4QRVA

Crystal structure of i86f mutant of papain
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
Knots found
sequence length
316
structure length
301
Chain Sequence
IVGYSQNDLTSTERLIQLFESWMLKHNKIYKNIDEKIYRFEIFKDNLKYIDETNKKNNSYWLGLNVFADMSNDEFKEKYTGSYTTTEVNIPEYVDWRQKGAVTPVKNQGSCGSAWAFSAVSTIESIIKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIRNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Papain
publication title Pro-peptide regulates the substrate specificity and zymogen activation process of papain: A structural and mechanistic insight
rcsb
source organism Carica papaya
molecule tags Hydrolase
total genus 109
structure length 301
sequence length 316
chains with identical sequence B
other databases KnotProt 2.0: K -31 -31 -31
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 2014-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
A PF08246 Inhibitor_I29 Cathepsin propeptide inhibitor domain (I29)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4qrvA00
5EGWA 4W5BA 4DMYA 3H6SA 1XKGA 1U9VA 1VJVA 2O6XA 1BP4A 2CIOA 5FPWA 4QH6A 4KLBA 1AYWA 4YYVA 3WXGA 3D6SA 1NPZA 1NQCA 1EWOA 3S3RA 2OZ2A 1S4VA 4QRXA 4YYRA 3KW9A 2DCCA 2NQAA 2G7YA 4N79A 1MS6A 4PI3A 3CH3X 3PDFA 2BDLA 1AIMA 5K16A 1AU3A 4QBBA 3H8CA 5CHTA 3PNRA 1PBHA 3OVZA 1ZCMA 3MHSA 2B1MA 4PADA 3P5XA 1QDQA 1U9XA 2AYNA 2ACTA 1STFE 2G8EA 4I05A 3LXSA 4I07A 3BPMA 2XU3A 3ERVA 1NB3A 3TNXA 4FJCA 4I04A 5CVOB 3O0UA 4QRGA 1DF0A 2R9CA 5CHVA 4Q8HA 2NQDB 3OVXA 1BY8A 2R9MA 4YV8A 1ME3A 4AXMA 3V6CA 1CB5A 2DCAA 1GCBA 2E01A 1Y4HA 1GLOA 2AVWA 2YJ2A 1FH0A 4QRVA 1F2CA 1DEUA 1PPDA 1TLOA 3IUTA 8PCHA 3RVWA 2ARYA 3IV2A 1KHPA 1CSBB 2FTDA 2PREA 2XU4A 3K8UA 4YYSA 3IMAA 3KX1A 4MSXA 1KFXL 3H89A 3BC3A 2F7DA 2FUDA 2G8JA 2P7UA 4G54A 1M6DA 2IPPB 1YT7A 2DC6A 1MEGA 7PCKA 9PAPA 4CDFB 2DJGB 2XU5A 1QOLA 1AU0A 5CVNB 2E02A 2YJCA 3K9MA 4YYQA 1ME4A 1Y08A 1CS8A 2GHUA 1ATKA 3BWKA 2AIMA 2HD5A 3QT4A 1BGOA 4HWYA 2DC8A 3RVXA 2FYEA 5J94A 2HH5A 2G6DA 1K3BB 4N4ZA 2AUXA 4YYUA 1O0EA 1EF7A 1VSNA 2YJ8A 2JQFR 2OP3A 1POPA 3DF0A 3KWBX 3KWZA 1PIPA 4N8WA 3H7DA 2OULA 2DZZA 1NB5A 1PXVA 3AI8A 3CBJA 4PP1A 4BS5A 4FIPA 3P5VA 4Q8GA 1KXRA 2HHNA 2FRQA 1CVZA 2GFOA 2PBHA 4X6HA 1IWDA 6PADA 1KHQA 3V6EA 2IBIA 1PPPA 1U5IA 1YK7A 4ZUXU 1PPOA 1AU2A 5PADA 2DC7A 4X6JA 1F29A 1U9QX 3C9EA 1CQDA 2P0RA 3U8EA 4W4UA 1MIRA 3LFYA 1GECE 2DCDA 1NLJA 1TU6A 3P5WA 4YYWA 3F75A 4CZWA 3BPFA 3KFQA 2E03A 2DZYA 1HUCB 2YJBA 3B79A 2WBFX 1X9YA 1KFUL 4FK5A 2AU1A 3E1ZB 2YJ9A 3OF9A 1NL6A 2FO5A 3O1GA 5A24A 4BSQA 3OISA 1PPNA 2Y6EA 3WXEA 3NHEA 4XR7A 