1CPJA

Crystal structures of recombinant rat cathepsin b and a cathepsin b-inhibitor complex: implications for structure-based inhibitor design
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
253
structure length
253
Chain Sequence
LPESFDAREQWSNCPTIAQIRDQGSCGSCWAFGAVEAMSDRICIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWNFWTRKGLVSGGVYNSHIGCLPYTIPPCEHHVNGARPPCTGEGDTPKCNKMCEAGYSTSYKEDKHYGYTSYSVSDSEKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDVMGGHAIRILGWGIENGVPYWLVANSWNADWGDNGFFKILRGENHCGIESEIVAGIPRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CATHEPSIN B
publication title Crystal structures of recombinant rat cathepsin B and a cathepsin B-inhibitor complex. Implications for structure-based inhibitor design.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 72
structure length 253
sequence length 253
chains with identical sequence B
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 1995-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1cpjA00
1O0EA 1KXRA 2JQGR 4YYUA 2G8EA 1PE6A 5K16A 3I3TA 3BCNA 1U9WA 4QRXA 2PREA 1NL6A 1DEUA 2DJFB 5J94A 2BDLA 3K8UA 4FJCA 2PNSA 1TL9A 3P5XA 3OISA 3BPMA 3MHSA 4P6EA 2B1NA 3IOQA 1PXVA 1MHWA 1YK7A 1AU2A 1AIMA 1Q6KA 1AYUA 3K9MA 4BS6A 3H8CA 4MZOA 1PBHA 4YYVA 3OVZA 2DC6A 2DCBA 3PW3A 4FIPA 4PP2E 4YYRA 2YJ8A 3B79A 3V6EA 4CZWA 5JH3A 5CHVA 3V6CA 5CHTA 2AUZA 2DC8A 3O0UA 1GCBA 1M6DA 3H6SA 4PADA 3PBHA 1SP4B 1X9YA 4ZUXU 2HHNA 1STFE 3D6SA 2E00A 1AU0A 1U9QX 4BPVA 1CVZA 1ZIVA 2O6XA 3HD3A 2AVWA 3MHHA 2B1MA 4P6GA 3BPFA 1YALA 2DCCA 2VHFA 5CVMA 1IWDA 3N3KA 1NB5A 3KSEA 3WXEA 4X6HA 2ARYA 8PCHA 1EWLA 1XKGA 2ATOA 4WA6A 2HXZA 2DJGB 3CH2X 3KX1A 4QH6A 4QRVA 1GLOA 1MEGA 4K7CA 2DC9A 3KKUA 4DMYA 1MIRA 4PI3A 1CV8A 5EF4A 3F5VA 4YYSA 2WBFX 3NHEA 3E1ZB 2R9CA 1PADA 1BY8A 2XU1A 1EWOA 2GFOA 1AU4A 1CTEA 1TLOA 2YJ2A 2NQGA 1MS6A 4BQVA 3KWBX 3IHPA 4W5CA 3OVXA 1SNKA 2HH5A 1AU3A 4I07A 1ME4A 2E03A 1BQIA 4DMXA 4Q8HA 3GCBA 3P5WA 2IPPB 1MEMA 1BGOA 4I04A 1NQCA 1CSBB 2PADA 3RVWA 2DC7A 1BP4A 9PAPA 1NPZA 1AYWA 1U9VA 5EGWA 3KW9A 1F2CA 2E02A 3DF0A 2DZZA 3MORA 3ZUAA 1KHQA 1YT7A 2G6DA 3LXSA 2FYEA 4N4ZA 2HD5A 2FTDA 2C0YA 3PDFA 1PPNA 1CS8A 3IMAA 2DZYA 1VSNA 3PNRA 3WXGA 3P5VA 2FRQA 3HHAA 1MDWA 1CPJA 2P0RA 1QMYA 3KFQA 2BDZA 4YYWA 4KLBA 1ZCMA 4QBBA 4OEMA 4Q8GA 3ERVA 3C9EA 2FT2A 3IV2A 1F2BA 3OF8A 1PPOA 4N8WA 2YJ9A 4YV8A 1PPPA 4N79A 2G8JA 1PPDA 1THEA 2XU5A 4W5BA 3RVXA 3USVA 1U9XA 1EF7A 2XU4A 4XR7A 3KWZA 2P86A 2AIMA 1JQPA 3LFYA 1TU6A 3N3GA 4MZSA 4W4UA 4QRGA 5F02A 3I06A 4YVAA 3S3QA 5CVNB 1ICFA 1CB5A 4YYQA 