1CPJA

Crystal structures of recombinant rat cathepsin b and a cathepsin b-inhibitor complex: implications for structure-based inhibitor design
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
253
structure length
253
Chain Sequence
b'LPESFDAREQWSNCPTIAQIRDQGSCGSCWAFGAVEAMSDRICIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWNFWTRKGLVSGGVYNSHIGCLPYTIPPCEHHVNGARPPCTGEGDTPKCNKMCEAGYSTSYKEDKHYGYTSYSVSDSEKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDVMGGHAIRILGWGIENGVPYWLVANSWNADWGDNGFFKILRGENHCGIESEIVAGIPRT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATHEPSIN B
publication title Crystal structures of recombinant rat cathepsin B and a cathepsin B-inhibitor complex. Implications for structure-based inhibitor design.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 72
structure length 253
sequence length 253
chains with identical sequence B
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 1995-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1cpjA00
3KFQA 1NB3A 2GFOA 2G8EA 2YJ8A 3WXEA 2B1MA 2AU1A 3OF9A 4G54A 3BPMA 3KSEA 4X6HA 3K8UA 2R9OA 4CDEB 2AYOA 1FH0A 3P5UA 2GHUA 1PPNA 1CV8A 3KWBX 4W5CA 4BQVA 5CHVA 4YYRA 6PADA 2R9MA 1ATKA 2FT2A 1GLOA 3P5VA 1EWOA 4CZWA 1AU3A 3GCBA 3N4CA 3BC3A 1Y4HA 4FJCA 1BGOA 3D6SA 3KWZA 1THEA 3CH2X 1EF7A 1VJVA 2DC6A 1MIRA 3RVVA 2YJ9A 1QOLA 4W5BA 1ME4A 1YK7A 2G6DA 2DZYA 2BDLA 1CJLA 5JH3A 1AYUA 4HWYA 3RVXA 1O0EA 2DJFB 2E00A 2IPPB 2FRAA 3H7DA 1S4VA 4I04A 2R6NA 5FPWA 2Y5BA 1NL6A 1KFXL 2FTDA 1PPOA 3NHEA 3USVA 7PCKA 4CDFB 2FO5A 2R9CA 5K16A 1ICFA 2HD5A 4DMXA 1SP4B 1MS6A 3OVZA 1KHPA 1Y08A 1CTEA 4CDCB 3V6EA 1PXVA 1QDQA 1SNKA 4KLBA 1PIPA 1CSBB 4N79A 4YYQA 4RY2A 1F2CA 2H7JA 1POPA 1F2BA 2NQIA 1K3BB 4DMYA 3N3KA 1EWMA 5EF4A 3C9EA 1NQCA 1PE6A 1HUCB 2G7YA 2XU3A 2NQGA 4MZOA 5CVMA 3OVXA 3E1ZB 2FQ9A 4QH6A 1NLJA 2DC9A 1MHWA 3DF0A 1BQIA 2C0YA 2F1GA 3MTNA 2AYNA 1TU6A 3OISA 2B1NA 2DJGB 2AIMA 1EWPA 1U9WA 3V6CA 2HHNA 3IUTA 3P5XA 1AYVA 3MHHA 2E02A 3HHAA 3PNRA 4AXMA 2DCCA 1F2AA 3QJ3A 1AYWA 2E01A 4FK5A 2O6XA 3WXFA 2JQFR 1TLOA 2DCDA 3HD3A 2FUDA 4P6GA 3WXGA 4P6EA 3LFYA 3IOQA 1F29A 1M6DA 4XR7A 1YVBA 3S3QA 3BCNA 2OZ2A 1JQPA 1X9YA 1PCIA 5J94A 4PP1A 1PADA 2NQDB 4YVAA 1XKGA 2WBFX 2OP3A 4XUIA 1PPDA 1A6RA 1IWDA 2YJ2A 9PAPA 1AU2A 2P0RA 3KW9A 3KX1A 2VHFA 3F5VA 3K9MA 1CVZA 2XU4A 3CBKA 4Q8HA 4I05A 3KKUA 1EWLA 1KXRA 2DCAA 1MEGA 2HH5A 2R9NA 1CS8A 2AS8A 1CPJA 3F75A 3IV2A 1U9QX 4YV8A 4X6JA 2PREA 4ZUXU 3PBHA 5CVOB 2R9FA 4BPVA 2HXZA 1YK8A 1AU0A 4Q8GA 2PNSA 3K24A 3PDFA 3ERVA 3QT4A 4YYWA 1GECE 5F02A 1DEUA 