1MDWA 2HXZA 4CDDB 3MTNA 4OEMA 1BQIA 1QXPA 4MZSA 2FRAA 2P86A 1CPJA 1EWPA 5F02A 5EF4A 2AYOA 2PADA 3HWNA 2FQ9A 2E00A 5JH3A 1MEMA 2B1NA 4MZOA 4BS6A 3N3KA 3KKUA 4BQVA 2F1GA 3PBHA 1YK8A 3S3QA 3QSDA 1U9WA 2AS8A 3M99A 1PCIA 1EWLA 1ICFA 1TL9A 2DCBA 1ZIVA 1THEA 4BPVA 2DC9A 1F2AA 1SP4B 4W5CA 2C0YA 3F5VA 3IHPA 1QMYA 3PW3A 3N3GA 1GMYA 1CTEA 1MHWA 1CV8A 1YALA 1F2BA 3HD3A 4P6EA 1ITOA 3K24A 1CJLA 2R9OA 3KSEA 5CVMA 3CBKA 2Y5BA 1EWMA 2AUZA 3P5UA 4OELA 3H8BA 3CH2X 1JQPA 2JQGR 2NQGA 3RVVA 4K7CA 1Q6KA 3OF8A 2DJFB 3USVA 3IEJA 1A6RA 1YVBA 3IOQA 5JA7A 1AYUA 4AXLA 3HHAA 1AYVA 3MORA 2PNSA 2H7JA 4CDCB 4XUIA 4WA6A 1PE6A 3I06A 1AECA 3BCNA 3QJ3A 4DMXA 2ATOA 4CDEB 2CB5A 2XU1A 3N4CA 2NQIA 1SNKA 2BDZA 3GCBA 1PADA 2VHSA 4P6GA 2R9FA 4RY2A 4X6IA 3HHIA 3I3TA 2VHFA 2R6NA 4YVAA 3MHHA 3ZUAA 2FT2A 2R9NA 3WXFA 1AU4A 3BOWA 4PP2E
chains in the Genus database with same CATH superfamily
5EGWA 4W5BA 4DMYA 3H6SA 1XKGA 1U9VA 1VJVA 2O6XA 1BP4A 2CIOA 3O65A 3MJ5A 2UZJA 5FPWA 4QH6A 4KLBA 1AYWA 4YYVA 4RF0A 3WXGA 3D6SA 1NPZA 4XZXA 1NQCA 1EWOA 3S3RA 2OZ2A 1S4VA 4QRXA 4YYRA 3KW9A 2DCCA 4R3DA 3W30A 2NQAA 2G7YA 4N79A 1MS6A 4PI3A 3TRKA 3CH3X 3PDFA 2BDLA 1AIMA 5K16A 1AU3A 4QBBA 3H8CA 5CHTA 3PNRA 1PBHA 3OVZA 1ZCMA 3MHSA 2B1MA 4PADA 3P5XA 1QDQA 1U9XA 2AYNA 2ACTA 1STFE 2G8EA 4I05A 3LXSA 4I07A 3BPMA 4BOPA 2XU3A 3ERVA 1NB3A 3TNXA 3OQCA 4FJCA 4I04A 3BY4A 5CVOB 4ZTBA 3O0UA 4IP3A 5JZEA 4QRGA 1DF0A 2R9CA 5CHVA 4Q8HA 2NQDB 3OVXA 1BY8A 2R9MA 4YV8A 3PSEA 1ME3A 4AXMA 3V6CA 1CB5A 2DCAA 1GCBA 2E01A 1Y4HA 1GLOA 2AVWA 2YJ2A 2DOSA 1FH0A 4QRVA 1F2CA 1DEUA 1PPDA 1TLOA 3IUTA 8PCHA 4OVZA 3RVWA 3PRPA 2ARYA 3IV2A 1KHPA 4BOQA 1CSBB 2FTDA 2PREA 2XU4A 3K8UA 4YYSA 3IMAA 3KX1A 4MSXA 3B21A 1KFXL 3H89A 3BC3A 2F7DA 2FUDA 2G8JA 2P7UA 4G54A 4OVZB 1M6DA 2IPPB 1YT7A 2DC6A 1MEGA 7PCKA 9PAPA 4CDFB 2DJGB 3PHUA 2XU5A 1QOLA 1AU0A 5CVNB 2E02A 2YJCA 3K9MA 5KO3A 5EZSA 4YYQA 1ME4A 1Y08A 1CS8A 5EZQA 2GHUA 2JTCA 1ATKA 3BWKA 3BBAA 2JRIA 1UKFA 2AIMA 2HD5A 3QT4A 3E9SA 1BGOA 4HWYA 2DC8A 4IUMA 3RVXA 2FYEA 5J94A 2HH5A 2G6DA 1K3BB 4N4ZA 2AUXA 4YYUA 1YZBA 1O0EA 1EF7A 1VSNA 2YJ8A 2FE8A 4PT5A 2JQFR 4HXDB 2OP3A 1POPA 3DF0A 3KWBX 3KWZA 1PIPA 4N8WA 3H7DA 4A5UA 2OULA 2DZZA 1NB5A 1PXVA 3AI8A 3CBJA 4PP1A 4BS5A 4FIPA 3P5VA 4Q8GA 1KXRA 2HHNA 2FRQA 1CVZA 2GFOA 2PBHA 4X6HA 1IWDA 6PADA 1KHQA 4RNAA 3BB7A 3V6EA 2IBIA 3TMPA 4REZA 1PPPA 2J7QA 1U5IA 1YK7A 4ZUXU 1PPOA 1AU2A 5PADA 2DC7A 4X6JA 1F29A 4BOUA 1U9QX 3C9EA 1CQDA 2P0RA 3U8EA 4W4UA 4RKXA 3PHWA 1MIRA 3RNVA 3LFYA 1GECE 2DCDA 5E6JA 1NLJA 1TU6A 3P5WA 4YYWA 3F75A 4CZWA 3BPFA 3KFQA 2E03A 2DZYA 