1CPJA

Crystal structures of recombinant rat cathepsin b and a cathepsin b-inhibitor complex: implications for structure-based inhibitor design
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
253
structure length
253
Chain Sequence
LPESFDAREQWSNCPTIAQIRDQGSCGSCWAFGAVEAMSDRICIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWNFWTRKGLVSGGVYNSHIGCLPYTIPPCEHHVNGARPPCTGEGDTPKCNKMCEAGYSTSYKEDKHYGYTSYSVSDSEKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDVMGGHAIRILGWGIENGVPYWLVANSWNADWGDNGFFKILRGENHCGIESEIVAGIPRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATHEPSIN B
publication title Crystal structures of recombinant rat cathepsin B and a cathepsin B-inhibitor complex. Implications for structure-based inhibitor design.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 72
structure length 253
sequence length 253
chains with identical sequence B
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 1995-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1cpjA00
3BPMA 3PNRA 2CB5A 1U9QX 2GFOA 4QH6A 1SNKA 2R9CA 4X6HA 1PIPA 1THEA 4BS5A 1AYWA 1BY8A 4YYRA 1GLOA 2R9FA 2AUXA 5JA7A 1U9WA 4N8WA 3CH2X 4QBBA 1NB3A 3WXGA 1CPJA 3U8EA 4CDCB 1DF0A 1F2CA 1MHWA 3QJ3A 2OP3A 1PADA 1A6RA 1U5IA 3CBKA 3I06A 1KHPA 1FH0A 3S3QA 1BP4A 3MORA 3H6SA 1PPOA 1JQPA 4PP2E 4HWYA 3PDFA 3IV2A 3CBJA 4CZWA 2O6XA 3PW3A 4WA6A 3MTNA 3F5VA 4MZOA 2YJCA 1NL6A 3BOWA 4BSQA 3PBHA 2AVWA 3NHEA 4FIPA 1DEUA 1AECA 2G7YA 4QRVA 5J94A 1TL9A 2DCCA 9PAPA 3K24A 3OVZA 2HXZA 4I07A 1QDQA 1GMYA 1NLJA 1CSBB 2DZZA 2ACTA 4FJCA 3WXEA 1AU0A 4P6EA 2IPPB 3RVVA 5CHTA 1CV8A 1AYVA 1PCIA 3F75A 4AXMA 1EF7A 3KKUA 3C9EA 1PE6A 2XU5A 2E01A 2ARYA 3K9MA 1MIRA 3N3GA 1Y08A 1U9VA 2H7JA 1CQDA 1M6DA 3IMAA 4N4ZA 2G6DA 3M99A 2G8JA 4OELA 2YJBA 1ATKA 3AI8A 1PXVA 2R6NA 1MS6A 3P5XA 2F1GA 3P5VA 1Y4HA 3V6CA 3BWKA 1GCBA 4W4UA 1YK7A 4OEMA 2YJ8A 1HUCB 2HHNA 4CDEB 1SP4B 7PCKA 1MEGA 1X9YA 4X6JA 2OULA 5A24A 2CIOA 2DZYA 1VSNA 1AU4A 5EF4A 2YJ9A 1PBHA 2P0RA 2BDLA 4MSXA 3LFYA 2FT2A 4YYVA 1YALA 2BDZA 1F2AA 2AYNA 3ERVA 2FTDA 2NQAA 2XU3A 1KXRA 1K3BB 2PADA 2DC9A 3OVXA 3B79A 3P5WA 1O0EA 3D6SA 1F29A 3K8UA 2DCBA 2E03A 2E02A 3KSEA 1CS8A 1AU3A 2XU4A 3E1ZB 3MHSA 2DC8A 2HH5A 1AU2A 2GHUA 2FYEA 3KWBX 4YYUA 4ZUXU 1EWLA 4MZSA 2B1NA 2PNSA 3WXFA 3BCNA 2R9NA 4FK5A 3O0UA 1EWOA 1KFUL 3KX1A 4X6IA 2AYOA 1AIMA 1NQCA 2P86A 2R9OA 3IUTA 2NQGA 3GCBA 3OF8A 3P5UA 2NQDB 3H8CA 4QRXA 5CVNB 4CDDB 2DCDA 1ME3A 3H89A 5K16A 4KLBA 2DJGB 1BGOA 1CVZA 4CDFB 2FUDA 4YVAA 5PADA 3HWNA 3KW9A 2IBIA 1XKGA 3OISA 2Y6EA 1STFE 2P7UA 2AIMA 2VHSA 