2NQDB 3IEJA 1Y4HA 2G7YA 3H8BA 2DCDA 2YJCA 3H89A 1A6RA 2F1GA 3TNXA 1QDQA 2H7JA 4PP1A 2R6NA 3HHIA 4G54A 1CQDA 5PADA 1KFXL 1Y08A 1QOLA 1EWPA 4BSQA 3O1GA 3OF9A 1CJLA 5CVOB 1F2AA 2AU1A 2ACTA 2YJBA 4BS5A 3BWKA 1ME3A 2R9MA 1AECA 1NLJA 3H7DA 4MSXA 1GMYA 3K24A 2OP3A 1U5IA 2AS8A 2R9FA 4OELA 1POPA 4CDCB 1K3BB 3CBJA 3N4CA 3U8EA 1PCIA 2JQFR 4AXMA 2OULA 3BC3A 1ATKA 1EWMA 2FQ9A 2FRAA 4X6JA 1S4VA 1HUCB 1KFUL 2R9OA 2DCAA 1GECE 5JA7A 4CDFB 5FPWA 3RVVA 2CB5A 3M99A 3WXFA 1FH0A 3IUTA 2PBHA 1F29A 1DF0A 3AI8A 2R9NA 1NB3A 3QSDA 4HWYA 3BOWA 4CDEB 1AYVA 2AYNA 3F75A 2P7UA 6PADA 3QT4A 1YK8A 7PCKA 2XU3A 2AUXA 3QJ3A 3S3RA 4AXLA 4CDDB 2NQAA 3MTNA 1YVBA 2IBIA 2Y5BA 2CIOA 2NQIA 1VJVA 2FO5A 2Y6EA 4I05A 3P5UA 1ITOA 4X6IA 4XUIA 2VHSA 3CH3X 2AYOA 3HWNA 2F7DA 1KHPA 2OZ2A 1PIPA 1QXPA 2E01A 4RY2A 5A24A 3CBKA 4FK5A 2GHUA 2FUDA
chains in the Genus database with same CATH superfamily
5E6JA 3E9SA 1O0EA 1KXRA 1PVJA 2JQGR 4YYUA 4RF1A 2G8EA 1PE6A 5K16A 3I3TA 3BCNA 1U9WA 4QRXA 2PREA 1NL6A 1DEUA 2DJFB 5J94A 1DKIA 2BDLA 3K8UA 4FJCA 2PNSA 1TL9A 3P5XA 3OISA 3BPMA 3RNVA 3MHSA 4P6EA 2B1NA 3IOQA 1PXVA 1MHWA 1YK7A 3BB7A 2AGAA 1AU2A 1AIMA 1Q6KA 1AYUA 4HXDB 3K9MA 4BS6A 3H8CA 4MZOA 1PBHA 4YYVA 3OVZA 2DC6A 2DCBA 3BY4A 3PW3A 4FIPA 4PP2E 4YYRA 2YJ8A 3B79A 3V6EA 4CZWA 3PRMA 5JH3A 4IUMA 5CHVA 5EZSA 3V6CA 5CHTA 2AUZA 2DC8A 3IFUA 3O0UA 4XZXA 1GCBA 1M6DA 2DOSA 3H6SA 3PSEA 4PADA 4D8EA 3PBHA 1SP4B 4IP3A 1X9YA 4ZUXU 2HHNA 1STFE 3D6SA 4REZA 2E00A 1AU0A 1U9QX 4BPVA 1CVZA 1ZIVA 3B21A 2O6XA 4BOZA 3PHUA 4MM3B 3HD3A 4RF0A 2BTWA 2AVWA 3MHHA 2B1MA 4RNAA 4P6GA 3BPFA 4OVZA 1YALA 2DCCA 2VHFA 5CVMA 1IWDA 3N3KA 1UKFA 1NB5A 3KSEA 3WXEA 4X6HA 2ARYA 8PCHA 1EWLA 1XKGA 2ATOA 4WA6A 2HXZA 2DJGB 3CH2X 3KX1A 4QH6A 4QRVA 1GLOA 1MEGA 4K7CA 2DC9A 3KKUA 3BBAA 4DMYA 1MIRA 4PI3A 1CV8A 5EF4A 3F5VA 4YYSA 2WBFX 3NHEA 3E1ZB 2R9CA 1PADA 5EZQA 1BY8A 2XU1A 1EWOA 2GFOA 1AU4A 1CTEA 1TLOA 2YJ2A 2NQGA 1MS6A 4BQVA 3KWBX 3TMPA 3IHPA 3PHWA 4W5CA 3OVXA 1SNKA 2HH5A 1AU3A 4I07A 3MTVA 1ME4A 2E03A 1BQIA 4DMXA 4Q8HA 3GCBA 3P5WA 2IPPB 1MEMA 1BGOA 2BTWB 4I04A 1NQCA 1CSBB 2PADA 3RVWA 2DC7A 1BP4A 9PAPA 1NPZA 1AYWA 3TRKA 1U9VA 5EGWA 3KW9A 2JTCA 4BOQA 1F2CA 2E02A 3DF0A 2DZZA 3MORA 3ZUAA 4P16A 1KHQA 1YT7A 2G6DA 3PHXA 3LXSA 2Z84A 2FYEA 4N4ZA 2HD5A 2FTDA 4BOUA 2C0YA 3PDFA 1PPNA 1CS8A 3IMAA 2DZYA 1VSNA 3PNRA 3WXGA 3P5VA 2FRQA 3HHAA 1MDWA 1CPJA 2P0RA 4R3DA 2HWKA 4PT5A 1QMYA 3KFQA 2BDZA 4YYWA 4KLBA 1ZCMA 4QBBA 4OEMA 4Q8GA 3ERVA 3C9EA 2FT2A 3IV2A 1F2BA 3OF8A 1PPOA 4OW0A 4N8WA 2YJ9A 4YV8A 1PPPA 4N79A 4BOPA 2UZJA 2G8JA 1PPDA 1THEA 2XU5A 