1HUCB 3B79A 2YJBA 4P16A 2WBFX 3PT2A 1X9YA 1KFUL 4FK5A 2AU1A 3E1ZB 2YJ9A 4BOZA 2BU3A 3OF9A 1NL6A 2FO5A 3O1GA 3PHXA 5A24A 4BSQA 3OISA 1PPNA 2Y6EA 3WXEA 3NHEA 4XR7A 4D8EA 1MDWA 2HXZA 3MP2A 4CDDB 3MTNA 3ZNHA 4OEMA 1BQIA 1QXPA 4MZSA 2FRAA 2P86A 1CPJA 1EWPA 5F02A 5EF4A 2AYOA 4M0WA 2PADA 3HWNA 2FQ9A 2E00A 1DKIA 5JH3A 1MEMA 2B1NA 4MZOA 4BS6A 3N3KA 3KKUA 4BQVA 2F1GA 3PBHA 1YK8A 4GUAA 3S3QA 3QSDA 3W31A 1U9WA 2AS8A 3M99A 1PCIA 1EWLA 1ICFA 1TL9A 2DCBA 1ZIVA 1THEA 4BPVA 2DC9A 1F2AA 3PRMA 1SP4B 4W5CA 2C0YA 3F5VA 3IHPA 1PVJA 1QMYA 3PW3A 3N3GA 1GMYA 1CTEA 1MHWA 1CV8A 1YALA 1F2BA 3HD3A 4OW0A 4P6EA 1ITOA 3K24A 1CJLA 2R9OA 3KSEA 5CVMA 3CBKA 2Y5BA 2BTWA 1EWMA 2AUZA 3P5UA 4OELA 3H8BA 3CH2X 1JQPA 2JQGR 2NQGA 3RVVA 2Z84A 4K7CA 1Q6KA 3OF8A 2DJFB 3USVA 3MTVA 2BTWB 4RF1A 3IEJA 2HWKA 2J7QC 1A6RA 2AGAA 1YVBA 3IOQA 5JA7A 1AYUA 4AXLA 3HHAA 1AYVA 3MORA 2PNSA 2H7JA 4CDCB 4XUIA 4WA6A 1PE6A 3I06A 4MI7A 4WURA 1AECA 3BCNA 3QJ3A 4DMXA 2ATOA 3IFUA 4CDEB 2CB5A 2XU1A 3N4CA 2NQIA 4MM3B 1SNKA 4D8BA 2BDZA 3GCBA 1PADA 2VHSA 4P6GA 3C0RA 2R9FA 4RY2A 4X6IA 4BOSA 3HHIA 3I3TA 2VHFA 2R6NA 4YVAA 3MHHA 3ZUAA 2FT2A 2R9NA 3WXFA 1AU4A 3BOWA 4PP2E 4D8IA
chains in the Genus database with same CATH topology
5EGWA 3D9WA 4W5BA 4DMYA 3H6SA 1XKGA 1U9VA 1VJVA 2O6XA 4C5PA 1BP4A 2CIOA 5FPWA 4QH6A 4KLBA 1AYWA 4YYVA 3WXGA 3D6SA 1NPZA 1NQCA 1EWOA 3S3RA 2OZ2A 1S4VA 4QRXA 4BGFA 4YYRA 3KW9A 2DCCA 2NQAA 2G7YA 4N79A 1MS6A 4PI3A 3CH3X 3PDFA 2BDLA 1AIMA 5K16A 1AU3A 4QBBA 3H8CA 5CHTA 3PNRA 1PBHA 3OVZA 4NV7A 4B55A 1ZCMA 3MHSA 2B1MA 4PADA 3P5XA 1QDQA 1U9XA 2AYNA 2ACTA 1STFE 2G8EA 4I05A 3LXSA 4I07A 3BPMA 2XU3A 3ERVA 1NB3A 3TNXA 4FJCA 4I04A 5CVOB 3O0UA 4QRGA 1DF0A 2R9CA 5CHVA 4Q8HA 2NQDB 3OVXA 1BY8A 2R9MA 4YV8A 1ME3A 4AXMA 3V6CA 1CB5A 2DCAA 1GCBA 2E01A 1Y4HA 1GX3A 1GLOA 3LTWA 2YJ2A 2AVWA 1FH0A 4QRVA 1F2CA 1DEUA 1PPDA 1TLOA 3IUTA 8PCHA 3RVWA 2ARYA 3IV2A 1KHPA 1CSBB 2FTDA 2PREA 2XU4A 3K8UA 4YYSA 3IMAA 3KX1A 4MSXA 4NV8A 1KFXL 3H89A 3BC3A 2F7DA 2FUDA 2G8JA 2P7UA 4G54A 1M6DA 2IPPB 1YT7A 2DC6A 1MEGA 7PCKA 9PAPA 4CDFB 2DJGB 2XU5A 1QOLA 1AU0A 5CVNB 2E02A 2YJCA 3K9MA 4YYQA 1ME4A 1Y08A 1CS8A 4GUZA 2GHUA 1ATKA 3BWKA 2AIMA 2HD5A 3QT4A 1BGOA 4HWYA 2DC8A 3RVXA 2FYEA 5J94A 2HH5A 2G6DA 1K3BB 4N4ZA 2AUXA 4YYUA 1O0EA 1EF7A 1VSNA 2YJ8A 2JQFR 2OP3A 1POPA 3DF0A 3KWBX 3KWZA 1PIPA 4N8WA 3H7DA 1W4TA 2OULA 2DZZA 1NB5A 1PXVA 3AI8A 3CBJA 4PP1A 4BS5A 4FIPA 3P5VA 4Q8GA 1KXRA 2HHNA 2FRQA 1CVZA 2GFOA 2PBHA 4X6HA 1IWDA 6PADA 1KHQA 3V6EA 2IBIA 1PPPA 1U5IA 1YK7A 4ZUXU 1PPOA 1AU2A 5PADA 2DC7A 4X6JA 1F29A 1U9QX 3C9EA 1CQDA 