3MORA 2BDZA 2VHSA 1NB5A 2DC8A 1CQDA 3N3GA 2DZZA 3RVWA 2FYEA 1QMYA 2PBHA 3I06A 4W4UA 1Q6KA 4MZSA 3TNXA 2P86A 2P7UA 4BS5A 4MSXA 5PADA 4N8WA 5CHTA 3IHPA 5A24A 4QBBA 4PP2E 8PCHA 1DF0A 2Y6EA 3QSDA 3O1GA 1MDWA 1KHQA 2DC7A 1GMYA 4BS6A 3S3RA 3H6SA 2ACTA 2OULA 1U9XA 2YJCA 3U8EA 1QXPA 4K7CA 1AECA 1PPPA 5EGWA 1ZCMA 2NQAA 3M99A 1MEMA 3AI8A 1TL9A 3H89A 2G8JA 1BP4A 1ME3A 2IBIA 3IEJA 2F7DA 2ARYA 2YJBA 3MHSA 3CBJA 1AIMA 2E03A 2DCBA 4QRVA 3CH3X 2CB5A 2JQGR 2AUXA 4PI3A 3H8CA 3OF8A 5JA7A 1CB5A 1STFE 2ATOA 1VSNA 1AU4A 2XU1A 2PADA 3H8BA 3O0UA 4FIPA 4BSQA 1U5IA 3HHIA 1U9VA 4QRXA 3I3TA 1GCBA 1KFUL 1YALA 4OEMA 1ZIVA 4N4ZA 2AUZA 2CIOA 1ITOA 4AXLA 3BWKA 3BPFA 4CDDB 3B79A 4YYVA 3LXSA 2AVWA 3HWNA 3PW3A 3P5WA 1YT7A 4YYUA 2FRQA 4QRGA 1PBHA 5CVNB 4PADA 1BY8A 3ZUAA 3BOWA 4X6IA 4WA6A 1NPZA 4OELA 2XU5A 4YYSA 4I07A 3IMAA
chains in the Genus database with same CATH superfamily
3KFQA 1NB3A 2GFOA 4BOSA 2G8EA 2YJ8A 3WXEA 2B1MA 4RKXA 2AU1A 3OF9A 4G54A 3TRKA 3BPMA 3KSEA 4X6HA 3K8UA 2R9OA 4CDEB 2AYOA 1FH0A 3P5UA 2GHUA 3OQCA 1PPNA 1CV8A 3KWBX 4W5CA 4BQVA 5CHVA 4YYRA 6PADA 2R9MA 1ATKA 2FT2A 3BB7A 1GLOA 3P5VA 1EWOA 4CZWA 1AU3A 3GCBA 3N4CA 3BC3A 1Y4HA 4FJCA 1BGOA 3D6SA 3PRPA 3KWZA 5JZEA 1THEA 3CH2X 1EF7A 1VJVA 2DC6A 1MIRA 3RVVA 4OVZB 2YJ9A 4D8BA 1QOLA 4W5BA 1ME4A 1YK7A 2G6DA 2DZYA 4WURA 2BDLA 1CJLA 5JH3A 1AYUA 5E6JA 4HWYA 3RVXA 1O0EA 2DJFB 4HXDB 2E00A 2IPPB 2FRAA 3H7DA 1S4VA 4I04A 2R6NA 5FPWA 2Y5BA 1NL6A 1KFXL 2DOSA 2FTDA 1PPOA 3NHEA 3USVA 7PCKA 4CDFB 2FO5A 2R9CA 5K16A 1ICFA 2HD5A 3E9SA 4DMXA 1SP4B 1MS6A 3OVZA 1KHPA 1Y08A 1CTEA 4CDCB 3V6EA 5EZSA 1PXVA 1QDQA 1SNKA 4KLBA 1PIPA 2HWKA 1CSBB 4N79A 4YYQA 4RY2A 4XZXA 4D8IA 1F2CA 3MJ5A 2H7JA 3BY4A 1POPA 1F2BA 3MP2A 4RNAA 2NQIA 1K3BB 1YZBA 4PT5A 4DMYA 3N3KA 1EWMA 5EF4A 3C9EA 4IUMA 1NQCA 1PE6A 1HUCB 3PHXA 2G7YA 2XU3A 2NQGA 4MZOA 5CVMA 3OVXA 3E1ZB 2FQ9A 4QH6A 1NLJA 2DC9A 1MHWA 3MTVA 3DF0A 1BQIA 2C0YA 4BOZA 2F1GA 3MTNA 2AYNA 1TU6A 3OISA 2B1NA 2DJGB 2AIMA 1EWPA 4ZTBA 2Z84A 1U9WA 3V6CA 3PHWA 2HHNA 3IUTA 3P5XA 1AYVA 3MHHA 2E02A 3HHAA 3PNRA 4M0WA 4AXMA 4GUAA 4OW0A 2DCCA 1F2AA 3QJ3A 1AYWA 4RF1A 2E01A 4FK5A 2O6XA 3WXFA 2JQFR 4BOUA 1TLOA 2DCDA 2J7QA 3HD3A 2FUDA 4P6GA 3WXGA 4P6EA 3LFYA 1DKIA 3IOQA 1F29A 1M6DA 4XR7A 1YVBA 2J7QC 3S3QA 3BCNA 2OZ2A 1JQPA 3PRMA 1X9YA 1PCIA 5J94A 4PP1A 1PADA 2NQDB 4YVAA 1XKGA 2WBFX 2OP3A 4XUIA 1PVJA 3IFUA 1PPDA 1A6RA 1IWDA 2FE8A 2BTWA 2YJ2A 9PAPA 1AU2A 2P0RA 3KW9A 3BBAA 3KX1A 2VHFA 3F5VA 3K9MA 1CVZA 3TMPA 2XU4A 3CBKA 4Q8HA 4I05A 3KKUA 1EWLA 4MI7A 1KXRA 2DCAA 1MEGA 2HH5A 2R9NA 1CS8A 2AS8A 1CPJA 