4W5BA 3RVXA 3USVA 1U9XA 1EF7A 2XU4A 3O65A 4XR7A 3KWZA 2P86A 2AIMA 1JQPA 3LFYA 1TU6A 3OQCA 3N3GA 4MZSA 4W4UA 4QRGA 5F02A 3W31A 3I06A 4D8BA 4YVAA 3S3QA 5CVNB 1ICFA 4A5UA 1CB5A 4YYQA 2NQDB 4GUAA 3IEJA 1Y4HA 2G7YA 3H8BA 2DCDA 2YJCA 3H89A 3MP2A 3C0RA 1A6RA 2F1GA 3TNXA 1QDQA 2H7JA 4PP1A 2R6NA 3HHIA 1YZBA 4G54A 1CQDA 5PADA 1KFXL 1Y08A 1QOLA 1EWPA 4BSQA 3O1GA 3OF9A 1CJLA 5CVOB 1F2AA 2AU1A 2ACTA 2YJBA 4BS5A 3BWKA 1ME3A 2R9MA 1AECA 1NLJA 3H7DA 4MSXA 1GMYA 3K24A 4OVZB 2OP3A 1U5IA 2AS8A 3PT2A 2R9FA 4OELA 1POPA 4RKXA 4CDCB 1K3BB 3CBJA 3N4CA 3U8EA 3ZNHA 1PCIA 2JQFR 4AXMA 4BOSA 2OULA 3BC3A 1ATKA 1EWMA 2J7QC 2FQ9A 2FRAA 4X6JA 1S4VA 1HUCB 1KFUL 2R9OA 2DCAA 2J7QA 1GECE 5JA7A 4CDFB 5FPWA 3RVVA 2CB5A 3M99A 3WXFA 1FH0A 3IUTA 2PBHA 1F29A 1DF0A 3AI8A 2R9NA 5KO3A 1NB3A 3QSDA 4HWYA 3BOWA 4CDEB 1AYVA 2AYNA 3F75A 3MJ5A 2P7UA 6PADA 3QT4A 1YK8A 7PCKA 5JZEA 4WURA 2XU3A 2AUXA 2BU3A 3QJ3A 3S3RA 4AXLA 4MI7A 4CDDB 4D8IA 2NQAA 3MTNA 1YVBA 2IBIA 2Y5BA 2CIOA 2NQIA 1VJVA 2FO5A 2JRIA 2Y6EA 3W30A 4I05A 3P5UA 1ITOA 4X6IA 4XUIA 4M0WA 2VHSA 3CH3X 4ZTBA 3PRPA 2AYOA 3HWNA 2F7DA 1KHPA 2FE8A 2OZ2A 1PIPA 1QXPA 2E01A 4RY2A 5A24A 3CBKA 4FK5A 2GHUA 2FUDA
chains in the Genus database with same CATH topology
1O0EA 1KXRA 2VFBA 2JQGR 4YYUA 2G8EA 1PE6A 5K16A 3I3TA 3BCNA 1U9WA 4QRXA 2PREA 1NL6A 1DEUA 2DJFB 5J94A 2BDLA 3K8UA 4FJCA 2PNSA 1TL9A 3P5XA 3OISA 3BPMA 3MHSA 4P6EA 2B1NA 3IOQA 1PXVA 1MHWA 1YK7A 1AU2A 1AIMA 1Q6KA 1AYUA 3K9MA 4BS6A 3H8CA 4MZOA 1PBHA 4YYVA 3OVZA 2DC6A 2DCBA 3PW3A 4FIPA 4PP2E 4YYRA 2YJ8A 3B79A 3V6EA 4CZWA 5JH3A 4NV8A 5CHVA 3V6CA 5CHTA 2VFCA 2AUZA 2DC8A 3O0UA 1GCBA 1M6DA 3H6SA 4PADA 3PBHA 1SP4B 1X9YA 4ZUXU 2HHNA 1STFE 3D6SA 2E00A 1AU0A 1U9QX 4BPVA 1CVZA 1ZIVA 2O6XA 3HD3A 1E2TA 2AVWA 3MHHA 2B1MA 4P6GA 3LTWA 3BPFA 1YALA 2DCCA 2VHFA 5CVMA 1IWDA 3N3KA 1NB5A 3KSEA 3WXEA 4X6HA 2ARYA 8PCHA 1EWLA 1XKGA 2ATOA 2BSZA 4WA6A 2HXZA 2DJGB 3CH2X 3KX1A 4QH6A 4QRVA 1GLOA 1MEGA 4K7CA 2DC9A 3KKUA 4DMYA 1MIRA 4PI3A 1CV8A 5EF4A 3F5VA 4BGFA 4YYSA 2WBFX 3NHEA 3E1ZB 2R9CA 1PADA 1BY8A 2XU1A 1EWOA 2GFOA 1AU4A 1CTEA 1TLOA 2YJ2A 2NQGA 1MS6A 4BQVA 4B55A 3KWBX 3IHPA 4W5CA 3OVXA 1SNKA 2HH5A 1AU3A 4I07A 4GUZA 1ME4A 2E03A 1BQIA 4DMXA 4Q8HA 3GCBA 3P5WA 2IPPB 1MEMA 1BGOA 1W5RA 4I04A 1NQCA 1CSBB 2PADA 3RVWA 2DC7A 1BP4A 9PAPA 1NPZA 1AYWA 1U9VA 5EGWA 3KW9A 1F2CA 2E02A 3DF0A 2DZZA 3MORA 3ZUAA 1KHQA 1YT7A 2G6DA 3LXSA 2FYEA 4N4ZA 2HD5A 2FTDA 2C0YA 3PDFA 1W6FA 1PPNA 1CS8A 3IMAA 2DZYA 1VSNA 4NV7A 3PNRA 3WXGA 3D9WA 3P5VA 2FRQA 3HHAA 1MDWA 1CPJA 2P0RA 1QMYA 3KFQA 2BDZA 4YYWA 4KLBA 1ZCMA 4QBBA 4OEMA 