A;  1ME3 A;  1CV8 A;  4Q8G A;  1VJV A;  1AU2 A;  1SP4 B;  4I04 A;  1BGO A;  2C0Y A;  3CH3 X;  2JQG R;  3CBK A;  4X6I A;  2XU3 A;  1ME4 A;  1U9W A;  2R9N A;  3B79 A;  3BPM A;  1F2A A;  3IEJ A;  1YVB A;  1CS8 A;  1QOL A;  3C9E A;  3U8E A;  4PI3 A;  1QMY A;  2YJ8 A;  1MEG A;  4G54 A;  2AS8 A;  1AYU A;  1GCB A;  3N4C A;  2P0R A;  1CVZ A;  2OUL A;  3QSD A;  1ATK A;  7PCK A;  4ZUX U;  4P6G A;  4YVA A;  2YJC A;  4Q8H A;  1ICF A;  1PPD A;  3AI8 A;  3E1Z B;  2R9C A;  3WXF A;  1NPZ A;  2R9M A;  3PDF A;  1TL9 A;  4K7C A;  1W4T A;  4FK5 A;  4MZO A;  1KFX L;  1IWD A;  4HWY A;  3IOQ A;  1CTE A;  3TNX A;  2AYO A;  1CSB B;  3H8B A;  2FUD A;  2DCC A;  3KWB X;  4BQV A;  2R6N A;  1KFU L;  5CHT A;  4I05 A;  1YT7 A;  1QXP A;  5CVN B;  1PBH A;  2G7Y A;  3V6E A;  2FT2 A;  2OZ2 A;  1PCI A;  1FH0 A;  2E03 A;  1K3B B;  2AUX A;  2VFB A;  3V6C A;  4W4U A;  4YYS A;  4W5C A;  2FO5 A;  5EF4 A;  4MZS A;  3RVW A;  1THE A;  2AYN A;  4QRG A;  1MIR A;  3S3Q A;  2ARY A;  3BWK A;  2DC6 A;  1STF E;  2PNS A;  1ITO A;  2YJ9 A;  4KLB A;  2BDZ A;  1KHQ A;  1AEC A;  2AVW A;  4YYV A;  4BSQ A;  2IBI A;  4W5B A;  4CDD B;  3N3G A;  3KSE A;  2BSZ A;  3I06 A;  4CDE B;  3K9M A;  2R9O A;  4B55 A;  3PBH A;  1PAD A;  3ERV A;  2G8J A;  8PCH A;  1KXR A;  1YK7 A;  1AIM A;  4BGF A;  2F7D A;  4FJC A;  4GUZ A;  2YJ2 A;  1A6R A;  1MDW A;  4X6J A;  2DC8 A;  2VHF A;  2IPP B;  3KX1 A;  1POP A;  1PE6 A;  4BS6 A;  3H89 A;  2G6D A;  3H8C A;  4N8W A;  2PBH A;  2Y6E A;  2DCB A;  3LTW A;  3H6S A;  3IHP A;  1Y08 A;  3QJ3 A;  1PPP A;  2FYE A;  9PAP A;  4NV7 A;  2R9F A;  1QDQ A;  2NQD B;  4OEL A;  3P5W A;  4OEM A;  5JH3 A;  3HHI A;  2BDL A;  3KKU A;  4QRV A;  1NB3 A;  1PXV A;  4QBB A;  1CQD A;  1CPJ A;  1NL6 A;  3M99 A;  4YYR A;  1MHW A;  2AUZ A;  2P7U A;  3S3R A;  3USV A;  3LFY A;  2XU4 A;  1YAL A;  3HWN A;  2HXZ A;  2HH5 A;  2B1M A;  1BP4 A;  1AU4 A;  1Y4H A;  2DJG B;  3IMA A;  1F29 A;  2DZY A;  3RVX A;  4CDC B;  3CBJ A;  3MHS A;  3GCB A;  3HHA A;  1GLO A;  3RVV A;  5JA7 A;  3IV2 A;  1EWM A;  1CJL A;  2ATO A;  3MHH A;  3O0U A;  5EGW A;  3HD3 A;  3KWZ A;  2NQG A;  2E00 A;  1AU3 A;  4DMY A;  5CVO B;  2OP3 A;  4BS5 A;  3QT4 A;  1ZCM A;  3P5U A;  3F75 A;  1PPN A;  2P86 A;  3N3K A;  2O6X A;  2DZZ A;  4BPV A;  5FPW A;  1GX3 A;  3K24 A;  2DCD A;  3PW3 A;  1KHP A;  1XKG A;  2FRA A;  4CZW A;  2FTD A;  2E02 A;  3BCN A;  1BY8 A;  1S4V A;  2AIM A;  2VFC A;  1U9Q X;  3KFQ A;  1PIP A;  1NQC A;  2XU5 A;  2NQA A;  3OF8 A;  4WA6 A;  2XU1 A;  4MSX A;  3IUT A;  2WBF X;  1EWP A;  4CDF B;  1DF0 A;  3MTN A;  3K8U A;  1PPO A;  3OVZ A;  2FQ9 A;  5CHV A;  3P5X A;  1AYW A;  1TLO A;  4PP2 E;  4YYU A;  1W6F A;  2HHN A;  5A24 A;  1GEC E;  1W5R A;  1JQP A;  1ZIV A;  4XUI A;  3LXS A;  1AU0 A;  3BPF A;  4I07 A;  6PAD A;  5PAD A;  4N4Z A;  1CB5 A;  1U9X A;  3H7D A;  2PAD A;  3ZUA A;  1X9Y A;  2AU1 A;  1MEM A;  4N79 A;  4P6E A;  5CVM A;  1EWL A;  2NQI A;  3WXE A;  2B1N A;  2YJB A;  2F1G A;  3D6S A;  4PAD A;  3F5V A;  1U9V A;  3CH2 X;  4QH6 A;  2GFO A;  1EF7 A;  1EWO A;  1E2T A;  1O0E A;  2G8E A;  3P5V A;  2FRQ A;  1F2C A;  4RY2 A;  2ACT A;  4PP1 A;  3BC3 A;  4YYW A;  1Q6K A;  4XR7 A;  5F02 A;  4DMX A;  3KW9 A;  1NLJ A;  2DC9 A;  4QRX A;  1GMY A;  1NB5 A;  2VHS A;  3OIS A;  1DEU A;  3WXG A;  2DJF B;  1TU6 A;  3DF0 A;  3OVX A;  2JQF R;  4X6H A;  1YK8 A;  4YYQ A;  4C5P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...