3F75A 3IV2A 1U9QX 4YV8A 4X6JA 2PREA 4ZUXU 3PBHA 5CVOB 2R9FA 4BPVA 2HXZA 1YK8A 1AU0A 4Q8GA 2PNSA 3K24A 3PDFA 3ERVA 3QT4A 2BU3A 4MM3B 4YYWA 1GECE 2UZJA 5F02A 2JTCA 1DEUA 3MORA 2BDZA 2VHSA 1NB5A 2DC8A 1CQDA 3N3GA 2JRIA 1UKFA 2BTWB 2DZZA 3RVWA 2FYEA 1QMYA 2PBHA 3I06A 4W4UA 4RF0A 1Q6KA 4MZSA 3TNXA 4BOQA 2P86A 2P7UA 4BS5A 4MSXA 5PADA 4N8WA 5CHTA 3IHPA 5A24A 5KO3A 4QBBA 4PP2E 8PCHA 1DF0A 2Y6EA 3QSDA 3O1GA 1MDWA 1KHQA 2DC7A 3O65A 1GMYA 4BS6A 3S3RA 3H6SA 3PSEA 2ACTA 2OULA 1U9XA 4R3DA 2YJCA 2AGAA 4REZA 3U8EA 1QXPA 4K7CA 1AECA 1PPPA 5EGWA 1ZCMA 2NQAA 3M99A 3W31A 1MEMA 3AI8A 3PHUA 1TL9A 3H89A 2G8JA 1BP4A 1ME3A 2IBIA 3IEJA 2F7DA 2ARYA 2YJBA 3MHSA 3W30A 3C0RA 5EZQA 3CBJA 4D8EA 1AIMA 2E03A 2DCBA 4QRVA 3CH3X 3RNVA 2CB5A 2JQGR 2AUXA 4PI3A 3H8CA 3OF8A 5JA7A 1CB5A 1STFE 2ATOA 1VSNA 1AU4A 2XU1A 2PADA 3H8BA 3O0UA 4FIPA 4BSQA 1U5IA 4IP3A 3HHIA 1U9VA 4QRXA 3I3TA 1GCBA 1KFUL 1YALA 4OEMA 4P16A 4A5UA 1ZIVA 4N4ZA 2AUZA 2CIOA 1ITOA 4AXLA 3BWKA 3BPFA 4CDDB 3B79A 4YYVA 3LXSA 2AVWA 3HWNA 3ZNHA 3PW3A 3P5WA 1YT7A 4YYUA 2FRQA 4OVZA 4QRGA 1PBHA 5CVNB 3B21A 4PADA 1BY8A 3ZUAA 3BOWA 4X6IA 4WA6A 1NPZA 4OELA 2XU5A 4YYSA 3PT2A 4I07A 4BOPA 3IMAA
chains in the Genus database with same CATH topology
3KFQA 1NB3A 2GFOA 2VFCA 2G8EA 2YJ8A 3WXEA 2B1MA 2AU1A 3OF9A 4G54A 3BPMA 3KSEA 4X6HA 3K8UA 2R9OA 4CDEB 2AYOA 1FH0A 3P5UA 2GHUA 1PPNA 1CV8A 3KWBX 4W5CA 4BQVA 5CHVA 4YYRA 1W6FA 6PADA 2R9MA 1ATKA 2FT2A 1GLOA 3P5VA 1EWOA 4CZWA 1AU3A 3GCBA 3N4CA 3BC3A 3LTWA 1Y4HA 4FJCA 1BGOA 3D6SA 3KWZA 1THEA 3CH2X 1EF7A 1VJVA 2DC6A 1MIRA 3RVVA 2YJ9A 4BGFA 1QOLA 4W5BA 1ME4A 1YK7A 2G6DA 2DZYA 2BDLA 1CJLA 5JH3A 1AYUA 4HWYA 3RVXA 1O0EA 2DJFB 2E00A 2IPPB 2FRAA 3H7DA 4C5PA 1S4VA 4I04A 2R6NA 5FPWA 2Y5BA 1NL6A 1KFXL 2FTDA 1PPOA 3NHEA 3USVA 7PCKA 4NV8A 4CDFB 2FO5A 2R9CA 5K16A 1ICFA 2HD5A 4DMXA 1SP4B 1MS6A 3OVZA 1KHPA 1Y08A 1CTEA 4CDCB 3V6EA 1PXVA 1QDQA 1SNKA 4KLBA 1PIPA 1CSBB 4N79A 4YYQA 4RY2A 1F2CA 2H7JA 1POPA 1F2BA 2NQIA 1K3BB 4DMYA 3N3KA 1EWMA 5EF4A 3C9EA 1NQCA 1PE6A 1HUCB 2G7YA 2XU3A 2NQGA 4MZOA 5CVMA 4B55A 3OVXA 3E1ZB 2FQ9A 4QH6A 1NLJA 2DC9A 1MHWA 3DF0A 1BQIA 2C0YA 2F1GA 3MTNA 2AYNA 1TU6A 3OISA 2B1NA 2DJGB 2AIMA 1EWPA 3D9WA 1U9WA 3V6CA 2HHNA 3IUTA 3P5XA 1AYVA 3MHHA 2E02A 3HHAA 3PNRA 1W4TA 4AXMA 2DCCA 1F2AA 3QJ3A 1AYWA 2E01A 4FK5A 2O6XA 3WXFA 2JQFR 1TLOA 2DCDA 3HD3A 2FUDA 4P6GA 3WXGA 4P6EA 3LFYA 3IOQA 1F29A 1M6DA 4XR7A 1YVBA 2VFBA 3S3QA 3BCNA 2OZ2A 1JQPA 1X9YA 1PCIA 5J94A 4PP1A 1PADA 2NQDB 4YVAA 1XKGA 2WBFX 2OP3A 4XUIA 1E2TA 1PPDA 1A6RA 1IWDA 2YJ2A 9PAPA 1AU2A 2P0RA 3KW9A 3KX1A 2VHFA 