4Q8GA 3ERVA 3C9EA 2FT2A 3IV2A 1F2BA 3OF8A 1PPOA 4N8WA 2YJ9A 4YV8A 1PPPA 4N79A 2G8JA 1PPDA 1THEA 2XU5A 4W5BA 3RVXA 3USVA 1U9XA 1EF7A 2XU4A 1GX3A 4XR7A 3KWZA 2P86A 2AIMA 1JQPA 3LFYA 1TU6A 3N3GA 4MZSA 4W4UA 4QRGA 5F02A 3I06A 4YVAA 3S3QA 5CVNB 1ICFA 1CB5A 4YYQA 2NQDB 3IEJA 4C5PA 1Y4HA 2G7YA 3H8BA 2DCDA 2YJCA 3H89A 1A6RA 2F1GA 3TNXA 1QDQA 2H7JA 4PP1A 2R6NA 3HHIA 4G54A 1CQDA 5PADA 1KFXL 1Y08A 1QOLA 1EWPA 4BSQA 3O1GA 3OF9A 1CJLA 5CVOB 1F2AA 2AU1A 2ACTA 2YJBA 4BS5A 3BWKA 1ME3A 2R9MA 1AECA 1NLJA 3H7DA 4MSXA 1GMYA 3K24A 2OP3A 1U5IA 2AS8A 2R9FA 4OELA 1POPA 4CDCB 1K3BB 3CBJA 3N4CA 3U8EA 1PCIA 2JQFR 4AXMA 2OULA 3BC3A 1ATKA 1EWMA 2FQ9A 2FRAA 4X6JA 1S4VA 1HUCB 1KFUL 2R9OA 2DCAA 1GECE 5JA7A 4CDFB 5FPWA 3RVVA 2CB5A 3M99A 3WXFA 1FH0A 3IUTA 2PBHA 1F29A 1DF0A 3AI8A 2R9NA 1NB3A 3QSDA 1W4TA 4HWYA 3BOWA 4CDEB 1AYVA 2AYNA 3F75A 2P7UA 6PADA 3QT4A 1YK8A 7PCKA 2XU3A 2AUXA 3QJ3A 3S3RA 4AXLA 4CDDB 2NQAA 3MTNA 1YVBA 2IBIA 2Y5BA 2CIOA 2NQIA 1VJVA 2FO5A 2Y6EA 4I05A 3P5UA 1ITOA 4X6IA 4XUIA 2VHSA 3CH3X 2AYOA 3HWNA 2F7DA 1KHPA 2OZ2A 1PIPA 1QXPA 2E01A 4RY2A 5A24A 3CBKA 4FK5A 2GHUA 2FUDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O0E A;  1KXR A;  2JQG R;  4YYU A;  2G8E A;  1PE6 A;  5K16 A;  3I3T A;  3BCN A;  1U9W A;  4QRX A;  2PRE A;  1NL6 A;  1DEU A;  2DJF B;  5J94 A;  2BDL A;  3K8U A;  4FJC A;  2PNS A;  1TL9 A;  3P5X A;  3OIS A;  3BPM A;  3MHS A;  4P6E A;  2B1N A;  3IOQ A;  1PXV A;  1MHW A;  1YK7 A;  1AU2 A;  1AIM A;  1Q6K A;  1AYU A;  3K9M A;  4BS6 A;  3H8C A;  4MZO A;  1PBH A;  4YYV A;  3OVZ A;  2DC6 A;  2DCB A;  3PW3 A;  4FIP A;  4PP2 E;  4YYR A;  2YJ8 A;  3B79 A;  3V6E A;  4CZW A;  5JH3 A;  5CHV A;  3V6C A;  5CHT A;  2AUZ A;  2DC8 A;  3O0U A;  1GCB A;  1M6D A;  3H6S A;  4PAD A;  3PBH A;  1SP4 B;  1X9Y A;  4ZUX U;  2HHN A;  1STF E;  3D6S A;  2E00 A;  1AU0 A;  1U9Q X;  4BPV A;  1CVZ A;  1ZIV A;  2O6X A;  3HD3 A;  2AVW A;  3MHH A;  2B1M A;  4P6G A;  3BPF A;  1YAL A;  2DCC A;  2VHF A;  5CVM A;  1IWD A;  3N3K A;  1NB5 A;  3KSE A;  3WXE A;  4X6H A;  2ARY A;  8PCH A;  1EWL A;  1XKG A;  2ATO A;  4WA6 A;  2HXZ A;  2DJG B;  3CH2 X;  3KX1 A;  4QH6 A;  4QRV A;  1GLO A;  1MEG A;  4K7C A;  2DC9 A;  3KKU A;  4DMY A;  1MIR A;  4PI3 A;  1CV8 A;  5EF4 A;  3F5V A;  4YYS A;  2WBF X;  3NHE A;  3E1Z B;  2R9C A;  1PAD A;  1BY8 A;  2XU1 A;  1EWO A;  2GFO A;  1AU4 A;  1CTE A;  1TLO A;  2YJ2 A;  2NQG A;  1MS6 A;  4BQV A;  3KWB X;  3IHP A;  4W5C A;  3OVX A;  1SNK A;  2HH5 A;  1AU3 A;  4I07 A;  1ME4 A;  2E03 A;  1BQI A;  4DMX A;  4Q8H A;  3GCB A;  3P5W A;  