1KFXL 2C0YA 4YV8A 4QRGA 3V6EA 4PI3A 2R9MA 3QSDA 2DC6A 4XR7A 4PP1A 4W5BA 5CVMA 1VJVA 3IEJA 1TLOA 1CTEA 3KWZA 6PADA 1POPA 5EGWA 3IHPA 3LXSA 1S4VA 3KFQA 4N79A 2WBFX 5CHVA 2FO5A 4RY2A 2NQIA 3O1GA 3MHHA 1TU6A 4DMXA 5FPWA 4G54A 3IOQA 1Q6KA 1NB5A 4YYQA 1ITOA 3H8BA 1AYUA 1MEMA 2VHFA 1ZCMA 5F02A 4XUIA 3DF0A 3ZUAA 3RVXA 2G8EA 2Y5BA 1ICFA 3USVA 3N3KA 2E00A 1BQIA 2AU1A 4YYWA 3BPFA 1QXPA 4I04A 4P6GA 4DMYA 1PPPA 2PBHA 2JQGR 1QMYA 4I05A 1NPZA 3QT4A 5JH3A 4Q8HA 4PADA 2DJFB 1QOLA 8PCHA 2ATOA 1CJLA 3TNXA 3H7DA 3HHAA 4AXLA 1F2BA 1CB5A 4YYSA 2AS8A 4BPVA 1YK8A 1ZIVA 1EWMA 3BC3A 2DC7A 5CVOB 3HD3A 2HD5A 2FRAA 1YT7A 1ME4A 1U9XA 1MDWA 2DCAA 1IWDA 2FRQA 2B1MA 4BQVA 4Q8GA 2XU1A 2F7DA 1PPDA 1PPNA 1GECE 4BS6A 4K7CA 4W5CA 3N4CA 1KHQA 2FQ9A 2PREA 1EWPA 2JQFR 2OZ2A 3OF9A 3RVWA 2AUZA 2YJ2A 3S3RA 3HHIA 3I3TA 1YVBA 3CH3X
chains in the Genus database with same CATH superfamily
3BPMA 3PNRA 2CB5A 1U9QX 2GFOA 4QH6A 1SNKA 2R9CA 4X6HA 1PIPA 5EZQA 1THEA 4BS5A 4PT5A 1AYWA 4OW0A 3E9SA 1BY8A 4YYRA 1GLOA 2R9FA 2AUXA 5JA7A 1U9WA 4N8WA 3ZNHA 3CH2X 4QBBA 1NB3A 3WXGA 1CPJA 3U8EA 3OQCA 4CDCB 1DF0A 1F2CA 3MJ5A 1MHWA 3QJ3A 2OP3A 3PRMA 1PADA 1A6RA 3W31A 1U5IA 3PHXA 3CBKA 3I06A 1KHPA 1FH0A 1PVJA 3S3QA 2BU3A 3MP2A 1BP4A 3MORA 3H6SA 1PPOA 1JQPA 4PP2E 4HWYA 4REZA 4D8BA 3PDFA 3IV2A 2BTWA 3CBJA 4CZWA 2O6XA 3PW3A 4WA6A 3MTNA 3F5VA 4HXDB 4MZOA 2YJCA 1NL6A 3BOWA 4BSQA 3PBHA 2AVWA 3NHEA 4FIPA 1DEUA 1AECA 2G7YA 4QRVA 5J94A 1TL9A 2DCCA 9PAPA 4RKXA 4BOQA 3K24A 5EZSA 3PT2A 3OVZA 4MI7A 2HXZA 3IFUA 4I07A 1QDQA 1GMYA 1NLJA 1CSBB 2DZZA 2ACTA 4FJCA 3WXEA 1AU0A 4A5UA 4P6EA 2Z84A 3RNVA 2IPPB 3RVVA 5CHTA 1CV8A 3C0RA 1AYVA 1PCIA 3F75A 5E6JA 4AXMA 1EF7A 3KKUA 3O65A 3C9EA 1PE6A 2XU5A 2E01A 2ARYA 3K9MA 1MIRA 3N3GA 1Y08A 1U9VA 3PHWA 2H7JA 1CQDA 4OVZB 1M6DA 3IMAA 4N4ZA 2G6DA 3M99A 2G8JA 4OELA 2YJBA 1ATKA 3AI8A 1PXVA 2R6NA 1MS6A 3P5XA 2F1GA 3P5VA 4R3DA 4M0WA 1Y4HA 3V6CA 3BWKA 1GCBA 4W4UA 1YK7A 4OEMA 2YJ8A 1HUCB 2HHNA 4CDEB 1SP4B 7PCKA 1MEGA 1X9YA 4X6JA 2OULA 5A24A 2CIOA 2DZYA 1VSNA 3PRPA 3B21A 1AU4A 5EF4A 2YJ9A 1UKFA 1PBHA 2P0RA 2BDLA 4MSXA 3LFYA 2FT2A 4YYVA 1YALA 2BDZA 1F2AA 2AYNA 3ERVA 2FTDA 2NQAA 2XU3A 4BOZA 1KXRA 1K3BB 2PADA 2DC9A 3TRKA 3OVXA 3B79A 3P5WA 1O0EA 3D6SA 1F29A 3K8UA 2DCBA 2E03A 4XZXA 2E02A 3KSEA 1CS8A 1AU3A 3BBAA 2XU4A 3E1ZB 3MHSA 2DC8A 2HH5A 1AU2A 4BOSA 2GHUA 2FYEA 3KWBX 4YYUA 4ZUXU 1EWLA 2DOSA 4MZSA 2B1NA 4P16A 2PNSA 3WXFA 3BCNA 2R9NA 4FK5A 3O0UA 1EWOA 1KFUL 3KX1A 4X6IA 2JRIA 2AYOA 1AIMA 1NQCA 2P86A 2R9OA 2FE8A 3IUTA 2NQGA 3GCBA 3OF8A 3P5UA 2NQDB 3H8CA 4RNAA 4QRXA 4D8EA 5CVNB 