3F5VA 3K9MA 1CVZA 2XU4A 3CBKA 4Q8HA 4I05A 3KKUA 1EWLA 1KXRA 2DCAA 1MEGA 2HH5A 2R9NA 4GUZA 1CS8A 2AS8A 1CPJA 3F75A 3IV2A 1U9QX 4YV8A 4X6JA 2PREA 2BSZA 4ZUXU 3PBHA 5CVOB 2R9FA 4BPVA 2HXZA 1YK8A 1AU0A 4Q8GA 2PNSA 3K24A 3PDFA 3ERVA 3QT4A 4NV7A 4YYWA 1GECE 5F02A 1DEUA 3MORA 2BDZA 2VHSA 1NB5A 2DC8A 1CQDA 3N3GA 2DZZA 3RVWA 2FYEA 1QMYA 2PBHA 3I06A 4W4UA 1Q6KA 4MZSA 3TNXA 2P86A 2P7UA 4BS5A 4MSXA 5PADA 4N8WA 5CHTA 3IHPA 5A24A 4QBBA 4PP2E 8PCHA 1DF0A 2Y6EA 3QSDA 3O1GA 1MDWA 1KHQA 2DC7A 1GMYA 4BS6A 3S3RA 3H6SA 1W5RA 2ACTA 2OULA 1U9XA 2YJCA 3U8EA 1QXPA 4K7CA 1AECA 1PPPA 5EGWA 1ZCMA 2NQAA 3M99A 1MEMA 3AI8A 1TL9A 3H89A 2G8JA 1BP4A 1ME3A 2IBIA 3IEJA 2F7DA 2ARYA 2YJBA 3MHSA 3CBJA 1AIMA 2E03A 2DCBA 4QRVA 3CH3X 2CB5A 2JQGR 2AUXA 4PI3A 3H8CA 3OF8A 5JA7A 1CB5A 1GX3A 1STFE 2ATOA 1VSNA 1AU4A 2XU1A 2PADA 3H8BA 3O0UA 4FIPA 4BSQA 1U5IA 3HHIA 1U9VA 4QRXA 3I3TA 1GCBA 1KFUL 1YALA 4OEMA 1ZIVA 4N4ZA 2AUZA 2CIOA 1ITOA 4AXLA 3BWKA 3BPFA 4CDDB 3B79A 4YYVA 3LXSA 2AVWA 3HWNA 3PW3A 3P5WA 1YT7A 4YYUA 2FRQA 4QRGA 1PBHA 5CVNB 4PADA 1BY8A 3ZUAA 3BOWA 4X6IA 4WA6A 1NPZA 4OELA 2XU5A 4YYSA 4I07A 3IMAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KFQ A;  1NB3 A;  2GFO A;  2G8E A;  2YJ8 A;  3WXE A;  2B1M A;  2AU1 A;  3OF9 A;  4G54 A;  3BPM A;  3KSE A;  4X6H A;  3K8U A;  2R9O A;  4CDE B;  2AYO A;  1FH0 A;  3P5U A;  2GHU A;  1PPN A;  1CV8 A;  3KWB X;  4W5C A;  4BQV A;  5CHV A;  4YYR A;  6PAD A;  2R9M A;  1ATK A;  2FT2 A;  1GLO A;  3P5V A;  1EWO A;  4CZW A;  1AU3 A;  3GCB A;  3N4C A;  3BC3 A;  1Y4H A;  4FJC A;  1BGO A;  3D6S A;  3KWZ A;  1THE A;  3CH2 X;  1EF7 A;  1VJV A;  2DC6 A;  1MIR A;  3RVV A;  2YJ9 A;  1QOL A;  4W5B A;  1ME4 A;  1YK7 A;  2G6D A;  2DZY A;  2BDL A;  1CJL A;  5JH3 A;  1AYU A;  4HWY A;  3RVX A;  1O0E A;  2DJF B;  2E00 A;  2IPP B;  2FRA A;  3H7D A;  1S4V A;  4I04 A;  2R6N A;  5FPW A;  2Y5B A;  1NL6 A;  1KFX L;  2FTD A;  1PPO A;  3NHE A;  3USV A;  7PCK A;  4CDF B;  2FO5 A;  2R9C A;  5K16 A;  1ICF A;  2HD5 A;  4DMX A;  1SP4 B;  1MS6 A;  3OVZ A;  1KHP A;  1Y08 A;  1CTE A;  4CDC B;  3V6E A;  1PXV A;  1QDQ A;  1SNK A;  4KLB A;  1PIP A;  1CSB B;  4N79 A;  4YYQ A;  4RY2 A;  1F2C A;  2H7J A;  1POP A;  1F2B A;  2NQI A;  1K3B B;  4DMY A;  3N3K A;  1EWM A;  5EF4 A;  3C9E A;  1NQC A;  1PE6 A;  1HUC B;  2G7Y A;  2XU3 A;  2NQG A;  4MZO A;  5CVM A;  3OVX A;  3E1Z B;  2FQ9 A;  4QH6 A;  1NLJ A;  2DC9 A;  1MHW A;  3DF0 A;  1BQI A;  2C0Y A;  2F1G A;  3MTN A;  2AYN A;  1TU6 A;  3OIS A;  2B1N A;  2DJG B;  2AIM A;  1EWP A;  1U9W A;  3V6C A;  2HHN A;  3IUT A;  