2IPP B;  1MEM A;  1BGO A;  4I04 A;  1NQC A;  1CSB B;  2PAD A;  3RVW A;  2DC7 A;  1BP4 A;  9PAP A;  1NPZ A;  1AYW A;  1U9V A;  5EGW A;  3KW9 A;  1F2C A;  2E02 A;  3DF0 A;  2DZZ A;  3MOR A;  3ZUA A;  1KHQ A;  1YT7 A;  2G6D A;  3LXS A;  2FYE A;  4N4Z A;  2HD5 A;  2FTD A;  2C0Y A;  3PDF A;  1PPN A;  1CS8 A;  3IMA A;  2DZY A;  1VSN A;  3PNR A;  3WXG A;  3P5V A;  2FRQ A;  3HHA A;  1MDW A;  1CPJ A;  2P0R A;  1QMY A;  3KFQ A;  2BDZ A;  4YYW A;  4KLB A;  1ZCM A;  4QBB A;  4OEM A;  4Q8G A;  3ERV A;  3C9E A;  2FT2 A;  3IV2 A;  1F2B A;  3OF8 A;  1PPO A;  4N8W A;  2YJ9 A;  4YV8 A;  1PPP A;  4N79 A;  2G8J A;  1PPD A;  1THE A;  2XU5 A;  4W5B A;  3RVX A;  3USV A;  1U9X A;  1EF7 A;  2XU4 A;  4XR7 A;  3KWZ A;  2P86 A;  2AIM A;  1JQP A;  3LFY A;  1TU6 A;  3N3G A;  4MZS A;  4W4U A;  4QRG A;  5F02 A;  3I06 A;  4YVA A;  3S3Q A;  5CVN B;  1ICF A;  1CB5 A;  4YYQ A;  2NQD B;  3IEJ A;  1Y4H A;  2G7Y A;  3H8B A;  2DCD A;  2YJC A;  3H89 A;  1A6R A;  2F1G A;  3TNX A;  1QDQ A;  2H7J A;  4PP1 A;  2R6N A;  3HHI A;  4G54 A;  1CQD A;  5PAD A;  1KFX L;  1Y08 A;  1QOL A;  1EWP A;  4BSQ A;  3O1G A;  3OF9 A;  1CJL A;  5CVO B;  1F2A A;  2AU1 A;  2ACT A;  2YJB A;  4BS5 A;  3BWK A;  1ME3 A;  2R9M A;  1AEC A;  1NLJ A;  3H7D A;  4MSX A;  1GMY A;  3K24 A;  2OP3 A;  1U5I A;  2AS8 A;  2R9F A;  4OEL A;  1POP A;  4CDC B;  1K3B B;  3CBJ A;  3N4C A;  3U8E A;  1PCI A;  2JQF R;  4AXM A;  2OUL A;  3BC3 A;  1ATK A;  1EWM A;  2FQ9 A;  2FRA A;  4X6J A;  1S4V A;  1HUC B;  1KFU L;  2R9O A;  2DCA A;  1GEC E;  5JA7 A;  4CDF B;  5FPW A;  3RVV A;  2CB5 A;  3M99 A;  3WXF A;  1FH0 A;  3IUT A;  2PBH A;  1F29 A;  1DF0 A;  3AI8 A;  2R9N A;  1NB3 A;  3QSD A;  4HWY A;  3BOW A;  4CDE B;  1AYV A;  2AYN A;  3F75 A;  2P7U A;  6PAD A;  3QT4 A;  1YK8 A;  7PCK A;  2XU3 A;  2AUX A;  3QJ3 A;  3S3R A;  4AXL A;  4CDD B;  2NQA A;  3MTN A;  1YVB A;  2IBI A;  2Y5B A;  2CIO A;  2NQI A;  1VJV A;  2FO5 A;  2Y6E A;  4I05 A;  3P5U A;  1ITO A;  4X6I A;  4XUI A;  2VHS A;  3CH3 X;  2AYO A;  3HWN A;  2F7D A;  1KHP A;  2OZ2 A;  1PIP A;  1QXP A;  2E01 A;  4RY2 A;  5A24 A;  3CBK A;  4FK5 A;  2GHU A;  2FUD A; 
#chains in the Genus database with same CATH topology