4ZTBA 4CDDB 2DCDA 2J7QC 1ME3A 5JZEA 3H89A 5K16A 4KLBA 2DJGB 1BGOA 1CVZA 4CDFB 3BB7A 2FUDA 4YVAA 5PADA 2HWKA 3HWNA 3KW9A 2IBIA 1XKGA 3OISA 1YZBA 2Y6EA 3W30A 1STFE 2P7UA 2AIMA 2VHSA 4GUAA 1KFXL 2C0YA 4YV8A 4QRGA 3BY4A 3V6EA 4PI3A 2R9MA 4IP3A 3QSDA 2UZJA 2DC6A 4MM3B 4XR7A 4PP1A 4W5BA 5CVMA 2BTWB 1VJVA 3IEJA 1TLOA 1CTEA 3KWZA 6PADA 5KO3A 1POPA 5EGWA 3IHPA 3LXSA 1S4VA 3KFQA 4N79A 2WBFX 2AGAA 5CHVA 2FO5A 4RY2A 2NQIA 3O1GA 3MHHA 1TU6A 4DMXA 2JTCA 4OVZA 5FPWA 4G54A 3IOQA 1Q6KA 1NB5A 4YYQA 1ITOA 4BOUA 3H8BA 1AYUA 1MEMA 2VHFA 3TMPA 1ZCMA 5F02A 3MTVA 4XUIA 3DF0A 3ZUAA 3RVXA 2G8EA 2Y5BA 1ICFA 3USVA 3N3KA 2E00A 1BQIA 2AU1A 4YYWA 3BPFA 1QXPA 4I04A 4P6GA 4DMYA 1PPPA 4IUMA 2J7QA 2JQGR 2PBHA 1QMYA 4I05A 1NPZA 3QT4A 5JH3A 4Q8HA 4PADA 2DJFB 1QOLA 8PCHA 2ATOA 1CJLA 3TNXA 3H7DA 3HHAA 4AXLA 1F2BA 1DKIA 1CB5A 3PSEA 4YYSA 4RF0A 2AS8A 4BPVA 1YK8A 1ZIVA 1EWMA 3BC3A 2DC7A 5CVOB 3HD3A 2HD5A 2FRAA 1YT7A 1ME4A 1U9XA 1MDWA 2DCAA 1IWDA 2FRQA 2B1MA 4BQVA 3PHUA 4Q8GA 2XU1A 2F7DA 1PPDA 1PPNA 1GECE 4BS6A 4K7CA 4W5CA 3N4CA 1KHQA 2FQ9A 2PREA 1EWPA 2JQFR 2OZ2A 3OF9A 3RVWA 4D8IA 4WURA 2AUZA 2YJ2A 4RF1A 3S3RA 3HHIA 3I3TA 1YVBA 4BOPA 3CH3X
chains in the Genus database with same CATH topology
3BPMA 3PNRA 2CB5A 1U9QX 2GFOA 4QH6A 1SNKA 2R9CA 4X6HA 1PIPA 1THEA 4BS5A 1AYWA 1BY8A 4YYRA 1GLOA 2R9FA 2AUXA 5JA7A 1U9WA 4N8WA 3CH2X 4QBBA 1NB3A 3WXGA 1CPJA 3LTWA 3U8EA 4CDCB 1DF0A 1F2CA 1MHWA 3QJ3A 2OP3A 1PADA 1A6RA 1U5IA 3CBKA 3I06A 1KHPA 1FH0A 3S3QA 1BP4A 3MORA 3H6SA 1PPOA 1JQPA 4PP2E 4HWYA 3PDFA 3IV2A 3CBJA 4CZWA 2O6XA 3PW3A 4WA6A 1GX3A 3MTNA 3F5VA 4MZOA 2YJCA 1NL6A 3BOWA 4BSQA 3PBHA 2AVWA 3NHEA 4FIPA 1DEUA 1AECA 2G7YA 4QRVA 5J94A 1TL9A 2DCCA 9PAPA 3K24A 3D9WA 3OVZA 2HXZA 4I07A 1QDQA 1GMYA 1NLJA 1CSBB 2DZZA 2ACTA 4FJCA 3WXEA 1AU0A 4P6EA 2IPPB 3RVVA 5CHTA 1CV8A 1AYVA 1PCIA 3F75A 4AXMA 1EF7A 3KKUA 3C9EA 1PE6A 2XU5A 2E01A 2ARYA 3K9MA 1MIRA 3N3GA 1Y08A 1U9VA 2H7JA 1CQDA 1M6DA 3IMAA 4N4ZA 2G6DA 3M99A 2G8JA 4OELA 2YJBA 1ATKA 3AI8A 1PXVA 2R6NA 1MS6A 3P5XA 1W5RA 2F1GA 4B55A 3P5VA 1Y4HA 3V6CA 4GUZA 3BWKA 1GCBA 4W4UA 1YK7A 4OEMA 2YJ8A 1HUCB 4C5PA 2HHNA 4CDEB 1SP4B 7PCKA 1MEGA 1X9YA 4X6JA 2OULA 1W6FA 2CIOA 5A24A 2DZYA 1VSNA 1AU4A 5EF4A 2YJ9A 1PBHA 2P0RA 2BDLA 4MSXA 3LFYA 2FT2A 4YYVA 1YALA 2BDZA 1F2AA 2AYNA 3ERVA 2FTDA 2NQAA 2XU3A 1KXRA 1K3BB 2PADA 2DC9A 3OVXA 3B79A 3P5WA 1O0EA 1W4TA 3D6SA 1F29A 3K8UA 2DCBA 2E03A 2E02A 3KSEA 1CS8A 1AU3A 2XU4A 3E1ZB 3MHSA 2DC8A 2HH5A 1AU2A 2GHUA 2FYEA 3KWBX 4YYUA 4ZUXU 1EWLA 4MZSA 2B1NA 2PNSA 3WXFA 3BCNA 2R9NA 4FK5A 3O0UA 1EWOA 1KFUL 3KX1A 