3P5X A;  1AYV A;  3MHH A;  2E02 A;  3HHA A;  3PNR A;  4AXM A;  2DCC A;  1F2A A;  3QJ3 A;  1AYW A;  2E01 A;  4FK5 A;  2O6X A;  3WXF A;  2JQF R;  1TLO A;  2DCD A;  3HD3 A;  2FUD A;  4P6G A;  3WXG A;  4P6E A;  3LFY A;  3IOQ A;  1F29 A;  1M6D A;  4XR7 A;  1YVB A;  3S3Q A;  3BCN A;  2OZ2 A;  1JQP A;  1X9Y A;  1PCI A;  5J94 A;  4PP1 A;  1PAD A;  2NQD B;  4YVA A;  1XKG A;  2WBF X;  2OP3 A;  4XUI A;  1PPD A;  1A6R A;  1IWD A;  2YJ2 A;  9PAP A;  1AU2 A;  2P0R A;  3KW9 A;  3KX1 A;  2VHF A;  3F5V A;  3K9M A;  1CVZ A;  2XU4 A;  3CBK A;  4Q8H A;  4I05 A;  3KKU A;  1EWL A;  1KXR A;  2DCA A;  1MEG A;  2HH5 A;  2R9N A;  1CS8 A;  2AS8 A;  1CPJ A;  3F75 A;  3IV2 A;  1U9Q X;  4YV8 A;  4X6J A;  2PRE A;  4ZUX U;  3PBH A;  5CVO B;  2R9F A;  4BPV A;  2HXZ A;  1YK8 A;  1AU0 A;  4Q8G A;  2PNS A;  3K24 A;  3PDF A;  3ERV A;  3QT4 A;  4YYW A;  1GEC E;  5F02 A;  1DEU A;  3MOR A;  2BDZ A;  2VHS A;  1NB5 A;  2DC8 A;  1CQD A;  3N3G A;  2DZZ A;  3RVW A;  2FYE A;  1QMY A;  2PBH A;  3I06 A;  4W4U A;  1Q6K A;  4MZS A;  3TNX A;  2P86 A;  2P7U A;  4BS5 A;  4MSX A;  5PAD A;  4N8W A;  5CHT A;  3IHP A;  5A24 A;  4QBB A;  4PP2 E;  8PCH A;  1DF0 A;  2Y6E A;  3QSD A;  3O1G A;  1MDW A;  1KHQ A;  2DC7 A;  1GMY A;  4BS6 A;  3S3R A;  3H6S A;  2ACT A;  2OUL A;  1U9X A;  2YJC A;  3U8E A;  1QXP A;  4K7C A;  1AEC A;  1PPP A;  5EGW A;  1ZCM A;  2NQA A;  3M99 A;  1MEM A;  3AI8 A;  1TL9 A;  3H89 A;  2G8J A;  1BP4 A;  1ME3 A;  2IBI A;  3IEJ A;  2F7D A;  2ARY A;  2YJB A;  3MHS A;  3CBJ A;  1AIM A;  2E03 A;  2DCB A;  4QRV A;  3CH3 X;  2CB5 A;  2JQG R;  2AUX A;  4PI3 A;  3H8C A;  3OF8 A;  5JA7 A;  1CB5 A;  1STF E;  2ATO A;  1VSN A;  1AU4 A;  2XU1 A;  2PAD A;  3H8B A;  3O0U A;  4FIP A;  4BSQ A;  1U5I A;  3HHI A;  1U9V A;  4QRX A;  3I3T A;  1GCB A;  1KFU L;  1YAL A;  4OEM A;  1ZIV A;  4N4Z A;  2AUZ A;  2CIO A;  1ITO A;  4AXL A;  3BWK A;  3BPF A;  4CDD B;  3B79 A;  4YYV A;  3LXS A;  2AVW A;  3HWN A;  3PW3 A;  3P5W A;  1YT7 A;  4YYU A;  2FRQ A;  4QRG A;  1PBH A;  5CVN B;  4PAD A;  1BY8 A;  3ZUA A;  3BOW A;  4X6I A;  4WA6 A;  1NPZ A;  4OEL A;  2XU5 A;  4YYS A;  4I07 A;  3IMA A; 
#chains in the Genus database with same CATH topology