 5E6J A;  3E9S A;  1O0E A;  1KXR A;  1PVJ A;  2JQG R;  4YYU A;  4RF1 A;  2G8E A;  1PE6 A;  5K16 A;  3I3T A;  3BCN A;  1U9W A;  4QRX A;  2PRE A;  1NL6 A;  1DEU A;  2DJF B;  5J94 A;  1DKI A;  2BDL A;  3K8U A;  4FJC A;  2PNS A;  1TL9 A;  3P5X A;  3OIS A;  3BPM A;  3RNV A;  3MHS A;  4P6E A;  2B1N A;  3IOQ A;  1PXV A;  1MHW A;  1YK7 A;  3BB7 A;  2AGA A;  1AU2 A;  1AIM A;  1Q6K A;  1AYU A;  4HXD B;  3K9M A;  4BS6 A;  3H8C A;  4MZO A;  1PBH A;  4YYV A;  3OVZ A;  2DC6 A;  2DCB A;  3BY4 A;  3PW3 A;  4FIP A;  4PP2 E;  4YYR A;  2YJ8 A;  3B79 A;  3V6E A;  4CZW A;  3PRM A;  5JH3 A;  4IUM A;  5CHV A;  5EZS A;  3V6C A;  5CHT A;  2AUZ A;  2DC8 A;  3IFU A;  3O0U A;  4XZX A;  1GCB A;  1M6D A;  2DOS A;  3H6S A;  3PSE A;  4PAD A;  4D8E A;  3PBH A;  1SP4 B;  4IP3 A;  1X9Y A;  4ZUX U;  2HHN A;  1STF E;  3D6S A;  4REZ A;  2E00 A;  1AU0 A;  1U9Q X;  4BPV A;  1CVZ A;  1ZIV A;  3B21 A;  2O6X A;  4BOZ A;  3PHU A;  4MM3 B;  3HD3 A;  4RF0 A;  2BTW A;  2AVW A;  3MHH A;  2B1M A;  4RNA A;  4P6G A;  3BPF A;  4OVZ A;  1YAL A;  2DCC A;  2VHF A;  5CVM A;  1IWD A;  3N3K A;  1UKF A;  1NB5 A;  3KSE A;  3WXE A;  4X6H A;  2ARY A;  8PCH A;  1EWL A;  1XKG A;  2ATO A;  4WA6 A;  2HXZ A;  2DJG B;  3CH2 X;  3KX1 A;  4QH6 A;  4QRV A;  1GLO A;  1MEG A;  4K7C A;  2DC9 A;  3KKU A;  3BBA A;  4DMY A;  1MIR A;  4PI3 A;  1CV8 A;  5EF4 A;  3F5V A;  4YYS A;  2WBF X;  3NHE A;  3E1Z B;  2R9C A;  1PAD A;  5EZQ A;  1BY8 A;  2XU1 A;  1EWO A;  2GFO A;  1AU4 A;  1CTE A;  1TLO A;  2YJ2 A;  2NQG A;  1MS6 A;  4BQV A;  3KWB X;  3TMP A;  3IHP A;  3PHW A;  4W5C A;  3OVX A;  1SNK A;  2HH5 A;  1AU3 A;  4I07 A;  3MTV A;  1ME4 A;  2E03 A;  1BQI A;  4DMX A;  4Q8H A;  3GCB A;  3P5W A;  2IPP B;  1MEM A;  1BGO A;  2BTW B;  4I04 A;  1NQC A;  1CSB B;  2PAD A;  3RVW A;  2DC7 A;  1BP4 A;  9PAP A;  1NPZ A;  1AYW A;  3TRK A;  1U9V A;  5EGW A;  3KW9 A;  2JTC A;  4BOQ A;  1F2C A;  2E02 A;  3DF0 A;  2DZZ A;  3MOR A;  3ZUA A;  4P16 A;  1KHQ A;  1YT7 A;  2G6D A;  3PHX A;  3LXS A;  2Z84 A;  2FYE A;  4N4Z A;  2HD5 A;  2FTD A;  4BOU A;  2C0Y A;  3PDF A;  1PPN A;  1CS8 A;  3IMA A;  2DZY A;  1VSN A;  3PNR A;  3WXG A;  3P5V A;  2FRQ A;  3HHA A;  1MDW A;  1CPJ A;  2P0R A;  4R3D A;  2HWK A;  4PT5 A;  1QMY A;  3KFQ A;  2BDZ A;  4YYW A;  4KLB A;  1ZCM A;  4QBB A;  4OEM A;  4Q8G A;  3ERV A;  3C9E A;  2FT2 A;  3IV2 A;  1F2B A;  3OF8 A;  1PPO A;  4OW0 A;  4N8W A;  2YJ9 A;  4YV8 A;  1PPP A;  4N79 A;  4BOP A;  2UZJ A;  2G8J A;  1PPD A;  1THE A;  2XU5 A;  4W5B A;  3RVX A;  3USV A;  1U9X A;  1EF7 A;  2XU4 A;  3O65 A;  4XR7 A;  3KWZ A;  2P86 A;  2AIM A;  1JQP A;  3LFY A;  1TU6 A;  3OQC A;  3N3G A;  4MZS A;  4W4U A;  4QRG A;  5F02 A;  3W31 A;  3I06 A;  4D8B A;  4YVA A;  3S3Q A;  5CVN B;  1ICF A;  4A5U A;  1CB5 A;  4YYQ A;  2NQD B;  4GUA A;  3IEJ A;  1Y4H A;  2G7Y A;  3H8B A;  2DCD A;  2YJC A;  3H89 A;  3MP2 A;  3C0R A;  1A6R A;  2F1G A;  3TNX A;  1QDQ A;  2H7J