2P0RA 3U8EA 4W4UA 1MIRA 3LFYA 1GECE 2DCDA 1NLJA 1TU6A 3P5WA 4YYWA 3F75A 4CZWA 3BPFA 3KFQA 2E03A 2DZYA 1HUCB 2YJBA 3B79A 2WBFX 1X9YA 1KFUL 4FK5A 2AU1A 3E1ZB 2YJ9A 3OF9A 1NL6A 2FO5A 3O1GA 5A24A 4BSQA 3OISA 1PPNA 2Y6EA 3WXEA 3NHEA 4XR7A 1MDWA 2HXZA 4CDDB 3MTNA 4OEMA 1BQIA 1QXPA 4MZSA 2FRAA 2P86A 1CPJA 1EWPA 5F02A 5EF4A 2AYOA 2PADA 3HWNA 2FQ9A 2E00A 5JH3A 1MEMA 2B1NA 4MZOA 4BS6A 3N3KA 3KKUA 4BQVA 2F1GA 3PBHA 1YK8A 3S3QA 3QSDA 2VFCA 1U9WA 2AS8A 3M99A 1PCIA 1EWLA 1ICFA 1TL9A 2BSZA 2DCBA 1ZIVA 1THEA 4BPVA 2DC9A 1F2AA 1SP4B 4W5CA 2C0YA 3F5VA 3IHPA 1QMYA 3PW3A 3N3GA 1GMYA 1CTEA 1MHWA 1CV8A 1YALA 1F2BA 3HD3A 4P6EA 1ITOA 3K24A 1CJLA 2R9OA 3KSEA 5CVMA 3CBKA 2Y5BA 1EWMA 2AUZA 3P5UA 4OELA 3H8BA 3CH2X 1JQPA 2JQGR 2NQGA 3RVVA 4K7CA 1Q6KA 3OF8A 2DJFB 3USVA 3IEJA 1W5RA 2VFBA 1A6RA 1YVBA 3IOQA 5JA7A 1AYUA 4AXLA 3HHAA 1AYVA 3MORA 2PNSA 2H7JA 4CDCB 4XUIA 4WA6A 1PE6A 3I06A 1E2TA 1AECA 3BCNA 3QJ3A 4DMXA 2ATOA 4CDEB 2CB5A 2XU1A 3N4CA 2NQIA 1SNKA 2BDZA 3GCBA 1PADA 2VHSA 4P6GA 2R9FA 4RY2A 4X6IA 3HHIA 3I3TA 2VHFA 2R6NA 4YVAA 3MHHA 3ZUAA 2FT2A 2R9NA 3WXFA 1AU4A 3BOWA 4PP2E 1W6FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EGW A;  4W5B A;  4DMY A;  3H6S A;  1XKG A;  1U9V A;  1VJV A;  2O6X A;  1BP4 A;  2CIO A;  5FPW A;  4QH6 A;  4KLB A;  1AYW A;  4YYV A;  3WXG A;  3D6S A;  1NPZ A;  1NQC A;  1EWO A;  3S3R A;  2OZ2 A;  1S4V A;  4QRX A;  4YYR A;  3KW9 A;  2DCC A;  2NQA A;  2G7Y A;  4N79 A;  1MS6 A;  4PI3 A;  3CH3 X;  3PDF A;  2BDL A;  1AIM A;  5K16 A;  1AU3 A;  4QBB A;  3H8C A;  5CHT A;  3PNR A;  1PBH A;  3OVZ A;  1ZCM A;  3MHS A;  2B1M A;  4PAD A;  3P5X A;  1QDQ A;  1U9X A;  2AYN A;  2ACT A;  1STF E;  2G8E A;  4I05 A;  3LXS A;  4I07 A;  3BPM A;  2XU3 A;  3ERV A;  1NB3 A;  3TNX A;  4FJC A;  4I04 A;  5CVO B;  3O0U A;  4QRG A;  1DF0 A;  2R9C A;  5CHV A;  4Q8H A;  2NQD B;  3OVX A;  1BY8 A;  2R9M A;  4YV8 A;  1ME3 A;  4AXM A;  3V6C A;  1CB5 A;  2DCA A;  1GCB A;  2E01 A;  1Y4H A;  1GLO A;  2AVW A;  2YJ2 A;  1FH0 A;  4QRV A;  1F2C A;  1DEU A;  1PPD A;  1TLO A;  3IUT A;  8PCH A;  3RVW A;  2ARY A;  3IV2 A;  1KHP A;  1CSB B;  2FTD A;  2PRE A;  2XU4 A;  3K8U A;  4YYS A;  3IMA A;  3KX1 A;  4MSX A;  1KFX L;  3H89 A;  3BC3 A;  2F7D A;  2FUD A;  2G8J A;  2P7U A;  4G54 A;  1M6D A;  2IPP B;  1YT7 A;  2DC6 A;  1MEG A;  7PCK A;  9PAP A;  4CDF B;  2DJG B;  2XU5 A;  1QOL A;  1AU0 A;  5CVN B;  2E02 A;  2YJC A;  3K9M A;  4YYQ A;  1ME4 A;  1Y08 A;  1CS8 A;  2GHU A;  1ATK A;  3BWK A;  2AIM A;  2HD5 A;  3QT4 A;  1BGO A;  4HWY A;  2DC8 A;  3RVX A;  2FYE A;  5J94 