4X6IA 2AYOA 1AIMA 1NQCA 2P86A 2R9OA 3IUTA 2NQGA 3GCBA 3OF8A 3P5UA 2NQDB 3H8CA 4QRXA 5CVNB 4CDDB 2DCDA 1ME3A 3H89A 5K16A 4KLBA 2DJGB 1BGOA 1CVZA 4CDFB 2FUDA 4YVAA 5PADA 3HWNA 3KW9A 2IBIA 1XKGA 3OISA 2Y6EA 1STFE 2P7UA 2AIMA 2VHSA 1KFXL 2C0YA 4YV8A 4QRGA 3V6EA 4PI3A 2R9MA 3QSDA 2DC6A 4XR7A 4PP1A 4W5BA 5CVMA 1VJVA 3IEJA 1TLOA 1CTEA 3KWZA 6PADA 1POPA 5EGWA 3IHPA 3LXSA 1S4VA 3KFQA 4N79A 2WBFX 5CHVA 2FO5A 4RY2A 2NQIA 3O1GA 3MHHA 1TU6A 4DMXA 5FPWA 4G54A 3IOQA 1Q6KA 2VFBA 1NB5A 4BGFA 4YYQA 1ITOA 3H8BA 1AYUA 1MEMA 2VHFA 1ZCMA 5F02A 4XUIA 3DF0A 3ZUAA 3RVXA 4NV7A 2G8EA 2Y5BA 1ICFA 3USVA 3N3KA 2E00A 1BQIA 2AU1A 4YYWA 3BPFA 1QXPA 4I04A 4P6GA 4DMYA 1PPPA 2PBHA 2JQGR 1QMYA 4I05A 1NPZA 3QT4A 5JH3A 4Q8HA 4PADA 2DJFB 1QOLA 8PCHA 2ATOA 1CJLA 3TNXA 3H7DA 3HHAA 4AXLA 1F2BA 1CB5A 4YYSA 2AS8A 4BPVA 1YK8A 1ZIVA 4NV8A 1EWMA 2BSZA 3BC3A 2DC7A 5CVOB 3HD3A 2HD5A 2FRAA 1YT7A 1ME4A 1U9XA 1MDWA 2DCAA 1IWDA 2FRQA 2B1MA 4BQVA 4Q8GA 2XU1A 2F7DA 1PPDA 1PPNA 1GECE 4BS6A 4K7CA 4W5CA 3N4CA 1KHQA 2FQ9A 2PREA 1EWPA 2JQFR 2OZ2A 3OF9A 3RVWA 2AUZA 2YJ2A 1E2TA 3S3RA 2VFCA 3HHIA 3I3TA 1YVBA 3CH3X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BPM A;  3PNR A;  2CB5 A;  1U9Q X;  2GFO A;  4QH6 A;  1SNK A;  2R9C A;  4X6H A;  1PIP A;  1THE A;  4BS5 A;  1AYW A;  1BY8 A;  4YYR A;  1GLO A;  2R9F A;  2AUX A;  5JA7 A;  1U9W A;  4N8W A;  3CH2 X;  4QBB A;  1NB3 A;  3WXG A;  1CPJ A;  3U8E A;  4CDC B;  1DF0 A;  1F2C A;  1MHW A;  3QJ3 A;  2OP3 A;  1PAD A;  1A6R A;  1U5I A;  3CBK A;  3I06 A;  1KHP A;  1FH0 A;  3S3Q A;  1BP4 A;  3MOR A;  3H6S A;  1PPO A;  1JQP A;  4PP2 E;  4HWY A;  3PDF A;  3IV2 A;  3CBJ A;  4CZW A;  2O6X A;  3PW3 A;  4WA6 A;  3MTN A;  3F5V A;  4MZO A;  2YJC A;  1NL6 A;  3BOW A;  4BSQ A;  3PBH A;  2AVW A;  3NHE A;  4FIP A;  1DEU A;  1AEC A;  2G7Y A;  4QRV A;  5J94 A;  1TL9 A;  2DCC A;  9PAP A;  3K24 A;  3OVZ A;  2HXZ A;  4I07 A;  1QDQ A;  1GMY A;  1NLJ A;  1CSB B;  2DZZ A;  2ACT A;  4FJC A;  3WXE A;  1AU0 A;  4P6E A;  2IPP B;  3RVV A;  5CHT A;  1CV8 A;  1AYV A;  1PCI A;  3F75 A;  4AXM A;  1EF7 A;  3KKU A;  3C9E A;  1PE6 A;  2XU5 A;  2E01 A;  2ARY A;  3K9M A;  1MIR A;  3N3G A;  1Y08 A;  1U9V A;  2H7J A;  1CQD A;  1M6D A;  3IMA A;  4N4Z A;  2G6D A;  3M99 A;  2G8J A;  4OEL A;  2YJB A;  1ATK A;  3AI8 A;  1PXV A;  2R6N A;  1MS6 A;  3P5X A;  2F1G A;  3P5V A;  1Y4H A;  3V6C A;  3BWK A;  1GCB A;  4W4U A;  1YK7 A;  4OEM A;  2YJ8 A;  1HUC B;  2HHN A;  4CDE B;  1SP4 B;  7PCK A;  1MEG A;  1X9Y A;  4X6J A;  2OUL A;  5A24 A;  2CIO A;  2DZY A;  1VSN A;  1AU4 A;  