A;  4PP1 A;  2R6N A;  3HHI A;  1YZB A;  4G54 A;  1CQD A;  5PAD A;  1KFX L;  1Y08 A;  1QOL A;  1EWP A;  4BSQ A;  3O1G A;  3OF9 A;  1CJL A;  5CVO B;  1F2A A;  2AU1 A;  2ACT A;  2YJB A;  4BS5 A;  3BWK A;  1ME3 A;  2R9M A;  1AEC A;  1NLJ A;  3H7D A;  4MSX A;  1GMY A;  3K24 A;  4OVZ B;  2OP3 A;  1U5I A;  2AS8 A;  3PT2 A;  2R9F A;  4OEL A;  1POP A;  4RKX A;  4CDC B;  1K3B B;  3CBJ A;  3N4C A;  3U8E A;  3ZNH A;  1PCI A;  2JQF R;  4AXM A;  4BOS A;  2OUL A;  3BC3 A;  1ATK A;  1EWM A;  2J7Q C;  2FQ9 A;  2FRA A;  4X6J A;  1S4V A;  1HUC B;  1KFU L;  2R9O A;  2DCA A;  2J7Q A;  1GEC E;  5JA7 A;  4CDF B;  5FPW A;  3RVV A;  2CB5 A;  3M99 A;  3WXF A;  1FH0 A;  3IUT A;  2PBH A;  1F29 A;  1DF0 A;  3AI8 A;  2R9N A;  5KO3 A;  1NB3 A;  3QSD A;  4HWY A;  3BOW A;  4CDE B;  1AYV A;  2AYN A;  3F75 A;  3MJ5 A;  2P7U A;  6PAD A;  3QT4 A;  1YK8 A;  7PCK A;  5JZE A;  4WUR A;  2XU3 A;  2AUX A;  2BU3 A;  3QJ3 A;  3S3R A;  4AXL A;  4MI7 A;  4CDD B;  4D8I A;  2NQA A;  3MTN A;  1YVB A;  2IBI A;  2Y5B A;  2CIO A;  2NQI A;  1VJV A;  2FO5 A;  2JRI A;  2Y6E A;  3W30 A;  4I05 A;  3P5U A;  1ITO A;  4X6I A;  4XUI A;  4M0W A;  2VHS A;  3CH3 X;  4ZTB A;  3PRP A;  2AYO A;  3HWN A;  2F7D A;  1KHP A;  2FE8 A;  2OZ2 A;  1PIP A;  1QXP A;  2E01 A;  4RY2 A;  5A24 A;  3CBK A;  4FK5 A;  2GHU A;  2FUD A; 
#chains in the Genus database with same CATH homology
 1O0E A;  1KXR A;  2VFB A;  2JQG R;  4YYU A;  2G8E A;  1PE6 A;  5K16 A;  3I3T A;  3BCN A;  1U9W A;  4QRX A;  2PRE A;  1NL6 A;  1DEU A;  2DJF B;  5J94 A;  2BDL A;  3K8U A;  4FJC A;  2PNS A;  1TL9 A;  3P5X A;  3OIS A;  3BPM A;  3MHS A;  4P6E A;  2B1N A;  3IOQ A;  1PXV A;  1MHW A;  1YK7 A;  1AU2 A;  1AIM A;  1Q6K A;  1AYU A;  3K9M A;  4BS6 A;  3H8C A;  4MZO A;  1PBH A;  4YYV A;  3OVZ A;  2DC6 A;  2DCB A;  3PW3 A;  4FIP A;  4PP2 E;  4YYR A;  2YJ8 A;  3B79 A;  3V6E A;  4CZW A;  5JH3 A;  4NV8 A;  5CHV A;  3V6C A;  5CHT A;  2VFC A;  2AUZ A;  2DC8 A;  3O0U A;  1GCB A;  1M6D A;  3H6S A;  4PAD A;  3PBH A;  1SP4 B;  1X9Y A;  4ZUX U;  2HHN A;  1STF E;  3D6S A;  2E00 A;  1AU0 A;  1U9Q X;  4BPV A;  1CVZ A;  1ZIV A;  2O6X A;  3HD3 A;  1E2T A;  2AVW A;  3MHH A;  2B1M A;  4P6G A;  3LTW A;  3BPF A;  1YAL A;  2DCC A;  2VHF A;  5CVM A;  1IWD A;  3N3K A;  1NB5 A;  3KSE A;  3WXE A;  4X6H A;  2ARY A;  8PCH A;  1EWL A;  1XKG A;  2ATO A;  2BSZ A;  4WA6 A;  2HXZ A;  2DJG B;  3CH2 X;  3KX1 A;  4QH6 A;  4QRV A;  1GLO A;  1MEG A;  4K7C A;  2DC9 A;  3KKU A;  4DMY A;  1MIR A;  4PI3 A;  1CV8 A;  5EF4 A;  3F5V A;  4BGF A;  4YYS A;  2WBF X;  