A;  2HH5 A;  2G6D A;  1K3B B;  4N4Z A;  2AUX A;  4YYU A;  1O0E A;  1EF7 A;  1VSN A;  2YJ8 A;  2JQF R;  2OP3 A;  1POP A;  3DF0 A;  3KWB X;  3KWZ A;  1PIP A;  4N8W A;  3H7D A;  2OUL A;  2DZZ A;  1NB5 A;  1PXV A;  3AI8 A;  3CBJ A;  4PP1 A;  4BS5 A;  4FIP A;  3P5V A;  4Q8G A;  1KXR A;  2HHN A;  2FRQ A;  1CVZ A;  2GFO A;  2PBH A;  4X6H A;  1IWD A;  6PAD A;  1KHQ A;  3V6E A;  2IBI A;  1PPP A;  1U5I A;  1YK7 A;  4ZUX U;  1PPO A;  1AU2 A;  5PAD A;  2DC7 A;  4X6J A;  1F29 A;  1U9Q X;  3C9E A;  1CQD A;  2P0R A;  3U8E A;  4W4U A;  1MIR A;  3LFY A;  1GEC E;  2DCD A;  1NLJ A;  1TU6 A;  3P5W A;  4YYW A;  3F75 A;  4CZW A;  3BPF A;  3KFQ A;  2E03 A;  2DZY A;  1HUC B;  2YJB A;  3B79 A;  2WBF X;  1X9Y A;  1KFU L;  4FK5 A;  2AU1 A;  3E1Z B;  2YJ9 A;  3OF9 A;  1NL6 A;  2FO5 A;  3O1G A;  5A24 A;  4BSQ A;  3OIS A;  1PPN A;  2Y6E A;  3WXE A;  3NHE A;  4XR7 A;  1MDW A;  2HXZ A;  4CDD B;  3MTN A;  4OEM A;  1BQI A;  1QXP A;  4MZS A;  2FRA A;  2P86 A;  1CPJ A;  1EWP A;  5F02 A;  5EF4 A;  2AYO A;  2PAD A;  3HWN A;  2FQ9 A;  2E00 A;  5JH3 A;  1MEM A;  2B1N A;  4MZO A;  4BS6 A;  3N3K A;  3KKU A;  4BQV A;  2F1G A;  3PBH A;  1YK8 A;  3S3Q A;  3QSD A;  1U9W A;  2AS8 A;  3M99 A;  1PCI A;  1EWL A;  1ICF A;  1TL9 A;  2DCB A;  1ZIV A;  1THE A;  4BPV A;  2DC9 A;  1F2A A;  1SP4 B;  4W5C A;  2C0Y A;  3F5V A;  3IHP A;  1QMY A;  3PW3 A;  3N3G A;  1GMY A;  1CTE A;  1MHW A;  1CV8 A;  1YAL A;  1F2B A;  3HD3 A;  4P6E A;  1ITO A;  3K24 A;  1CJL A;  2R9O A;  3KSE A;  5CVM A;  3CBK A;  2Y5B A;  1EWM A;  2AUZ A;  3P5U A;  4OEL A;  3H8B A;  3CH2 X;  1JQP A;  2JQG R;  2NQG A;  3RVV A;  4K7C A;  1Q6K A;  3OF8 A;  2DJF B;  3USV A;  3IEJ A;  1A6R A;  1YVB A;  3IOQ A;  5JA7 A;  1AYU A;  4AXL A;  3HHA A;  1AYV A;  3MOR A;  2PNS A;  2H7J A;  4CDC B;  4XUI A;  4WA6 A;  1PE6 A;  3I06 A;  1AEC A;  3BCN A;  3QJ3 A;  4DMX A;  2ATO A;  4CDE B;  2CB5 A;  2XU1 A;  3N4C A;  2NQI A;  1SNK A;  2BDZ A;  3GCB A;  1PAD A;  2VHS A;  4P6G A;  2R9F A;  4RY2 A;  4X6I A;  3HHI A;  3I3T A;  2VHF A;  2R6N A;  4YVA A;  3MHH A;  3ZUA A;  2FT2 A;  2R9N A;  3WXF A;  1AU4 A;  3BOW A;  4PP2 E; 
#chains in the Genus database with same CATH topology