5EF4 A;  2YJ9 A;  1PBH A;  2P0R A;  2BDL A;  4MSX A;  3LFY A;  2FT2 A;  4YYV A;  1YAL A;  2BDZ A;  1F2A A;  2AYN A;  3ERV A;  2FTD A;  2NQA A;  2XU3 A;  1KXR A;  1K3B B;  2PAD A;  2DC9 A;  3OVX A;  3B79 A;  3P5W A;  1O0E A;  3D6S A;  1F29 A;  3K8U A;  2DCB A;  2E03 A;  2E02 A;  3KSE A;  1CS8 A;  1AU3 A;  2XU4 A;  3E1Z B;  3MHS A;  2DC8 A;  2HH5 A;  1AU2 A;  2GHU A;  2FYE A;  3KWB X;  4YYU A;  4ZUX U;  1EWL A;  4MZS A;  2B1N A;  2PNS A;  3WXF A;  3BCN A;  2R9N A;  4FK5 A;  3O0U A;  1EWO A;  1KFU L;  3KX1 A;  4X6I A;  2AYO A;  1AIM A;  1NQC A;  2P86 A;  2R9O A;  3IUT A;  2NQG A;  3GCB A;  3OF8 A;  3P5U A;  2NQD B;  3H8C A;  4QRX A;  5CVN B;  4CDD B;  2DCD A;  1ME3 A;  3H89 A;  5K16 A;  4KLB A;  2DJG B;  1BGO A;  1CVZ A;  4CDF B;  2FUD A;  4YVA A;  5PAD A;  3HWN A;  3KW9 A;  2IBI A;  1XKG A;  3OIS A;  2Y6E A;  1STF E;  2P7U A;  2AIM A;  2VHS A;  1KFX L;  2C0Y A;  4YV8 A;  4QRG A;  3V6E A;  4PI3 A;  2R9M A;  3QSD A;  2DC6 A;  4XR7 A;  4PP1 A;  4W5B A;  5CVM A;  1VJV A;  3IEJ A;  1TLO A;  1CTE A;  3KWZ A;  6PAD A;  1POP A;  5EGW A;  3IHP A;  3LXS A;  1S4V A;  3KFQ A;  4N79 A;  2WBF X;  5CHV A;  2FO5 A;  4RY2 A;  2NQI A;  3O1G A;  3MHH A;  1TU6 A;  4DMX A;  5FPW A;  4G54 A;  3IOQ A;  1Q6K A;  1NB5 A;  4YYQ A;  1ITO A;  3H8B A;  1AYU A;  1MEM A;  2VHF A;  1ZCM A;  5F02 A;  4XUI A;  3DF0 A;  3ZUA A;  3RVX A;  2G8E A;  2Y5B A;  1ICF A;  3USV A;  3N3K A;  2E00 A;  1BQI A;  2AU1 A;  4YYW A;  3BPF A;  1QXP A;  4I04 A;  4P6G A;  4DMY A;  1PPP A;  2PBH A;  2JQG R;  1QMY A;  4I05 A;  1NPZ A;  3QT4 A;  5JH3 A;  4Q8H A;  4PAD A;  2DJF B;  1QOL A;  8PCH A;  2ATO A;  1CJL A;  3TNX A;  3H7D A;  3HHA A;  4AXL A;  1F2B A;  1CB5 A;  4YYS A;  2AS8 A;  4BPV A;  1YK8 A;  1ZIV A;  1EWM A;  3BC3 A;  2DC7 A;  5CVO B;  3HD3 A;  2HD5 A;  2FRA A;  1YT7 A;  1ME4 A;  1U9X A;  1MDW A;  2DCA A;  1IWD A;  2FRQ A;  2B1M A;  4BQV A;  4Q8G A;  2XU1 A;  2F7D A;  1PPD A;  1PPN A;  1GEC E;  4BS6 A;  4K7C A;  4W5C A;  3N4C A;  1KHQ A;  2FQ9 A;  2PRE A;  1EWP A;  2JQF R;  2OZ2 A;  3OF9 A;  3RVW A;  2AUZ A;  2YJ2 A;  3S3R A;  3HHI A;  3I3T A;  1YVB A;  3CH3 X; 
#chains in the Genus database with same CATH topology