3NHE A;  3E1Z B;  2R9C A;  1PAD A;  1BY8 A;  2XU1 A;  1EWO A;  2GFO A;  1AU4 A;  1CTE A;  1TLO A;  2YJ2 A;  2NQG A;  1MS6 A;  4BQV A;  4B55 A;  3KWB X;  3IHP A;  4W5C A;  3OVX A;  1SNK A;  2HH5 A;  1AU3 A;  4I07 A;  4GUZ A;  1ME4 A;  2E03 A;  1BQI A;  4DMX A;  4Q8H A;  3GCB A;  3P5W A;  2IPP B;  1MEM A;  1BGO A;  1W5R A;  4I04 A;  1NQC A;  1CSB B;  2PAD A;  3RVW A;  2DC7 A;  1BP4 A;  9PAP A;  1NPZ A;  1AYW A;  1U9V A;  5EGW A;  3KW9 A;  1F2C A;  2E02 A;  3DF0 A;  2DZZ A;  3MOR A;  3ZUA A;  1KHQ A;  1YT7 A;  2G6D A;  3LXS A;  2FYE A;  4N4Z A;  2HD5 A;  2FTD A;  2C0Y A;  3PDF A;  1W6F A;  1PPN A;  1CS8 A;  3IMA A;  2DZY A;  1VSN A;  4NV7 A;  3PNR A;  3WXG A;  3D9W A;  3P5V A;  2FRQ A;  3HHA A;  1MDW A;  1CPJ A;  2P0R A;  1QMY A;  3KFQ A;  2BDZ A;  4YYW A;  4KLB A;  1ZCM A;  4QBB A;  4OEM A;  4Q8G A;  3ERV A;  3C9E A;  2FT2 A;  3IV2 A;  1F2B A;  3OF8 A;  1PPO A;  4N8W A;  2YJ9 A;  4YV8 A;  1PPP A;  4N79 A;  2G8J A;  1PPD A;  1THE A;  2XU5 A;  4W5B A;  3RVX A;  3USV A;  1U9X A;  1EF7 A;  2XU4 A;  1GX3 A;  4XR7 A;  3KWZ A;  2P86 A;  2AIM A;  1JQP A;  3LFY A;  1TU6 A;  3N3G A;  4MZS A;  4W4U A;  4QRG A;  5F02 A;  3I06 A;  4YVA A;  3S3Q A;  5CVN B;  1ICF A;  1CB5 A;  4YYQ A;  2NQD B;  3IEJ A;  4C5P A;  1Y4H A;  2G7Y A;  3H8B A;  2DCD A;  2YJC A;  3H89 A;  1A6R A;  2F1G A;  3TNX A;  1QDQ A;  2H7J A;  4PP1 A;  2R6N A;  3HHI A;  4G54 A;  1CQD A;  5PAD A;  1KFX L;  1Y08 A;  1QOL A;  1EWP A;  4BSQ A;  3O1G A;  3OF9 A;  1CJL A;  5CVO B;  1F2A A;  2AU1 A;  2ACT A;  2YJB A;  4BS5 A;  3BWK A;  1ME3 A;  2R9M A;  1AEC A;  1NLJ A;  3H7D A;  4MSX A;  1GMY A;  3K24 A;  2OP3 A;  1U5I A;  2AS8 A;  2R9F A;  4OEL A;  1POP A;  4CDC B;  1K3B B;  3CBJ A;  3N4C A;  3U8E A;  1PCI A;  2JQF R;  4AXM A;  2OUL A;  3BC3 A;  1ATK A;  1EWM A;  2FQ9 A;  2FRA A;  4X6J A;  1S4V A;  1HUC B;  1KFU L;  2R9O A;  2DCA A;  1GEC E;  5JA7 A;  4CDF B;  5FPW A;  3RVV A;  2CB5 A;  3M99 A;  3WXF A;  1FH0 A;  3IUT A;  2PBH A;  1F29 A;  1DF0 A;  3AI8 A;  2R9N A;  1NB3 A;  3QSD A;  1W4T A;  4HWY A;  3BOW A;  4CDE B;  1AYV A;  2AYN A;  3F75 A;  2P7U A;  6PAD A;  3QT4 A;  1YK8 A;  7PCK A;  2XU3 A;  2AUX A;  3QJ3 A;  3S3R A;  4AXL A;  4CDD B;  2NQA A;  3MTN A;  1YVB A;  2IBI A;  2Y5B A;  2CIO A;  2NQI A;  1VJV A;  2FO5 A;  2Y6E A;  4I05 A;  3P5U A;  1ITO A;  4X6I A;  4XUI A;  2VHS A;  3CH3 X;  2AYO A;  3HWN A;  2F7D A;  1KHP A;  2OZ2 A;  1PIP A;  1QXP A;  2E01 A;  4RY2 A;  5A24 A;  3CBK A;  4FK5 A;  2GHU A;  2FUD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...