 5EGW A;  4W5B A;  4DMY A;  3H6S A;  1XKG A;  1U9V A;  1VJV A;  2O6X A;  1BP4 A;  2CIO A;  3O65 A;  3MJ5 A;  2UZJ A;  5FPW A;  4QH6 A;  4KLB A;  1AYW A;  4YYV A;  4RF0 A;  3WXG A;  3D6S A;  1NPZ A;  4XZX A;  1NQC A;  1EWO A;  3S3R A;  2OZ2 A;  1S4V A;  4QRX A;  4YYR A;  3KW9 A;  2DCC A;  4R3D A;  3W30 A;  2NQA A;  2G7Y A;  4N79 A;  1MS6 A;  4PI3 A;  3TRK A;  3CH3 X;  3PDF A;  2BDL A;  1AIM A;  5K16 A;  1AU3 A;  4QBB A;  3H8C A;  5CHT A;  3PNR A;  1PBH A;  3OVZ A;  1ZCM A;  3MHS A;  2B1M A;  4PAD A;  3P5X A;  1QDQ A;  1U9X A;  2AYN A;  2ACT A;  1STF E;  2G8E A;  4I05 A;  3LXS A;  4I07 A;  3BPM A;  4BOP A;  2XU3 A;  3ERV A;  1NB3 A;  3TNX A;  3OQC A;  4FJC A;  4I04 A;  3BY4 A;  5CVO B;  4ZTB A;  3O0U A;  4IP3 A;  5JZE A;  4QRG A;  1DF0 A;  2R9C A;  5CHV A;  4Q8H A;  2NQD B;  3OVX A;  1BY8 A;  2R9M A;  4YV8 A;  3PSE A;  1ME3 A;  4AXM A;  3V6C A;  1CB5 A;  2DCA A;  1GCB A;  2E01 A;  1Y4H A;  1GLO A;  2AVW A;  2YJ2 A;  2DOS A;  1FH0 A;  4QRV A;  1F2C A;  1DEU A;  1PPD A;  1TLO A;  3IUT A;  8PCH A;  4OVZ A;  3RVW A;  3PRP A;  2ARY A;  3IV2 A;  1KHP A;  4BOQ A;  1CSB B;  2FTD A;  2PRE A;  2XU4 A;  3K8U A;  4YYS A;  3IMA A;  3KX1 A;  4MSX A;  3B21 A;  1KFX L;  3H89 A;  3BC3 A;  2F7D A;  2FUD A;  2G8J A;  2P7U A;  4G54 A;  4OVZ B;  1M6D A;  2IPP B;  1YT7 A;  2DC6 A;  1MEG A;  7PCK A;  9PAP A;  4CDF B;  2DJG B;  3PHU A;  2XU5 A;  1QOL A;  1AU0 A;  5CVN B;  2E02 A;  2YJC A;  3K9M A;  5KO3 A;  5EZS A;  4YYQ A;  1ME4 A;  1Y08 A;  1CS8 A;  5EZQ A;  2GHU A;  2JTC A;  1ATK A;  3BWK A;  3BBA A;  2JRI A;  1UKF A;  2AIM A;  2HD5 A;  3QT4 A;  3E9S A;  1BGO A;  4HWY A;  2DC8 A;  4IUM A;  3RVX A;  2FYE A;  5J94 A;  2HH5 A;  2G6D A;  1K3B B;  4N4Z A;  2AUX A;  4YYU A;  1YZB A;  1O0E A;  1EF7 A;  1VSN A;  2YJ8 A;  2FE8 A;  4PT5 A;  2JQF R;  4HXD B;  2OP3 A;  1POP A;  3DF0 A;  3KWB X;  3KWZ A;  1PIP A;  4N8W A;  3H7D A;  4A5U A;  2OUL A;  2DZZ A;  1NB5 A;  1PXV A;  3AI8 A;  3CBJ A;  4PP1 A;  4BS5 A;  4FIP A;  3P5V A;  4Q8G A;  1KXR A;  2HHN A;  2FRQ A;  1CVZ A;  2GFO A;  2PBH A;  4X6H A;  1IWD A;  6PAD A;  1KHQ A;  4RNA A;  3BB7 A;  3V6E A;  2IBI A;  3TMP A;  4REZ A;  1PPP A;  2J7Q A;  1U5I A;  1YK7 A;  4ZUX U;  1PPO A;  1AU2 A;  5PAD A;  2DC7 A;  4X6J A;  1F29 A;  4BOU A;  1U9Q X;  3C9E A;  1CQD A;  2P0R A;  3U8E A;  4W4U A;  4RKX A;  3PHW A;  1MIR A;  3RNV A;  3LFY A;  1GEC E;  2DCD A;  5E6J A;  1NLJ A;  1TU6 A;  3P5W A;  4YYW A;  3F75 A;  4CZW A;  3BPF A;  3KFQ A;  2E03 A;  2DZY A;  1HUC B;  3B79 A;  2YJB A;  4P16 A;  2WBF X;  3PT2 A;  1X9Y A;  1KFU L;  4FK5 A;  2AU1 A;  3E1Z B;  2YJ9 A;  4BOZ A;  2BU3 A;  3OF9 A;  1NL6 A;  2FO5 A;  3O1G A;  3PHX A;  5A24 A;  4BSQ A;  3OIS A;  1PPN A;  2Y6E A;  3WXE A;  3NHE A;  4XR7 A;  4D8E A;  1MDW A;  2HXZ A;  3MP2 A;  4CDD B;  3MTN A;  3ZNH A;  4OEM A;  1BQI A;  1QXP A;  4MZS A;  2FRA A;  2P86 A;  1CPJ A;  1EWP A;  5F02 A;  5EF4 A;  2AYO