 3BPM A;  3PNR A;  2CB5 A;  1U9Q X;  2GFO A;  4QH6 A;  1SNK A;  2R9C A;  4X6H A;  1PIP A;  5EZQ A;  1THE A;  4BS5 A;  4PT5 A;  1AYW A;  4OW0 A;  3E9S A;  1BY8 A;  4YYR A;  1GLO A;  2R9F A;  2AUX A;  5JA7 A;  1U9W A;  4N8W A;  3ZNH A;  3CH2 X;  4QBB A;  1NB3 A;  3WXG A;  1CPJ A;  3U8E A;  3OQC A;  4CDC B;  1DF0 A;  1F2C A;  3MJ5 A;  1MHW A;  3QJ3 A;  2OP3 A;  3PRM A;  1PAD A;  1A6R A;  3W31 A;  1U5I A;  3PHX A;  3CBK A;  3I06 A;  1KHP A;  1FH0 A;  1PVJ A;  3S3Q A;  2BU3 A;  3MP2 A;  1BP4 A;  3MOR A;  3H6S A;  1PPO A;  1JQP A;  4PP2 E;  4HWY A;  4REZ A;  4D8B A;  3PDF A;  3IV2 A;  2BTW A;  3CBJ A;  4CZW A;  2O6X A;  3PW3 A;  4WA6 A;  3MTN A;  3F5V A;  4HXD B;  4MZO A;  2YJC A;  1NL6 A;  3BOW A;  4BSQ A;  3PBH A;  2AVW A;  3NHE A;  4FIP A;  1DEU A;  1AEC A;  2G7Y A;  4QRV A;  5J94 A;  1TL9 A;  2DCC A;  9PAP A;  4RKX A;  4BOQ A;  3K24 A;  5EZS A;  3PT2 A;  3OVZ A;  4MI7 A;  2HXZ A;  3IFU A;  4I07 A;  1QDQ A;  1GMY A;  1NLJ A;  1CSB B;  2DZZ A;  2ACT A;  4FJC A;  3WXE A;  1AU0 A;  4A5U A;  4P6E A;  2Z84 A;  3RNV A;  2IPP B;  3RVV A;  5CHT A;  1CV8 A;  3C0R A;  1AYV A;  1PCI A;  3F75 A;  5E6J A;  4AXM A;  1EF7 A;  3KKU A;  3O65 A;  3C9E A;  1PE6 A;  2XU5 A;  2E01 A;  2ARY A;  3K9M A;  1MIR A;  3N3G A;  1Y08 A;  1U9V A;  3PHW A;  2H7J A;  1CQD A;  4OVZ B;  1M6D A;  3IMA A;  4N4Z A;  2G6D A;  3M99 A;  2G8J A;  4OEL A;  2YJB A;  1ATK A;  3AI8 A;  1PXV A;  2R6N A;  1MS6 A;  3P5X A;  2F1G A;  3P5V A;  4R3D A;  4M0W A;  1Y4H A;  3V6C A;  3BWK A;  1GCB A;  4W4U A;  1YK7 A;  4OEM A;  2YJ8 A;  1HUC B;  2HHN A;  4CDE B;  1SP4 B;  7PCK A;  1MEG A;  1X9Y A;  4X6J A;  2OUL A;  5A24 A;  2CIO A;  2DZY A;  1VSN A;  3PRP A;  3B21 A;  1AU4 A;  5EF4 A;  2YJ9 A;  1UKF A;  1PBH A;  2P0R A;  2BDL A;  4MSX A;  3LFY A;  2FT2 A;  4YYV A;  1YAL A;  2BDZ A;  1F2A A;  2AYN A;  3ERV A;  2FTD A;  2NQA A;  2XU3 A;  4BOZ A;  1KXR A;  1K3B B;  2PAD A;  2DC9 A;  3TRK A;  3OVX A;  3B79 A;  3P5W A;  1O0E A;  3D6S A;  1F29 A;  3K8U A;  2DCB A;  2E03 A;  4XZX A;  2E02 A;  3KSE A;  1CS8 A;  1AU3 A;  3BBA A;  2XU4 A;  3E1Z B;  3MHS A;  2DC8 A;  2HH5 A;  1AU2 A;  4BOS A;  2GHU A;  2FYE A;  3KWB X;  4YYU A;  4ZUX U;  1EWL A;  2DOS A;  4MZS A;  2B1N A;  4P16 A;  2PNS A;  3WXF A;  3BCN A;  2R9N A;  4FK5 A;  3O0U A;  1EWO A;  1KFU L;  3KX1 A;  4X6I A;  2JRI A;  2AYO A;  1AIM A;  1NQC A;  2P86 A;  2R9O A;  2FE8 A;  3IUT A;  2NQG A;  3GCB A;  3OF8 A;  3P5U A;  2NQD B;  3H8C A;  4RNA A;  4QRX A;  4D8E A;  5CVN B;  4ZTB A;  4CDD B;  2DCD A;  2J7Q C;  1ME3 A;  5JZE A;  3H89 A;  5K16 A;  4KLB A;  2DJG B;  1BGO A;  1CVZ A;  4CDF B;  3BB7 A;  2FUD A;  4YVA A;  5PAD A;  2HWK A;  3HWN A;  3KW9 A;  2IBI A;  1XKG A;  3OIS A;  1YZB A;  2Y6E A;  3W30 A;  1STF E;  2P7U A;  2AIM A;  2VHS A;  4GUA A;  1KFX L;  2C0Y A;  4YV8 A;  4QRG A;  3BY4 A;  3V6E A;  4PI3 A;  2R9M A;  4IP3 A;  3QSD A;  2UZJ A;  2DC6 A;  4MM3 B;  4XR7 