 3KFQ A;  1NB3 A;  2GFO A;  4BOS A;  2G8E A;  2YJ8 A;  3WXE A;  2B1M A;  4RKX A;  2AU1 A;  3OF9 A;  4G54 A;  3TRK A;  3BPM A;  3KSE A;  4X6H A;  3K8U A;  2R9O A;  4CDE B;  2AYO A;  1FH0 A;  3P5U A;  2GHU A;  3OQC A;  1PPN A;  1CV8 A;  3KWB X;  4W5C A;  4BQV A;  5CHV A;  4YYR A;  6PAD A;  2R9M A;  1ATK A;  2FT2 A;  3BB7 A;  1GLO A;  3P5V A;  1EWO A;  4CZW A;  1AU3 A;  3GCB A;  3N4C A;  3BC3 A;  1Y4H A;  4FJC A;  1BGO A;  3D6S A;  3PRP A;  3KWZ A;  5JZE A;  1THE A;  3CH2 X;  1EF7 A;  1VJV A;  2DC6 A;  1MIR A;  3RVV A;  4OVZ B;  2YJ9 A;  4D8B A;  1QOL A;  4W5B A;  1ME4 A;  1YK7 A;  2G6D A;  2DZY A;  4WUR A;  2BDL A;  1CJL A;  5JH3 A;  1AYU A;  5E6J A;  4HWY A;  3RVX A;  1O0E A;  2DJF B;  4HXD B;  2E00 A;  2IPP B;  2FRA A;  3H7D A;  1S4V A;  4I04 A;  2R6N A;  5FPW A;  2Y5B A;  1NL6 A;  1KFX L;  2DOS A;  2FTD A;  1PPO A;  3NHE A;  3USV A;  7PCK A;  4CDF B;  2FO5 A;  2R9C A;  5K16 A;  1ICF A;  2HD5 A;  3E9S A;  4DMX A;  1SP4 B;  1MS6 A;  3OVZ A;  1KHP A;  1Y08 A;  1CTE A;  4CDC B;  3V6E A;  5EZS A;  1PXV A;  1QDQ A;  1SNK A;  4KLB A;  1PIP A;  2HWK A;  1CSB B;  4N79 A;  4YYQ A;  4RY2 A;  4XZX A;  4D8I A;  1F2C A;  3MJ5 A;  2H7J A;  3BY4 A;  1POP A;  1F2B A;  3MP2 A;  4RNA A;  2NQI A;  1K3B B;  1YZB A;  4PT5 A;  4DMY A;  3N3K A;  1EWM A;  5EF4 A;  3C9E A;  4IUM A;  1NQC A;  1PE6 A;  1HUC B;  3PHX A;  2G7Y A;  2XU3 A;  2NQG A;  4MZO A;  5CVM A;  3OVX A;  3E1Z B;  2FQ9 A;  4QH6 A;  1NLJ A;  2DC9 A;  1MHW A;  3MTV A;  3DF0 A;  1BQI A;  2C0Y A;  4BOZ A;  2F1G A;  3MTN A;  2AYN A;  1TU6 A;  3OIS A;  2B1N A;  2DJG B;  2AIM A;  1EWP A;  4ZTB A;  2Z84 A;  1U9W A;  3V6C A;  3PHW A;  2HHN A;  3IUT A;  3P5X A;  1AYV A;  3MHH A;  2E02 A;  3HHA A;  3PNR A;  4M0W A;  4AXM A;  4GUA A;  4OW0 A;  2DCC A;  1F2A A;  3QJ3 A;  1AYW A;  4RF1 A;  2E01 A;  4FK5 A;  2O6X A;  3WXF A;  2JQF R;  4BOU A;  1TLO A;  2DCD A;  2J7Q A;  3HD3 A;  2FUD A;  4P6G A;  3WXG A;  4P6E A;  3LFY A;  1DKI A;  3IOQ A;  1F29 A;  1M6D A;  4XR7 A;  1YVB A;  2J7Q C;  3S3Q A;  3BCN A;  2OZ2 A;  1JQP A;  3PRM A;  1X9Y A;  1PCI A;  5J94 A;  4PP1 A;  1PAD A;  2NQD B;  4YVA A;  1XKG A;  2WBF X;  2OP3 A;  4XUI A;  1PVJ A;  3IFU A;  1PPD A;  1A6R A;  1IWD A;  2FE8 A;  2BTW A;  2YJ2 A;  9PAP A;  1AU2 A;  2P0R A;  3KW9 A;  3BBA A;  3KX1 A;  2VHF A;  3F5V A;  3K9M A;  1CVZ A;  3TMP A;  2XU4 A;  3CBK A;  4Q8H A;  4I05 A;  3KKU A;  1EWL A;  4MI7 A;  1KXR A;  2DCA A;  1MEG A;  2HH5 A;  2R9N A;  1CS8 A;  2AS8 A;  1CPJ A;  3F75 A;  3IV2 A;  1U9Q X;  4YV8 A;  4X6J A;  2PRE A;  4ZUX U;  3PBH A;  5CVO B;  2R9F A;  4BPV A;  2HXZ A;  1YK8 A;  1AU0 A;  4Q8G A;  2PNS A;  3K24 A;  3PDF A;  3ERV A;  3QT4 A;  2BU3 A;  4MM3 B;  4YYW A;  1GEC E;  2UZJ A;  5F02 A;  2JTC A;  1DEU A;  3MOR A;  2BDZ A;  2VHS A;  1NB5 A;  2DC8 A;  1CQD A;  3N3G A;  2JRI A;  1UKF A;  2BTW B;  2DZZ A;  3RVW A;  2FYE A;  1QMY A;  2PBH A;  3I06 A;  4W4U A;  4RF0 