A;  4M0W A;  2PAD A;  3HWN A;  2FQ9 A;  2E00 A;  1DKI A;  5JH3 A;  1MEM A;  2B1N A;  4MZO A;  4BS6 A;  3N3K A;  3KKU A;  4BQV A;  2F1G A;  3PBH A;  1YK8 A;  4GUA A;  3S3Q A;  3QSD A;  3W31 A;  1U9W A;  2AS8 A;  3M99 A;  1PCI A;  1EWL A;  1ICF A;  1TL9 A;  2DCB A;  1ZIV A;  1THE A;  4BPV A;  2DC9 A;  1F2A A;  3PRM A;  1SP4 B;  4W5C A;  2C0Y A;  3F5V A;  3IHP A;  1PVJ A;  1QMY A;  3PW3 A;  3N3G A;  1GMY A;  1CTE A;  1MHW A;  1CV8 A;  1YAL A;  1F2B A;  3HD3 A;  4OW0 A;  4P6E A;  1ITO A;  3K24 A;  1CJL A;  2R9O A;  3KSE A;  5CVM A;  3CBK A;  2Y5B A;  2BTW A;  1EWM A;  2AUZ A;  3P5U A;  4OEL A;  3H8B A;  3CH2 X;  1JQP A;  2JQG R;  2NQG A;  3RVV A;  2Z84 A;  4K7C A;  1Q6K A;  3OF8 A;  2DJF B;  3USV A;  3MTV A;  2BTW B;  4RF1 A;  3IEJ A;  2HWK A;  2J7Q C;  1A6R A;  2AGA A;  1YVB A;  3IOQ A;  5JA7 A;  1AYU A;  4AXL A;  3HHA A;  1AYV A;  3MOR A;  2PNS A;  2H7J A;  4CDC B;  4XUI A;  4WA6 A;  1PE6 A;  3I06 A;  4MI7 A;  4WUR A;  1AEC A;  3BCN A;  3QJ3 A;  4DMX A;  2ATO A;  3IFU A;  4CDE B;  2CB5 A;  2XU1 A;  3N4C A;  2NQI A;  4MM3 B;  1SNK A;  4D8B A;  2BDZ A;  3GCB A;  1PAD A;  2VHS A;  4P6G A;  3C0R A;  2R9F A;  4RY2 A;  4X6I A;  4BOS A;  3HHI A;  3I3T A;  2VHF A;  2R6N A;  4YVA A;  3MHH A;  3ZUA A;  2FT2 A;  2R9N A;  3WXF A;  1AU4 A;  3BOW A;  4PP2 E;  4D8I A; 
#chains in the Genus database with same CATH homology
 5EGW A;  3D9W A;  4W5B A;  4DMY A;  3H6S A;  1XKG A;  1U9V A;  1VJV A;  2O6X A;  4C5P A;  1BP4 A;  2CIO A;  5FPW A;  4QH6 A;  4KLB A;  1AYW A;  4YYV A;  3WXG A;  3D6S A;  1NPZ A;  1NQC A;  1EWO A;  3S3R A;  2OZ2 A;  1S4V A;  4QRX A;  4BGF A;  4YYR A;  3KW9 A;  2DCC A;  2NQA A;  2G7Y A;  4N79 A;  1MS6 A;  4PI3 A;  3CH3 X;  3PDF A;  2BDL A;  1AIM A;  5K16 A;  1AU3 A;  4QBB A;  3H8C A;  5CHT A;  3PNR A;  1PBH A;  3OVZ A;  4NV7 A;  4B55 A;  1ZCM A;  3MHS A;  2B1M A;  4PAD A;  3P5X A;  1QDQ A;  1U9X A;  2AYN A;  2ACT A;  1STF E;  2G8E A;  4I05 A;  3LXS A;  4I07 A;  3BPM A;  2XU3 A;  3ERV A;  1NB3 A;  3TNX A;  4FJC A;  4I04 A;  5CVO B;  3O0U A;  4QRG A;  1DF0 A;  2R9C A;  5CHV A;  4Q8H A;  2NQD B;  3OVX A;  1BY8 A;  2R9M A;  4YV8 A;  1ME3 A;  4AXM A;  3V6C A;  1CB5 A;  2DCA A;  1GCB A;  2E01 A;  1Y4H A;  1GX3 A;  1GLO A;  3LTW A;  2YJ2 A;  2AVW A;  1FH0 A;  4QRV A;  1F2C A;  1DEU A;  1PPD A;  1TLO A;  3IUT A;  8PCH A;  3RVW A;  2ARY A;  3IV2 A;  1KHP A;  1CSB B;  2FTD A;  2PRE A;  2XU4 A;  3K8U A;  4YYS A;  3IMA A;  3KX1 A;  4MSX A;  4NV8 A;  1KFX L;  3H89 A;  3BC3 A;  2F7D A;  2FUD A;  2G8J A;  2P7U A;  4G54 A;  