A;  4PP1 A;  4W5B A;  5CVM A;  2BTW B;  1VJV A;  3IEJ A;  1TLO A;  1CTE A;  3KWZ A;  6PAD A;  5KO3 A;  1POP A;  5EGW A;  3IHP A;  3LXS A;  1S4V A;  3KFQ A;  4N79 A;  2WBF X;  2AGA A;  5CHV A;  2FO5 A;  4RY2 A;  2NQI A;  3O1G A;  3MHH A;  1TU6 A;  4DMX A;  2JTC A;  4OVZ A;  5FPW A;  4G54 A;  3IOQ A;  1Q6K A;  1NB5 A;  4YYQ A;  1ITO A;  4BOU A;  3H8B A;  1AYU A;  1MEM A;  2VHF A;  3TMP A;  1ZCM A;  5F02 A;  3MTV A;  4XUI A;  3DF0 A;  3ZUA A;  3RVX A;  2G8E A;  2Y5B A;  1ICF A;  3USV A;  3N3K A;  2E00 A;  1BQI A;  2AU1 A;  4YYW A;  3BPF A;  1QXP A;  4I04 A;  4P6G A;  4DMY A;  1PPP A;  4IUM A;  2J7Q A;  2JQG R;  2PBH A;  1QMY A;  4I05 A;  1NPZ A;  3QT4 A;  5JH3 A;  4Q8H A;  4PAD A;  2DJF B;  1QOL A;  8PCH A;  2ATO A;  1CJL A;  3TNX A;  3H7D A;  3HHA A;  4AXL A;  1F2B A;  1DKI A;  1CB5 A;  3PSE A;  4YYS A;  4RF0 A;  2AS8 A;  4BPV A;  1YK8 A;  1ZIV A;  1EWM A;  3BC3 A;  2DC7 A;  5CVO B;  3HD3 A;  2HD5 A;  2FRA A;  1YT7 A;  1ME4 A;  1U9X A;  1MDW A;  2DCA A;  1IWD A;  2FRQ A;  2B1M A;  4BQV A;  3PHU A;  4Q8G A;  2XU1 A;  2F7D A;  1PPD A;  1PPN A;  1GEC E;  4BS6 A;  4K7C A;  4W5C A;  3N4C A;  1KHQ A;  2FQ9 A;  2PRE A;  1EWP A;  2JQF R;  2OZ2 A;  3OF9 A;  3RVW A;  4D8I A;  4WUR A;  2AUZ A;  2YJ2 A;  4RF1 A;  3S3R A;  3HHI A;  3I3T A;  1YVB A;  4BOP A;  3CH3 X; 
#chains in the Genus database with same CATH homology
 3BPM A;  3PNR A;  2CB5 A;  1U9Q X;  2GFO A;  4QH6 A;  1SNK A;  2R9C A;  4X6H A;  1PIP A;  1THE A;  4BS5 A;  1AYW A;  1BY8 A;  4YYR A;  1GLO A;  2R9F A;  2AUX A;  5JA7 A;  1U9W A;  4N8W A;  3CH2 X;  4QBB A;  1NB3 A;  3WXG A;  1CPJ A;  3LTW A;  3U8E A;  4CDC B;  1DF0 A;  1F2C A;  1MHW A;  3QJ3 A;  2OP3 A;  1PAD A;  1A6R A;  1U5I A;  3CBK A;  3I06 A;  1KHP A;  1FH0 A;  3S3Q A;  1BP4 A;  3MOR A;  3H6S A;  1PPO A;  1JQP A;  4PP2 E;  4HWY A;  3PDF A;  3IV2 A;  3CBJ A;  4CZW A;  2O6X A;  3PW3 A;  4WA6 A;  1GX3 A;  3MTN A;  3F5V A;  4MZO A;  2YJC A;  1NL6 A;  3BOW A;  4BSQ A;  3PBH A;  2AVW A;  3NHE A;  4FIP A;  1DEU A;  1AEC A;  2G7Y A;  4QRV A;  5J94 A;  1TL9 A;  2DCC A;  9PAP A;  3K24 A;  3D9W A;  3OVZ A;  2HXZ A;  4I07 A;  1QDQ A;  1GMY A;  1NLJ A;  1CSB B;  2DZZ A;  2ACT A;  4FJC A;  3WXE A;  1AU0 A;  4P6E A;  2IPP B;  3RVV A;  5CHT A;  1CV8 A;  1AYV A;  1PCI A;  3F75 A;  4AXM A;  1EF7 A;  3KKU A;  3C9E A;  1PE6 A;  2XU5 A;  2E01 A;  2ARY A;  3K9M A;  1MIR A;  3N3G A;  1Y08 A;  1U9V A;  2H7J A;  1CQD A;  1M6D A;  3IMA A;  4N4Z A;  2G6D A;  3M99 A;  2G8J A;  4OEL A;  2YJB A;  1ATK A;  3AI8 A;  1PXV A;  2R6N A;  