A;  1Q6K A;  4MZS A;  3TNX A;  4BOQ A;  2P86 A;  2P7U A;  4BS5 A;  4MSX A;  5PAD A;  4N8W A;  5CHT A;  3IHP A;  5A24 A;  5KO3 A;  4QBB A;  4PP2 E;  8PCH A;  1DF0 A;  2Y6E A;  3QSD A;  3O1G A;  1MDW A;  1KHQ A;  2DC7 A;  3O65 A;  1GMY A;  4BS6 A;  3S3R A;  3H6S A;  3PSE A;  2ACT A;  2OUL A;  1U9X A;  4R3D A;  2YJC A;  2AGA A;  4REZ A;  3U8E A;  1QXP A;  4K7C A;  1AEC A;  1PPP A;  5EGW A;  1ZCM A;  2NQA A;  3M99 A;  3W31 A;  1MEM A;  3AI8 A;  3PHU A;  1TL9 A;  3H89 A;  2G8J A;  1BP4 A;  1ME3 A;  2IBI A;  3IEJ A;  2F7D A;  2ARY A;  2YJB A;  3MHS A;  3W30 A;  3C0R A;  5EZQ A;  3CBJ A;  4D8E A;  1AIM A;  2E03 A;  2DCB A;  4QRV A;  3CH3 X;  3RNV A;  2CB5 A;  2JQG R;  2AUX A;  4PI3 A;  3H8C A;  3OF8 A;  5JA7 A;  1CB5 A;  1STF E;  2ATO A;  1VSN A;  1AU4 A;  2XU1 A;  2PAD A;  3H8B A;  3O0U A;  4FIP A;  4BSQ A;  1U5I A;  4IP3 A;  3HHI A;  1U9V A;  4QRX A;  3I3T A;  1GCB A;  1KFU L;  1YAL A;  4OEM A;  4P16 A;  4A5U A;  1ZIV A;  4N4Z A;  2AUZ A;  2CIO A;  1ITO A;  4AXL A;  3BWK A;  3BPF A;  4CDD B;  3B79 A;  4YYV A;  3LXS A;  2AVW A;  3HWN A;  3ZNH A;  3PW3 A;  3P5W A;  1YT7 A;  4YYU A;  2FRQ A;  4OVZ A;  4QRG A;  1PBH A;  5CVN B;  3B21 A;  4PAD A;  1BY8 A;  3ZUA A;  3BOW A;  4X6I A;  4WA6 A;  1NPZ A;  4OEL A;  2XU5 A;  4YYS A;  3PT2 A;  4I07 A;  4BOP A;  3IMA A; 
#chains in the Genus database with same CATH homology
 3KFQ A;  1NB3 A;  2GFO A;  2VFC A;  2G8E A;  2YJ8 A;  3WXE A;  2B1M A;  2AU1 A;  3OF9 A;  4G54 A;  3BPM A;  3KSE A;  4X6H A;  3K8U A;  2R9O A;  4CDE B;  2AYO A;  1FH0 A;  3P5U A;  2GHU A;  1PPN A;  1CV8 A;  3KWB X;  4W5C A;  4BQV A;  5CHV A;  4YYR A;  1W6F A;  6PAD A;  2R9M A;  1ATK A;  2FT2 A;  1GLO A;  3P5V A;  1EWO A;  4CZW A;  1AU3 A;  3GCB A;  3N4C A;  3BC3 A;  3LTW A;  1Y4H A;  4FJC A;  1BGO A;  3D6S A;  3KWZ A;  1THE A;  3CH2 X;  1EF7 A;  1VJV A;  2DC6 A;  1MIR A;  3RVV A;  2YJ9 A;  4BGF A;  1QOL A;  4W5B A;  1ME4 A;  1YK7 A;  2G6D A;  2DZY A;  2BDL A;  1CJL A;  5JH3 A;  1AYU A;  4HWY A;  3RVX A;  1O0E A;  2DJF B;  2E00 A;  2IPP B;  2FRA A;  3H7D A;  4C5P A;  1S4V A;  4I04 A;  2R6N A;  5FPW A;  2Y5B A;  1NL6 A;  1KFX L;  2FTD A;  1PPO A;  3NHE A;  3USV A;  7PCK A;  4NV8 A;  4CDF B;  2FO5 A;  2R9C A;  5K16 A;  1ICF A;  2HD5 A;  4DMX A;  1SP4 B;  1MS6 A;  3OVZ A;  1KHP A;  1Y08 A;  1CTE A;  4CDC B;  3V6E A;  1PXV A;  1QDQ A;  1SNK A;  4KLB A;  1PIP A;  1CSB B;  4N79 A;  4YYQ A;  4RY2 A;  1F2C A;  2H7J A;  1POP A;  1F2B A;  2NQI A;  1K3B B;  4DMY A;  3N3K A;  1EWM A;  5EF4 A;  3C9E A;  1NQC A;  1PE6 A;  