1M6D A;  2IPP B;  1YT7 A;  2DC6 A;  1MEG A;  7PCK A;  9PAP A;  4CDF B;  2DJG B;  2XU5 A;  1QOL A;  1AU0 A;  5CVN B;  2E02 A;  2YJC A;  3K9M A;  4YYQ A;  1ME4 A;  1Y08 A;  1CS8 A;  4GUZ A;  2GHU A;  1ATK A;  3BWK A;  2AIM A;  2HD5 A;  3QT4 A;  1BGO A;  4HWY A;  2DC8 A;  3RVX A;  2FYE A;  5J94 A;  2HH5 A;  2G6D A;  1K3B B;  4N4Z A;  2AUX A;  4YYU A;  1O0E A;  1EF7 A;  1VSN A;  2YJ8 A;  2JQF R;  2OP3 A;  1POP A;  3DF0 A;  3KWB X;  3KWZ A;  1PIP A;  4N8W A;  3H7D A;  1W4T A;  2OUL A;  2DZZ A;  1NB5 A;  1PXV A;  3AI8 A;  3CBJ A;  4PP1 A;  4BS5 A;  4FIP A;  3P5V A;  4Q8G A;  1KXR A;  2HHN A;  2FRQ A;  1CVZ A;  2GFO A;  2PBH A;  4X6H A;  1IWD A;  6PAD A;  1KHQ A;  3V6E A;  2IBI A;  1PPP A;  1U5I A;  1YK7 A;  4ZUX U;  1PPO A;  1AU2 A;  5PAD A;  2DC7 A;  4X6J A;  1F29 A;  1U9Q X;  3C9E A;  1CQD A;  2P0R A;  3U8E A;  4W4U A;  1MIR A;  3LFY A;  1GEC E;  2DCD A;  1NLJ A;  1TU6 A;  3P5W A;  4YYW A;  3F75 A;  4CZW A;  3BPF A;  3KFQ A;  2E03 A;  2DZY A;  1HUC B;  2YJB A;  3B79 A;  2WBF X;  1X9Y A;  1KFU L;  4FK5 A;  2AU1 A;  3E1Z B;  2YJ9 A;  3OF9 A;  1NL6 A;  2FO5 A;  3O1G A;  5A24 A;  4BSQ A;  3OIS A;  1PPN A;  2Y6E A;  3WXE A;  3NHE A;  4XR7 A;  1MDW A;  2HXZ A;  4CDD B;  3MTN A;  4OEM A;  1BQI A;  1QXP A;  4MZS A;  2FRA A;  2P86 A;  1CPJ A;  1EWP A;  5F02 A;  5EF4 A;  2AYO A;  2PAD A;  3HWN A;  2FQ9 A;  2E00 A;  5JH3 A;  1MEM A;  2B1N A;  4MZO A;  4BS6 A;  3N3K A;  3KKU A;  4BQV A;  2F1G A;  3PBH A;  1YK8 A;  3S3Q A;  3QSD A;  2VFC A;  1U9W A;  2AS8 A;  3M99 A;  1PCI A;  1EWL A;  1ICF A;  1TL9 A;  2BSZ A;  2DCB A;  1ZIV A;  1THE A;  4BPV A;  2DC9 A;  1F2A A;  1SP4 B;  4W5C A;  2C0Y A;  3F5V A;  3IHP A;  1QMY A;  3PW3 A;  3N3G A;  1GMY A;  1CTE A;  1MHW A;  1CV8 A;  1YAL A;  1F2B A;  3HD3 A;  4P6E A;  1ITO A;  3K24 A;  1CJL A;  2R9O A;  3KSE A;  5CVM A;  3CBK A;  2Y5B A;  1EWM A;  2AUZ A;  3P5U A;  4OEL A;  3H8B A;  3CH2 X;  1JQP A;  2JQG R;  2NQG A;  3RVV A;  4K7C A;  1Q6K A;  3OF8 A;  2DJF B;  3USV A;  3IEJ A;  1W5R A;  2VFB A;  1A6R A;  1YVB A;  3IOQ A;  5JA7 A;  1AYU A;  4AXL A;  3HHA A;  1AYV A;  3MOR A;  2PNS A;  2H7J A;  4CDC B;  4XUI A;  4WA6 A;  1PE6 A;  3I06 A;  1E2T A;  1AEC A;  3BCN A;  3QJ3 A;  4DMX A;  2ATO A;  4CDE B;  2CB5 A;  2XU1 A;  3N4C A;  2NQI A;  1SNK A;  2BDZ A;  3GCB A;  1PAD A;  2VHS A;  4P6G A;  2R9F A;  4RY2 A;  4X6I A;  3HHI A;  3I3T A;  2VHF A;  2R6N A;  4YVA A;  3MHH A;  3ZUA A;  2FT2 A;  2R9N A;  3WXF A;  1AU4 A;  3BOW A;  4PP2 E;  1W6F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...