1MS6 A;  3P5X A;  1W5R A;  2F1G A;  4B55 A;  3P5V A;  1Y4H A;  3V6C A;  4GUZ A;  3BWK A;  1GCB A;  4W4U A;  1YK7 A;  4OEM A;  2YJ8 A;  1HUC B;  4C5P A;  2HHN A;  4CDE B;  1SP4 B;  7PCK A;  1MEG A;  1X9Y A;  4X6J A;  2OUL A;  1W6F A;  2CIO A;  5A24 A;  2DZY A;  1VSN A;  1AU4 A;  5EF4 A;  2YJ9 A;  1PBH A;  2P0R A;  2BDL A;  4MSX A;  3LFY A;  2FT2 A;  4YYV A;  1YAL A;  2BDZ A;  1F2A A;  2AYN A;  3ERV A;  2FTD A;  2NQA A;  2XU3 A;  1KXR A;  1K3B B;  2PAD A;  2DC9 A;  3OVX A;  3B79 A;  3P5W A;  1O0E A;  1W4T A;  3D6S A;  1F29 A;  3K8U A;  2DCB A;  2E03 A;  2E02 A;  3KSE A;  1CS8 A;  1AU3 A;  2XU4 A;  3E1Z B;  3MHS A;  2DC8 A;  2HH5 A;  1AU2 A;  2GHU A;  2FYE A;  3KWB X;  4YYU A;  4ZUX U;  1EWL A;  4MZS A;  2B1N A;  2PNS A;  3WXF A;  3BCN A;  2R9N A;  4FK5 A;  3O0U A;  1EWO A;  1KFU L;  3KX1 A;  4X6I A;  2AYO A;  1AIM A;  1NQC A;  2P86 A;  2R9O A;  3IUT A;  2NQG A;  3GCB A;  3OF8 A;  3P5U A;  2NQD B;  3H8C A;  4QRX A;  5CVN B;  4CDD B;  2DCD A;  1ME3 A;  3H89 A;  5K16 A;  4KLB A;  2DJG B;  1BGO A;  1CVZ A;  4CDF B;  2FUD A;  4YVA A;  5PAD A;  3HWN A;  3KW9 A;  2IBI A;  1XKG A;  3OIS A;  2Y6E A;  1STF E;  2P7U A;  2AIM A;  2VHS A;  1KFX L;  2C0Y A;  4YV8 A;  4QRG A;  3V6E A;  4PI3 A;  2R9M A;  3QSD A;  2DC6 A;  4XR7 A;  4PP1 A;  4W5B A;  5CVM A;  1VJV A;  3IEJ A;  1TLO A;  1CTE A;  3KWZ A;  6PAD A;  1POP A;  5EGW A;  3IHP A;  3LXS A;  1S4V A;  3KFQ A;  4N79 A;  2WBF X;  5CHV A;  2FO5 A;  4RY2 A;  2NQI A;  3O1G A;  3MHH A;  1TU6 A;  4DMX A;  5FPW A;  4G54 A;  3IOQ A;  1Q6K A;  2VFB A;  1NB5 A;  4BGF A;  4YYQ A;  1ITO A;  3H8B A;  1AYU A;  1MEM A;  2VHF A;  1ZCM A;  5F02 A;  4XUI A;  3DF0 A;  3ZUA A;  3RVX A;  4NV7 A;  2G8E A;  2Y5B A;  1ICF A;  3USV A;  3N3K A;  2E00 A;  1BQI A;  2AU1 A;  4YYW A;  3BPF A;  1QXP A;  4I04 A;  4P6G A;  4DMY A;  1PPP A;  2PBH A;  2JQG R;  1QMY A;  4I05 A;  1NPZ A;  3QT4 A;  5JH3 A;  4Q8H A;  4PAD A;  2DJF B;  1QOL A;  8PCH A;  2ATO A;  1CJL A;  3TNX A;  3H7D A;  3HHA A;  4AXL A;  1F2B A;  1CB5 A;  4YYS A;  2AS8 A;  4BPV A;  1YK8 A;  1ZIV A;  4NV8 A;  1EWM A;  2BSZ A;  3BC3 A;  2DC7 A;  5CVO B;  3HD3 A;  2HD5 A;  2FRA A;  1YT7 A;  1ME4 A;  1U9X A;  1MDW A;  2DCA A;  1IWD A;  2FRQ A;  2B1M A;  4BQV A;  4Q8G A;  2XU1 A;  2F7D A;  1PPD A;  1PPN A;  1GEC E;  4BS6 A;  4K7C A;  4W5C A;  3N4C A;  1KHQ A;  2FQ9 A;  2PRE A;  1EWP A;  2JQF R;  2OZ2 A;  3OF9 A;  3RVW A;  2AUZ A;  2YJ2 A;  1E2T A;  3S3R A;  2VFC A;  3HHI A;  3I3T A;  1YVB A;  3CH3 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...