1HUC B;  2G7Y A;  2XU3 A;  2NQG A;  4MZO A;  5CVM A;  4B55 A;  3OVX A;  3E1Z B;  2FQ9 A;  4QH6 A;  1NLJ A;  2DC9 A;  1MHW A;  3DF0 A;  1BQI A;  2C0Y A;  2F1G A;  3MTN A;  2AYN A;  1TU6 A;  3OIS A;  2B1N A;  2DJG B;  2AIM A;  1EWP A;  3D9W A;  1U9W A;  3V6C A;  2HHN A;  3IUT A;  3P5X A;  1AYV A;  3MHH A;  2E02 A;  3HHA A;  3PNR A;  1W4T A;  4AXM A;  2DCC A;  1F2A A;  3QJ3 A;  1AYW A;  2E01 A;  4FK5 A;  2O6X A;  3WXF A;  2JQF R;  1TLO A;  2DCD A;  3HD3 A;  2FUD A;  4P6G A;  3WXG A;  4P6E A;  3LFY A;  3IOQ A;  1F29 A;  1M6D A;  4XR7 A;  1YVB A;  2VFB A;  3S3Q A;  3BCN A;  2OZ2 A;  1JQP A;  1X9Y A;  1PCI A;  5J94 A;  4PP1 A;  1PAD A;  2NQD B;  4YVA A;  1XKG A;  2WBF X;  2OP3 A;  4XUI A;  1E2T A;  1PPD A;  1A6R A;  1IWD A;  2YJ2 A;  9PAP A;  1AU2 A;  2P0R A;  3KW9 A;  3KX1 A;  2VHF A;  3F5V A;  3K9M A;  1CVZ A;  2XU4 A;  3CBK A;  4Q8H A;  4I05 A;  3KKU A;  1EWL A;  1KXR A;  2DCA A;  1MEG A;  2HH5 A;  2R9N A;  4GUZ A;  1CS8 A;  2AS8 A;  1CPJ A;  3F75 A;  3IV2 A;  1U9Q X;  4YV8 A;  4X6J A;  2PRE A;  2BSZ A;  4ZUX U;  3PBH A;  5CVO B;  2R9F A;  4BPV A;  2HXZ A;  1YK8 A;  1AU0 A;  4Q8G A;  2PNS A;  3K24 A;  3PDF A;  3ERV A;  3QT4 A;  4NV7 A;  4YYW A;  1GEC E;  5F02 A;  1DEU A;  3MOR A;  2BDZ A;  2VHS A;  1NB5 A;  2DC8 A;  1CQD A;  3N3G A;  2DZZ A;  3RVW A;  2FYE A;  1QMY A;  2PBH A;  3I06 A;  4W4U A;  1Q6K A;  4MZS A;  3TNX A;  2P86 A;  2P7U A;  4BS5 A;  4MSX A;  5PAD A;  4N8W A;  5CHT A;  3IHP A;  5A24 A;  4QBB A;  4PP2 E;  8PCH A;  1DF0 A;  2Y6E A;  3QSD A;  3O1G A;  1MDW A;  1KHQ A;  2DC7 A;  1GMY A;  4BS6 A;  3S3R A;  3H6S A;  1W5R A;  2ACT A;  2OUL A;  1U9X A;  2YJC A;  3U8E A;  1QXP A;  4K7C A;  1AEC A;  1PPP A;  5EGW A;  1ZCM A;  2NQA A;  3M99 A;  1MEM A;  3AI8 A;  1TL9 A;  3H89 A;  2G8J A;  1BP4 A;  1ME3 A;  2IBI A;  3IEJ A;  2F7D A;  2ARY A;  2YJB A;  3MHS A;  3CBJ A;  1AIM A;  2E03 A;  2DCB A;  4QRV A;  3CH3 X;  2CB5 A;  2JQG R;  2AUX A;  4PI3 A;  3H8C A;  3OF8 A;  5JA7 A;  1CB5 A;  1GX3 A;  1STF E;  2ATO A;  1VSN A;  1AU4 A;  2XU1 A;  2PAD A;  3H8B A;  3O0U A;  4FIP A;  4BSQ A;  1U5I A;  3HHI A;  1U9V A;  4QRX A;  3I3T A;  1GCB A;  1KFU L;  1YAL A;  4OEM A;  1ZIV A;  4N4Z A;  2AUZ A;  2CIO A;  1ITO A;  4AXL A;  3BWK A;  3BPF A;  4CDD B;  3B79 A;  4YYV A;  3LXS A;  2AVW A;  3HWN A;  3PW3 A;  3P5W A;  1YT7 A;  4YYU A;  2FRQ A;  4QRG A;  1PBH A;  5CVN B;  4PAD A;  1BY8 A;  3ZUA A;  3BOW A;  4X6I A;  4WA6 A;  1NPZ A;  4OEL A;  2XU5 A;  4YYS A;  4I07 A;  3IMA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...